DTASelect v1.9
/auto/gtl/ms/gtl_rpal/gtl_rpal_proteome/global_analysis/dbd_tryptic_1/wt_anaer_light_2
/auto/GAT/db/gtl/Rpal/rpal_3_plus_contams.fasta
DBDigger 1.05 in SQT format.

Jump to the summary table.

sequest.params modifications:
trueUse criteria
25.0Minimum +1 XCorr
30.0Minimum +2 XCorr
45.0Minimum +3 XCorr
0.08Minimum DeltCN
1Minimum charge state
3Maximum charge state
0.0Minimum ion proportion
1000Maximum Sp rank
-1.0Minimum Sp score
IncludeModified peptide inclusion
AnyTryptic status requirement
trueMultiple, ambiguous IDs allowed
IgnorePeptide validation handling
XCorrPurge duplicate peptides by protein
falseInclude only loci with unique peptide
falseRemove subset proteins
IgnoreLocus validation handling
0Minimum modified peptides per locus
10Minimum redundancy for low coverage loci
2Minimum peptides per locus

Locus Key:

Validation StatusLocusSequence CountSpectrum CountSequence CoverageLengthMolWtpIDescriptive Name

Similarity Key:

Locus# of identical peptides# of differing peptides

URPA01926628799.1%322339965.8mdh malate dehydrogenase 214807:215775 reverse MW:33996
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_pellet_full.4025.4025.351.01380.4158564257.944257.971178.045.7%2M.ARDKIALIGSGQIGGTLAHLVGLKELGDVVLFDIAEGVPQGK.A3
*rpal_wt_anaer_light_2_pellet_5.1739.1739.134.85140.4742621918.351919.321113.046.7%2K.IALIGSGQIGGTLAHLVGLK.E1
*rpal_wt_anaer_light_2_crude_1a.3398.3398.267.62520.6956711918.371919.321186.058.3%8K.IALIGSGQIGGTLAHLVGLK.E2
*rpal_wt_anaer_light_2_crude_full.3022.3022.353.79170.4601041919.491919.321226.050.8%4K.IALIGSGQIGGTLAHLVGLK.E3
*rpal_wt_anaer_light_2_cleared_full.4413.4413.368.11430.5437233787.423787.441189.047.3%10K.IALIGSGQIGGTLAHLVGLKELGDVVLFDIAEGVPQGK.A3
*rpal_wt_anaer_light_2_pellet_1a.3270.3270.368.3620.3976541886.41887.141216.063.2%1K.ELGDVVLFDIAEGVPQGK.A3
*rpal_wt_anaer_light_2_pellet_2a.2970.2970.126.14390.3607881886.931887.14175.040.7%1K.ELGDVVLFDIAEGVPQGK.A1
*rpal_wt_anaer_light_2_cleared_2.1821.1821.276.42680.6044221651.71651.771239.075.0%9K.ALDIAESSPVDGFDSK.L2
*rpal_wt_anaer_light_2_pellet_5.1048.1048.161.88650.6878271653.991651.771245.080.0%10K.ALDIAESSPVDGFDSK.L1
*rpal_wt_anaer_light_2_pellet_5.1332.1332.238.43090.4916413085.813085.31196.030.8%1K.ALDIAESSPVDGFDSKLTGANSYEAIEGAR.V2
*rpal_wt_anaer_light_2_pellet_full.2341.2341.371.48570.515163086.43085.311125.052.9%3K.ALDIAESSPVDGFDSKLTGANSYEAIEGAR.V3
*rpal_wt_anaer_light_2_crude_1a.1061.1061.271.28370.6414891452.271452.561127.076.9%10K.LTGANSYEAIEGAR.V2
*rpal_wt_anaer_light_2_crude_4.852.852.139.47060.5864111454.711452.561164.071.4%3K.LTGANSYEAIEGAR.V1
*rpal_wt_anaer_light_2_pellet_full.1114.1114.259.41280.4614781011.511011.251255.078.9%11R.VVIVTAGVPR.K2
*rpal_wt_anaer_light_2_pellet_2a.2024.2024.234.51140.4715772679.382680.2310.038.6%1R.VVIVTAGVPRKPGMSRDDLLSINLK.V2
*rpal_wt_anaer_light_2_pellet_5.947.947.130.3910.367771687.11688.01208.052.2%1R.KPGMSRDDLLSINLK.V1
*rpal_wt_anaer_light_2_pellet_2.1646.1646.238.99330.4022261688.171688.0116.055.6%2R.KPGMSRDDLLSINLK.V2
*rpal_wt_anaer_light_2_pellet_2a.1909.1909.131.91780.4339521030.961031.191168.078.6%1R.DDLLSINLK.V1
*rpal_wt_anaer_light_2_pellet_1.2246.2246.241.20340.4241791032.361031.191245.068.8%2R.DDLLSINLK.V2
*rpal_wt_anaer_light_2_pellet_2a.393.393.133.79720.4225911159.781160.42112.066.7%1K.VMEQVGAGIKK.Y1
*rpal_wt_anaer_light_2_pellet_1.543.543.241.52890.494281161.881160.42188.070.0%4K.VMEQVGAGIKK.Y2
*rpal_wt_anaer_light_2_pellet_full.4253.4253.266.86610.7102132708.812709.251144.057.1%4K.KYAPDAFVICITNPLDAMVWALQK.A2
*rpal_wt_anaer_light_2_pellet_2a.4684.4684.275.68610.7347492580.282581.071204.063.4%6K.YAPDAFVICITNPLDAMVWALQK.A2
*rpal_wt_anaer_light_2_pellet_full.4591.4591.365.24630.444792581.222581.071124.054.5%3K.YAPDAFVICITNPLDAMVWALQK.A3
*rpal_wt_anaer_light_2_crude_3.1388.1388.264.93960.7294211928.591928.311234.065.7%3K.ASGLPAKKVVGMAGVLDSAR.F2
*rpal_wt_anaer_light_2_pellet_1a.1890.1890.351.76010.4413481929.21928.311180.046.7%2K.ASGLPAKKVVGMAGVLDSAR.F3
*rpal_wt_anaer_light_2_pellet_2a.1243.1243.134.32690.4776341302.841303.57198.070.0%2K.KVVGMAGVLDSAR.F1
*rpal_wt_anaer_light_2_crude_1.919.919.261.8820.3318431303.21303.571120.075.0%4K.KVVGMAGVLDSAR.F2
*rpal_wt_anaer_light_2_crude_1.929.929.354.61520.3290991303.361303.571252.069.2%2K.KVVGMAGVLDSAR.F3
*rpal_wt_anaer_light_2_pellet_2a.1492.1492.128.68360.3926041174.881175.39168.057.9%2K.VVGMAGVLDSAR.F1
*rpal_wt_anaer_light_2_crude_full.1214.1214.263.89670.532271175.091175.391255.078.3%8K.VVGMAGVLDSAR.F2
*rpal_wt_anaer_light_2_pellet_2a.4494.4494.353.37490.3674823370.313371.831103.044.6%5R.YFLADEFNVSVEDVTAFVLGGHGDTMVPLVK.Y3
*rpal_wt_anaer_light_2_pellet_5.2291.2291.231.53350.3633253372.183371.83164.027.3%1R.YFLADEFNVSVEDVTAFVLGGHGDTMVPLVK.Y2
*rpal_wt_anaer_light_2_crude_full.2349.2349.249.40190.6117461473.551473.751170.057.7%15K.YSTVAGIPLPDLVK.M2
*rpal_wt_anaer_light_2_crude_4.2481.2481.152.24530.6853841475.911473.751219.077.3%15K.YSTVAGIPLPDLVK.M1
*rpal_wt_anaer_light_2_pellet_1.556.556.239.26760.499486937.14937.0671239.062.5%1K.MGWTSQAR.L2
*rpal_wt_anaer_light_2_pellet_2.557.557.128.2970.381178859.62859.9551144.081.8%2R.LDEIVDR.T1
*rpal_wt_anaer_light_2_pellet_1a.502.502.244.98140.291316859.73859.9551253.084.6%4R.LDEIVDR.T2
*rpal_wt_anaer_light_2_pellet_2.1652.1652.242.2610.5162511386.81385.611118.050.0%3R.TRNGGAEIVNLLK.T2
*rpal_wt_anaer_light_2_crude_full.1526.1526.265.75580.5879531127.861128.311231.085.0%6R.NGGAEIVNLLK.T2
*rpal_wt_anaer_light_2_cleared_2a.1686.1686.135.96280.5594841127.881128.31116.075.0%8R.NGGAEIVNLLK.T1
*rpal_wt_anaer_light_2_pellet_3.3849.3849.268.71540.7137062138.042137.421145.066.7%8K.TGSAFYAPASSAIAMAESYLK.D2
*rpal_wt_anaer_light_2_crude_2.3706.3706.369.07080.3660462138.342137.421126.057.6%4K.TGSAFYAPASSAIAMAESYLK.D3
*rpal_wt_anaer_light_2_pellet_full.3268.3268.357.05030.4261172380.562380.681216.047.1%3K.TGSAFYAPASSAIAMAESYLKDK.K3
*rpal_wt_anaer_light_2_cleared_full.3258.3258.258.3750.7016692381.412380.681141.052.6%10K.TGSAFYAPASSAIAMAESYLKDK.K2
*rpal_wt_anaer_light_2_pellet_2a.3125.3125.231.97510.3720112508.062508.851161.028.6%1K.TGSAFYAPASSAIAMAESYLKDKK.R2
*rpal_wt_anaer_light_2_pellet_full.2765.2765.345.62070.3046932664.142665.041172.045.3%1K.TGSAFYAPASSAIAMAESYLKDKKR.V3
*rpal_wt_anaer_light_2_pellet_full.2763.2763.234.66310.4067842664.242665.041168.031.8%2K.TGSAFYAPASSAIAMAESYLKDKKR.V2
*rpal_wt_anaer_light_2_cleared_3.2197.2197.345.37430.2654543524.353525.1114.035.4%1K.RVVPVAAHLNGEYGVKDMYVGVPVVIGDKGVER.I3
*rpal_wt_anaer_light_2_crude_5.694.694.149.12160.606431553.071553.81165.071.4%2R.VVPVAAHLNGEYGVK.D1
*rpal_wt_anaer_light_2_crude_1a.1113.1113.248.89330.5925941553.451553.8152.064.0%6R.VVPVAAHLNGEYGVK.D2
*rpal_wt_anaer_light_2_crude_2a.1859.1859.152.21110.701151391.651392.661209.081.0%10K.DMYVGVPVVIGDK.G1
*rpal_wt_anaer_light_2_crude_1a.1986.1986.257.9990.7175241393.311392.661246.070.8%5K.DMYVGVPVVIGDK.G2
*rpal_wt_anaer_light_2_crude_5.979.979.131.70670.527331833.061834.15173.053.8%4K.DMYVGVPVVIGDKGVER.I1
*rpal_wt_anaer_light_2_crude_3.1745.1745.260.44970.5944361833.781834.151157.064.5%8K.DMYVGVPVVIGDKGVER.I2
*rpal_wt_anaer_light_2_pellet_3.1468.1468.254.60940.6893471833.731834.081197.065.5%2R.IVEIELAGKDKEAFDR.S2
*rpal_wt_anaer_light_2_pellet_full.1321.1321.355.95820.4203171834.551834.081184.057.7%2R.IVEIELAGKDKEAFDR.S3
*rpal_wt_anaer_light_2_crude_2a.1707.1707.143.7910.5791531274.771275.511140.073.7%3R.SVAAVQGLVEACK.K1
*rpal_wt_anaer_light_2_pellet_1.2184.2184.265.930.7736511275.061275.511229.079.2%3R.SVAAVQGLVEACK.K2
*rpal_wt_anaer_light_2_pellet_full.1495.1495.140.49790.576051402.731403.691128.071.4%7R.SVAAVQGLVEACKK.I1
*rpal_wt_anaer_light_2_pellet_1a.1852.1852.252.58090.6900951403.441403.691200.072.0%9R.SVAAVQGLVEACKK.I2
*rpal_wt_anaer_light_2_pellet_full.1493.1493.347.19550.3512241404.521403.691212.052.3%1R.SVAAVQGLVEACKK.I3
*rpal_wt_anaer_light_2_pellet_2a.934.934.129.57240.412655982.88983.21160.071.4%4K.KIAPDLLGR.-1
*rpal_wt_anaer_light_2_pellet_full.925.925.239.64720.530484983.39983.21226.064.7%1K.KIAPDLLGR.-2
*rpal_wt_anaer_light_2_crude_1a.729.729.128.8990.403523854.53855.0261144.075.0%2K.IAPDLLGR.-1
*rpal_wt_anaer_light_2_crude_full.631.631.237.89620.570287856.04855.026197.066.7%5K.IAPDLLGR.-2

URPA2692143897.7%130143684.2rnpO RNA polymerase omega subunit 3063234:3063626 forward MW:14368
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_pellet_2.1502.1502.239.17550.4155961733.791733.94178.048.1%1M.ARVTVEDCIDKVDNR.F2
*rpal_wt_anaer_light_2_pellet_1a.3160.3160.354.00740.3906172870.092870.311237.053.7%1M.ARVTVEDCIDKVDNRFDLVLLAAHR.A3
*rpal_wt_anaer_light_2_crude_1a.1659.1659.361.00230.4591472514.942515.851172.051.4%4R.MISSGSPLTIDRDNDKNPVVSLR.E3
*rpal_wt_anaer_light_2_pellet_2a.1686.1686.233.69190.4252772515.452515.851193.034.1%4R.MISSGSPLTIDRDNDKNPVVSLR.E2
*rpal_wt_anaer_light_2_crude_4.1125.1125.145.48850.5480571458.841459.591164.075.0%4R.EIADQTISPEDLK.E1
*rpal_wt_anaer_light_2_pellet_2.1497.1497.240.73570.4440871459.481459.591206.050.0%2R.EIADQTISPEDLK.E2
*rpal_wt_anaer_light_2_pellet_2a.2545.2545.245.05870.5237392523.072523.8119.048.7%5R.EIADQTISPEDLKEELVHSLQK.F2
*rpal_wt_anaer_light_2_pellet_1a.2834.2834.349.070.3851332523.552523.81231.049.2%1R.EIADQTISPEDLKEELVHSLQK.F3
*rpal_wt_anaer_light_2_pellet_2a.429.429.138.6930.5723081082.681083.231161.085.7%2K.EELVHSLQK.F1
*rpal_wt_anaer_light_2_pellet_5.1452.1452.238.84090.5465483463.823462.721137.030.5%1K.FVEVDEPEPDTVPLIGSAGASVDADDTEVAMER.M2
*rpal_wt_anaer_light_2_pellet_2a.2640.2640.350.28070.2936063463.983462.721238.037.9%1K.FVEVDEPEPDTVPLIGSAGASVDADDTEVAMER.M3
*rpal_wt_anaer_light_2_crude_2a.597.597.128.5520.277707992.55993.166141.075.0%3R.MTEEELLK.G1
*rpal_wt_anaer_light_2_pellet_2a.3025.3025.253.22680.6668582712.642713.931204.041.9%8R.MTEEELLKGLEGLAPPEEQPEEDE.-2
*rpal_wt_anaer_light_2_pellet_2a.1547.1547.133.34260.5173741739.581739.791152.058.3%1K.GLEGLAPPEEQPEEDE.-1

URPA1495173092.8%97108365.4RPA1495 unknown protein 1658072:1658365 forward MW:10836
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_membrane_full.399.399.249.95060.6487071695.441695.921106.063.0%3M.SEEYKGHSGHPLILK.Q2
*rpal_wt_anaer_light_2_membrane_5.482.482.135.58290.4173861696.11695.921101.060.9%2M.SEEYKGHSGHPLILK.Q1
*rpal_wt_anaer_light_2_membrane_1a.409.409.356.4760.4970841696.31695.921242.054.2%1M.SEEYKGHSGHPLILK.Q3
*rpal_wt_anaer_light_2_membrane_4.564.564.251.63150.5863342430.662430.681144.051.4%2M.SEEYKGHSGHPLILKQEGEYK.G2
*rpal_wt_anaer_light_2_membrane_5.1017.1017.230.39690.529323487.483488.92116.025.9%1M.SEEYKGHSGHPLILKQEGEYKGYSGEPLILK.Q2
*rpal_wt_anaer_light_2_membrane_3.1606.1606.360.41380.4924593489.723488.921102.051.8%2M.SEEYKGHSGHPLILKQEGEYKGYSGEPLILK.Q3
*rpal_wt_anaer_light_2_membrane_3.1475.1475.230.28290.4607681812.121812.03142.036.7%1K.QEGEYKGYSGEPLILK.Q2
*rpal_wt_anaer_light_2_membrane_4.1399.1399.127.04340.3665811305.711306.5169.055.6%1K.GYSGTPLILEQK.G1
*rpal_wt_anaer_light_2_membrane_1a.2148.2148.265.48590.6805691539.91540.761250.076.0%3K.GEYQSFSGTPLILK.Q2
*rpal_wt_anaer_light_2_membrane_3.2870.2870.350.91090.324623287.613287.741146.045.5%1K.GEYQSFSGTPLILKQEGEYRGFSGAPLILK.Q3
*rpal_wt_anaer_light_2_membrane_full.1630.1630.230.18830.2518191765.391766.0112.041.4%1K.QEGEYRGFSGAPLILK.Q2
*rpal_wt_anaer_light_2_membrane_2.1825.1825.351.44840.3746162486.222486.741114.049.3%2K.QEGEYRGFSGAPLILKQDGEYK.S3
*rpal_wt_anaer_light_2_membrane_4.1690.1690.246.84310.5517122486.482486.7410.048.7%2K.QEGEYRGFSGAPLILKQDGEYK.S2
*rpal_wt_anaer_light_2_membrane_1.1766.1766.231.85380.3961791003.071003.231108.052.6%1R.GFSGAPLILK.Q2
*rpal_wt_anaer_light_2_membrane_5.1068.1068.134.51220.5133551722.891723.97188.062.5%1R.GFSGAPLILKQDGEYK.S1
*rpal_wt_anaer_light_2_membrane_2a.3270.3270.128.35290.4374471223.641224.441178.064.7%2K.SFSGYPLLLNI.-1
*rpal_wt_anaer_light_2_membrane_full.3138.3138.249.2410.5362851224.341224.441198.075.0%4K.SFSGYPLLLNI.-2

URPA3875117991.8%98100924.4RPA3875 conserved unknown protein 4374071:4374367 forward MW:10092
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_cleared_2a.1582.1582.125.50060.3554231892.951894.181132.052.0%1M.AVDGNWKLTMSTPMGER.Q1
*rpal_wt_anaer_light_2_cleared_1a.1720.1720.258.77310.5873331893.541894.181203.058.1%6M.AVDGNWKLTMSTPMGER.Q2
*rpal_wt_anaer_light_2_cleared_full.1549.1549.346.05710.3866371894.391894.181133.043.4%1M.AVDGNWKLTMSTPMGER.Q3
*rpal_wt_anaer_light_2_crude_1.595.595.242.28650.4835851122.981123.341232.066.7%5K.LTMSTPMGER.Q2
*rpal_wt_anaer_light_2_crude_full.2222.2222.259.69370.6938623157.123158.231131.040.7%7K.ADGSTLTGSQSADGDAGEIFDGTVNGDDVAWK.L2
*rpal_wt_anaer_light_2_crude_2a.2337.2337.135.55660.6021751735.871737.071208.054.2%12K.LSITNPMPLTLSYTGK.V1
*rpal_wt_anaer_light_2_crude_full.2159.2159.265.39740.7037541737.761737.071166.071.4%11K.LSITNPMPLTLSYTGK.V2
*rpal_wt_anaer_light_2_crude_1a.2448.2448.356.69830.5161111739.031737.071231.050.0%2K.LSITNPMPLTLSYTGK.V3
*rpal_wt_anaer_light_2_cleared_2a.2656.2656.254.5770.647192388.932388.681173.050.0%12K.VSGDSISGEMGIGPMGSFPFTGTR.A2
*rpal_wt_anaer_light_2_crude_full.2502.2502.264.80040.6997642458.572459.761216.048.9%19K.VSGDSISGEMGIGPMGSFPFTGTRA.-2
*rpal_wt_anaer_light_2_cleared_1a.2864.2864.373.97910.6118542459.182459.761241.058.3%3K.VSGDSISGEMGIGPMGSFPFTGTRA.-3

URPA09446531791.6%335359567.6cbbG glyceraldehyde-3-phosphate dehydrogenase(GAPDH) 1043108:1044115 reverse MW:35956
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_crude_full.465.465.125.70080.178162833.49833.966182.075.0%1R.VAINGFGR.I1
*rpal_wt_anaer_light_2_crude_1.533.533.242.20140.566934835.29833.9661240.080.0%11R.VAINGFGR.I2
*rpal_wt_anaer_light_2_crude_full.2127.2127.386.38380.5556873194.713194.621225.068.8%13R.AIYESGRKDIEVVAINDLGPVETNAHLLR.F3
*rpal_wt_anaer_light_2_crude_5.1179.1179.245.73720.5113023194.753194.621164.034.6%7R.AIYESGRKDIEVVAINDLGPVETNAHLLR.F2
*rpal_wt_anaer_light_2_pellet_2a.2342.2342.271.46110.6489782416.82417.771246.060.0%6R.KDIEVVAINDLGPVETNAHLLR.F2
*rpal_wt_anaer_light_2_pellet_2.2526.2526.399.42950.6423152417.142417.771255.067.1%6R.KDIEVVAINDLGPVETNAHLLR.F3
*rpal_wt_anaer_light_2_pellet_2.2882.2882.370.29610.5614822289.532289.591149.058.0%6K.DIEVVAINDLGPVETNAHLLR.F3
*rpal_wt_anaer_light_2_pellet_full.2560.2560.268.37910.7138452290.092289.591151.060.5%9K.DIEVVAINDLGPVETNAHLLR.F2
*rpal_wt_anaer_light_2_crude_2.1247.1247.245.5730.6170411565.361565.77113.058.3%9R.FDSVHGRFPFEVK.V2
*rpal_wt_anaer_light_2_pellet_full.1394.1394.354.73250.4716431565.981565.771231.057.1%5R.FDSVHGRFPFEVK.V3
*rpal_wt_anaer_light_2_crude_5.801.801.135.00080.4408931568.121565.771146.068.4%4R.FDSVHGRFPFEVK.V1
*rpal_wt_anaer_light_2_pellet_2a.1759.1759.231.83680.4077482750.582751.031131.027.3%1R.FDSVHGRFPFEVKVDGDTIDAGRGK.I2
*rpal_wt_anaer_light_2_pellet_2.2182.2182.239.16540.4283781766.341766.95124.046.4%1R.FPFEVKVDGDTIDAGR.G2
*rpal_wt_anaer_light_2_pellet_3.1831.1831.234.08220.5866351952.931952.17112.043.8%1R.FPFEVKVDGDTIDAGRGK.I2
*rpal_wt_anaer_light_2_pellet_2a.273.273.129.43270.3115721203.981204.281212.058.8%1K.VDGDTIDAGRGK.I1
*rpal_wt_anaer_light_2_crude_5.721.721.135.51140.4426181644.061645.01203.060.9%1K.IKVTAIKDPSALPYK.E1
*rpal_wt_anaer_light_2_pellet_2.1408.1408.239.92750.5242381644.71645.0167.050.0%1K.IKVTAIKDPSALPYK.E2
*rpal_wt_anaer_light_2_crude_full.400.400.142.53160.496481159.611160.361232.077.8%9R.DKAATLLTAGAK.R1
*rpal_wt_anaer_light_2_pellet_1a.638.638.253.28210.6652081159.931160.361226.072.7%8R.DKAATLLTAGAK.R2
*rpal_wt_anaer_light_2_crude_4.428.428.131.92530.4652361315.971316.541138.065.0%5R.DKAATLLTAGAKR.V1
*rpal_wt_anaer_light_2_pellet_1.605.605.269.43370.6603361316.151316.541118.075.0%7R.DKAATLLTAGAKR.V2
*rpal_wt_anaer_light_2_pellet_full.485.485.363.50260.5233411316.921316.541177.068.3%6R.DKAATLLTAGAKR.V3
*rpal_wt_anaer_light_2_pellet_full.490.490.125.24380.425701916.55917.094148.060.0%1K.AATLLTAGAK.R1
*rpal_wt_anaer_light_2_pellet_1a.544.544.241.6020.391094916.8917.094172.072.2%1K.AATLLTAGAK.R2
*rpal_wt_anaer_light_2_cleared_1.510.510.238.70080.4656911073.51073.28189.065.0%2K.AATLLTAGAKR.V2
*rpal_wt_anaer_light_2_crude_full.1480.1480.346.98260.2981342699.452701.0114.044.6%1K.RVLVSAPSDGADATIVYGVNHETLSK.D3
*rpal_wt_anaer_light_2_crude_4.1532.1532.251.5460.5765122702.132701.011209.043.5%1K.RVLVSAPSDGADATIVYGVNHETLSK.D2
*rpal_wt_anaer_light_2_pellet_2a.2163.2163.345.3180.3932124729.024730.36180.046.7%1K.RVLVSAPSDGADATIVYGVNHETLSKDHMVVSNGSCTTNCLAPVAK.V3
*rpal_wt_anaer_light_2_crude_full.1660.1660.255.15210.6467612545.642544.821232.047.7%6R.VLVSAPSDGADATIVYGVNHETLSK.D2
*rpal_wt_anaer_light_2_crude_full.1659.1659.347.95910.4662082546.052544.821154.042.5%1R.VLVSAPSDGADATIVYGVNHETLSK.D3
*rpal_wt_anaer_light_2_pellet_5.1242.1242.347.30890.3107684574.584574.17168.042.2%1R.VLVSAPSDGADATIVYGVNHETLSKDHMVVSNGSCTTNCLAPVAK.V3
*rpal_wt_anaer_light_2_pellet_3.1420.1420.277.41410.7454782047.352048.371109.072.2%3K.DHMVVSNGSCTTNCLAPVAK.V2
*rpal_wt_anaer_light_2_pellet_2a.2980.2980.356.86270.4251753955.573956.451115.050.6%3K.VLNDTVGIETGFMTTIHAYTGDQPTLDTMHKDLYR.G3
*rpal_wt_anaer_light_2_pellet_2.1228.1228.230.93980.4449091621.341621.921192.043.3%1R.GRAAAMSMIPTSTGAAK.A2
*rpal_wt_anaer_light_2_pellet_full.1188.1188.135.10370.4829321407.621408.681171.063.6%16R.AAAMSMIPTSTGAAK.A1
*rpal_wt_anaer_light_2_crude_full.909.909.254.47520.5446281407.841408.681211.070.4%12R.AAAMSMIPTSTGAAK.A2
*rpal_wt_anaer_light_2_crude_3.2133.2133.139.56220.4437821052.881053.331189.073.3%6K.AIGLVLPELK.G1
*rpal_wt_anaer_light_2_crude_full.1964.1964.253.8380.4274161053.291053.331254.077.8%16K.AIGLVLPELK.G2
*rpal_wt_anaer_light_2_pellet_4.1753.1753.136.08380.5250081237.851238.56125.066.7%1K.AIGLVLPELKGK.L1
*rpal_wt_anaer_light_2_pellet_1.613.613.244.07090.228641929.62929.1081236.070.6%2K.GKLDGVAIR.V2
*rpal_wt_anaer_light_2_crude_2a.2112.2112.269.49470.7113792178.212178.5811.067.6%16K.GKLDGVAIRVPTPNVSVVDLK.I2
*rpal_wt_anaer_light_2_cleared_1a.2305.2305.376.65290.5800952179.322178.581244.060.6%14K.GKLDGVAIRVPTPNVSVVDLK.I3
*rpal_wt_anaer_light_2_pellet_3.2594.2594.247.79660.5508451993.031993.36184.052.9%6K.LDGVAIRVPTPNVSVVDLK.I2
*rpal_wt_anaer_light_2_pellet_1.2799.2799.361.1820.5026631993.481993.361180.055.2%5K.LDGVAIRVPTPNVSVVDLK.I3
*rpal_wt_anaer_light_2_crude_2a.1457.1457.148.4030.6629841267.81268.51138.078.9%6R.VPTPNVSVVDLK.I1
*rpal_wt_anaer_light_2_pellet_1a.1889.1889.252.86820.6325561270.421268.51199.072.7%6R.VPTPNVSVVDLK.I2
*2rpal_wt_anaer_light_2_pellet_1a.252.252.125.47910.0986142574.44572.771180.087.5%1K.IIAKK.A11
*rpal_wt_anaer_light_2_pellet_4.470.470.132.56280.3508421475.031475.681149.063.2%1K.KATTKEEINEAIK.R1
*rpal_wt_anaer_light_2_pellet_2.531.531.248.12270.408341630.691631.87197.064.0%1K.KATTKEEINEAIKR.A2
*rpal_wt_anaer_light_2_pellet_1.549.549.347.43010.3198881631.61631.87198.056.8%1K.KATTKEEINEAIKR.A3
*rpal_wt_anaer_light_2_pellet_2a.401.401.142.42520.4880091632.111631.871200.071.4%5K.KATTKEEINEAIKR.A1
*rpal_wt_anaer_light_2_crude_5.416.416.133.37210.5138091503.21503.7191.057.9%4K.ATTKEEINEAIKR.A1
*rpal_wt_anaer_light_2_pellet_1a.698.698.247.92560.5317031503.321503.71120.065.2%3K.ATTKEEINEAIKR.A2
*rpal_wt_anaer_light_2_pellet_1a.717.717.349.83570.2854261504.261503.71152.058.5%1K.ATTKEEINEAIKR.A3
*rpal_wt_anaer_light_2_pellet_2a.349.349.131.91810.4254891101.811102.231171.071.4%1K.EEINEAIKR.A1
*rpal_wt_anaer_light_2_pellet_1.498.498.237.12890.3986091102.21102.23149.064.7%1K.EEINEAIKR.A2
*rpal_wt_anaer_light_2_pellet_2.363.363.127.58590.304126788.44788.8761240.072.7%1R.AAEQELK.G1
*rpal_wt_anaer_light_2_pellet_full.2016.2016.361.97820.4979273345.593345.631153.058.3%8K.GILGYTNAPNVSIDFNHDPHSSTFHMDQTK.V3
*rpal_wt_anaer_light_2_cleared_4.2223.2223.350.98610.3723134212.894213.64134.050.6%3K.GILGYTNAPNVSIDFNHDPHSSTFHMDQTKVQNGTLVR.V3
*rpal_wt_anaer_light_2_crude_2.2176.2176.249.35390.2559391792.781791.941250.060.0%7R.VMSWYDNEWGFSNR.M2
*rpal_wt_anaer_light_2_pellet_5.1317.1317.128.89680.4390351794.021791.941194.052.4%1R.VMSWYDNEWGFSNR.M1
*rpal_wt_anaer_light_2_crude_3.406.406.136.6030.524064976.62977.171173.075.0%10R.MADTAVAIGK.L1
*rpal_wt_anaer_light_2_cleared_1a.498.498.258.69990.538522977.48977.171182.078.9%5R.MADTAVAIGK.L2
*rpal_wt_anaer_light_2_cleared_1a.2289.2289.257.39190.5503791203.351203.491252.076.2%7R.MADTAVAIGKLI.-2
*rpal_wt_anaer_light_2_cleared_4.2265.2265.140.80060.4379321205.651203.491220.072.2%10R.MADTAVAIGKLI.-1
Similarities: RPA1697(1:64)

URPA3501188291.3%92101838.6RPA3501 conserved unknown protein 3951527:3951805 forward MW:10182
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_pellet_2.396.396.129.67910.14829810.57810.9721196.076.9%2R.SIVVAGHK.T1
*rpal_wt_anaer_light_2_pellet_1.408.408.233.40590.145968811.59810.9721234.060.0%1R.SIVVAGHK.T2
*rpal_wt_anaer_light_2_pellet_4.2430.2430.232.37040.3810182391.352391.7510.036.8%1R.SIVVAGHKTSVSLEEAFWNGMK.E2
*rpal_wt_anaer_light_2_cleared_3.3492.3492.349.50470.3575283065.373063.5118.050.7%2R.SIVVAGHKTSVSLEEAFWNGMKEISSVR.D3
*rpal_wt_anaer_light_2_pellet_2a.2620.2620.139.74980.6669241598.791599.8138.071.4%4K.TSVSLEEAFWNGMK.E1
*rpal_wt_anaer_light_2_pellet_1a.2902.2902.249.78680.6422811599.291599.81236.060.0%3K.TSVSLEEAFWNGMK.E2
*rpal_wt_anaer_light_2_cleared_3.3835.3835.256.52690.6507862270.912271.561244.057.1%9K.TSVSLEEAFWNGMKEISSVR.D2
*rpal_wt_anaer_light_2_crude_full.3335.3335.390.63780.6470852271.22271.561218.069.0%7K.TSVSLEEAFWNGMKEISSVR.D3
*rpal_wt_anaer_light_2_crude_1a.3093.3093.252.6470.6018631679.711679.851215.061.5%6R.DMTLSELVGEIDSNR.Q2
*rpal_wt_anaer_light_2_crude_1.3152.3152.372.20780.5469711679.891679.851255.063.6%2R.DMTLSELVGEIDSNR.Q3
*rpal_wt_anaer_light_2_pellet_5.1645.1645.129.03110.3548441680.981679.85173.052.4%3R.DMTLSELVGEIDSNR.Q1
*rpal_wt_anaer_light_2_crude_1a.3012.3012.391.14860.5404732734.32735.011218.066.7%7R.DMTLSELVGEIDSNRQQGNLSSAIR.L3
*rpal_wt_anaer_light_2_pellet_full.2589.2589.252.79420.4675251073.081073.281236.086.7%12R.LFVLDYFR.S2
*rpal_wt_anaer_light_2_pellet_4.1085.1085.232.42340.4793112443.562442.65118.032.5%1R.SRALQAQQQAVADTKTESSLTAH.-2
*rpal_wt_anaer_light_2_pellet_2a.428.428.145.53610.5105311371.771372.521202.078.9%5R.ALQAQQQAVADTK.T1
*rpal_wt_anaer_light_2_pellet_1a.490.490.277.60150.7445461371.971372.521228.087.0%3R.ALQAQQQAVADTK.T2
*rpal_wt_anaer_light_2_pellet_2a.1171.1171.265.62050.6860282198.442199.381211.062.2%7R.ALQAQQQAVADTKTESSLTAH.-2
*rpal_wt_anaer_light_2_pellet_1a.1401.1401.365.07650.5556812199.452199.38191.052.4%7R.ALQAQQQAVADTKTESSLTAH.-3

URPA32527772189.6%396433375.8tufA, EF-Tu elongation factor Tu 3659926:3661116 reverse MW:43337
URPA32837772189.6%396433375.8tuf, EF-Tu elongation factor Tu 3702061:3703251 reverse MW:43337
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
rpal_wt_anaer_light_2_cleared_full.442.442.261.01890.6860551814.081815.07154.066.7%5R.TKPHCNIGTIGHVDHGK.T2
rpal_wt_anaer_light_2_cleared_2a.405.405.137.99470.5571221815.071815.071192.057.7%6R.TKPHCNIGTIGHVDHGK.T1
rpal_wt_anaer_light_2_cleared_4.1138.1138.249.46550.649732701.362702.111192.043.5%10R.TKPHCNIGTIGHVDHGKTSLTAAITK.V2
rpal_wt_anaer_light_2_pellet_3.1246.1246.349.95970.3535012704.182702.11184.044.4%2R.TKPHCNIGTIGHVDHGKTSLTAAITK.V3
rpal_wt_anaer_light_2_cleared_full.707.707.132.31640.406509905.52906.068118.078.6%12K.TSLTAAITK.V1
rpal_wt_anaer_light_2_crude_1a.499.499.246.90520.598778906.11906.0681200.088.2%14K.TSLTAAITK.V2
rpal_wt_anaer_light_2_pellet_1a.1959.1959.351.46320.4442922454.652455.681195.041.4%1K.VLAETGGATFTAYDQIDKAPEEK.A3
rpal_wt_anaer_light_2_cleared_2a.1603.1603.261.50210.6747352455.42455.68124.051.2%7K.VLAETGGATFTAYDQIDKAPEEK.A2
rpal_wt_anaer_light_2_crude_2a.810.810.246.40490.6176422046.652047.2410.048.4%3K.ARGITISTAHVEYETQNR.H2
rpal_wt_anaer_light_2_crude_1a.1168.1168.263.32740.6983251819.381819.971222.065.5%15R.GITISTAHVEYETQNR.H2
rpal_wt_anaer_light_2_crude_1.1079.1079.374.44250.5859921820.121819.971161.066.7%11R.GITISTAHVEYETQNR.H3
rpal_wt_anaer_light_2_pellet_5.826.826.147.55860.5575981822.041819.971137.075.0%10R.GITISTAHVEYETQNR.H1
rpal_wt_anaer_light_2_cleared_5.963.963.230.42890.3962523513.543513.83133.025.9%1R.GITISTAHVEYETQNRHYAHVDCPGHADYVK.N2
rpal_wt_anaer_light_2_cleared_3.1473.1473.350.91130.3988663515.613513.831166.045.6%2R.GITISTAHVEYETQNRHYAHVDCPGHADYVK.N3
rpal_wt_anaer_light_2_cleared_2.618.618.267.05760.6662631712.511712.89133.078.6%6R.HYAHVDCPGHADYVK.N2
rpal_wt_anaer_light_2_pellet_1a.588.588.397.16820.6709421712.951712.891254.074.5%5R.HYAHVDCPGHADYVK.N3
rpal_wt_anaer_light_2_pellet_5.526.526.163.03540.6758841714.971712.891184.079.2%7R.HYAHVDCPGHADYVK.N1
rpal_wt_anaer_light_2_crude_full.4295.4295.258.94420.6912942716.562717.161238.046.9%49K.NMITGAAQMDGAILVVSAADGPMPQTR.E2
rpal_wt_anaer_light_2_cleared_2.556.556.135.68190.486431851.71852.0251211.090.9%9R.EHILLAR.Q1
rpal_wt_anaer_light_2_pellet_1.578.578.238.82850.475303853.49852.025125.076.9%9R.EHILLAR.Q2
rpal_wt_anaer_light_2_pellet_full.2686.2686.141.55370.6049711383.741384.71149.073.7%13R.QVGVPALVVFLNK.C1
rpal_wt_anaer_light_2_crude_full.2509.2509.257.66420.6487011384.441384.71188.079.2%21R.QVGVPALVVFLNK.C2
rpal_wt_anaer_light_2_pellet_1.3196.3196.359.81820.4821641385.231384.711255.058.5%1R.QVGVPALVVFLNK.C3
rpal_wt_anaer_light_2_cleared_full.4577.4577.358.03170.3836253501.733502.15150.046.2%4R.QVGVPALVVFLNKCDMVDDPELLELVEMEVR.E3
rpal_wt_anaer_light_2_pellet_3.3787.3787.286.35670.7475822135.32136.471253.078.1%3K.CDMVDDPELLELVEMEVR.E2
rpal_wt_anaer_light_2_crude_1.371.371.129.16260.179291589.36589.711182.087.5%9R.ELLSK.Y1
rpal_wt_anaer_light_2_pellet_5.1313.1313.138.93080.5268681949.061950.24182.057.7%5R.ELLSKYDFPGDDIPIVK.G1
rpal_wt_anaer_light_2_crude_3.2253.2253.269.37130.6972911950.61950.241215.070.0%15R.ELLSKYDFPGDDIPIVK.G2
rpal_wt_anaer_light_2_cleared_1a.2443.2443.356.24880.4296131951.971950.241175.058.0%6R.ELLSKYDFPGDDIPIVK.G3
rpal_wt_anaer_light_2_cleared_2a.2810.2810.238.69920.3826313178.083178.561144.028.8%2R.ELLSKYDFPGDDIPIVKGSALAALENSDAK.L2
rpal_wt_anaer_light_2_cleared_full.2755.2755.366.18380.5037083178.873178.561248.046.3%5R.ELLSKYDFPGDDIPIVKGSALAALENSDAK.L3
rpal_wt_anaer_light_2_crude_2a.1932.1932.143.05760.6082711378.81379.551190.073.7%28K.YDFPGDDIPIVK.G1
rpal_wt_anaer_light_2_crude_1.2102.2102.263.15770.7098261379.361379.551151.077.3%33K.YDFPGDDIPIVK.G2
rpal_wt_anaer_light_2_cleared_full.2679.2679.349.61240.2874742606.082607.881133.051.3%1K.YDFPGDDIPIVKGSALAALENSDAK.L3
rpal_wt_anaer_light_2_cleared_2a.2733.2733.250.44020.5384672607.452607.881100.042.2%4K.YDFPGDDIPIVKGSALAALENSDAK.L2
rpal_wt_anaer_light_2_cleared_full.1062.1062.151.8270.6724041246.541247.351111.084.2%25K.GSALAALENSDAK.L1
rpal_wt_anaer_light_2_crude_1.810.810.277.62020.6759161247.091247.351253.087.0%18K.GSALAALENSDAK.L2
rpal_wt_anaer_light_2_cleared_full.2947.2947.275.66920.7084592496.122496.851186.061.9%11K.GSALAALENSDAKLGHDAILELMR.Q2
rpal_wt_anaer_light_2_cleared_full.2944.2944.357.44380.5012272498.532496.851213.052.1%7K.GSALAALENSDAKLGHDAILELMR.Q3
rpal_wt_anaer_light_2_crude_4.1559.1559.163.28780.5636171267.951268.521185.0100.0%19K.LGHDAILELMR.Q1
rpal_wt_anaer_light_2_cleared_1a.1828.1828.263.72330.6343381268.821268.52162.084.2%21K.LGHDAILELMR.Q2
rpal_wt_anaer_light_2_membrane_1a.2056.2056.359.76580.4053141269.721268.521113.064.7%15K.LGHDAILELMR.Q3
rpal_wt_anaer_light_2_pellet_2a.3424.3424.231.88520.5089733444.943445.9218.025.0%2R.QVDAYIPQPERPIDQPFLMPVEDVFSISGR.G2
rpal_wt_anaer_light_2_crude_full.3159.3159.365.88080.46133445.753445.92136.058.7%18R.QVDAYIPQPERPIDQPFLMPVEDVFSISGR.G3
rpal_wt_anaer_light_2_pellet_2a.2034.2034.231.12330.4552542084.62084.4210.039.4%1R.GILKVGDEIEIVGIRDTQK.T2
rpal_wt_anaer_light_2_cleared_2a.1573.1573.139.15680.4276291199.841200.381188.075.0%12K.VGDEIEIVGIR.D1
rpal_wt_anaer_light_2_pellet_1a.1954.1954.273.2920.5625121200.451200.381247.090.0%9K.VGDEIEIVGIR.D2
rpal_wt_anaer_light_2_cleared_1a.1428.1428.270.8950.6630271672.581672.881217.077.8%13K.VGDEIEIVGIRDTQK.T2
rpal_wt_anaer_light_2_crude_full.1132.1132.361.27670.485631673.191672.881244.062.2%6K.VGDEIEIVGIRDTQK.T3
rpal_wt_anaer_light_2_pellet_5.901.901.142.8830.5448871675.041672.881145.076.2%11K.VGDEIEIVGIRDTQK.T1
rpal_wt_anaer_light_2_cleared_3.2388.2388.357.74690.4331332799.872799.21219.049.3%3K.VGDEIEIVGIRDTQKTTCTGVEMFR.K3
rpal_wt_anaer_light_2_cleared_full.1949.1949.366.63650.4530672927.72927.371203.054.3%4K.VGDEIEIVGIRDTQKTTCTGVEMFRK.L3
rpal_wt_anaer_light_2_cleared_2.864.864.230.68120.3452181745.861746.0212.040.7%1R.DTQKTTCTGVEMFRK.L2
rpal_wt_anaer_light_2_cleared_1a.748.748.345.52680.3560541746.851746.02198.055.3%1R.DTQKTTCTGVEMFRK.L3
rpal_wt_anaer_light_2_crude_2a.988.988.126.89290.4690751144.721145.34116.062.5%1K.TTCTGVEMFR.K1
rpal_wt_anaer_light_2_crude_1.884.884.247.62710.4974421144.81145.341172.073.7%7K.TTCTGVEMFR.K2
rpal_wt_anaer_light_2_crude_1a.504.504.237.85760.5837691273.061273.521184.055.0%5K.TTCTGVEMFRK.L2
rpal_wt_anaer_light_2_pellet_5.1116.1116.141.71260.5016451782.251783.04181.065.4%6R.KLLDQGQAGDNIGALLR.G1
rpal_wt_anaer_light_2_crude_full.1649.1649.383.91160.5384081782.571783.041195.064.3%7R.KLLDQGQAGDNIGALLR.G3
rpal_wt_anaer_light_2_crude_full.1634.1634.291.16860.6984351783.01783.041249.087.1%16R.KLLDQGQAGDNIGALLR.G2
rpal_wt_anaer_light_2_cleared_3.1868.1868.237.09690.4081582070.532069.371193.041.7%2R.KLLDQGQAGDNIGALLRGTK.R2
rpal_wt_anaer_light_2_crude_full.1909.1909.281.48550.6944471654.141654.861244.075.9%22K.LLDQGQAGDNIGALLR.G2
rpal_wt_anaer_light_2_crude_1a.2151.2151.368.91490.500131654.971654.861223.054.7%6K.LLDQGQAGDNIGALLR.G3
rpal_wt_anaer_light_2_pellet_5.1243.1243.139.73470.341111657.131654.861200.057.7%4K.LLDQGQAGDNIGALLR.G1
rpal_wt_anaer_light_2_cleared_3.2083.2083.246.20280.5003071942.051941.2184.050.0%3K.LLDQGQAGDNIGALLRGTK.R2
rpal_wt_anaer_light_2_cleared_1a.2081.2081.352.06390.4121151943.021941.21217.050.0%2K.LLDQGQAGDNIGALLRGTK.R3
rpal_wt_anaer_light_2_cleared_4.517.517.230.07820.2688862650.92651.0714.032.6%1R.GTKREDVERGQVLCKPGSVKPHTK.F2
rpal_wt_anaer_light_2_pellet_full.364.364.142.88690.5642241578.91579.911135.073.9%8R.GQVLCKPGSVKPHTK.F1
rpal_wt_anaer_light_2_pellet_full.365.365.256.01220.6782721581.681579.911149.066.7%3R.GQVLCKPGSVKPHTK.F2
rpal_wt_anaer_light_2_cleared_5.593.593.128.45590.4501421854.141855.26122.048.0%1R.GQVLCKPGSVKPHTKFK.A1
rpal_wt_anaer_light_2_cleared_2a.1152.1152.139.78320.5112161183.881184.421226.075.0%25K.FKAEAYILTK.E1
rpal_wt_anaer_light_2_pellet_1a.1486.1486.259.76210.5830641184.131184.421171.083.3%4K.FKAEAYILTK.E2
rpal_wt_anaer_light_2_pellet_2.1349.1349.230.72410.3383891714.511712.9410.040.0%1K.FKAEAYILTKEEGGR.H2
rpal_wt_anaer_light_2_crude_3.447.447.132.12240.447871908.99909.0711117.083.3%7K.AEAYILTK.E1
rpal_wt_anaer_light_2_crude_full.3340.3340.378.49570.573894104.524105.81154.058.2%53R.TTDVTGVVHLPEGTEMVMPGDNIAMEVHLIVPIAMEEK.L3
rpal_wt_anaer_light_2_crude_full.3257.3257.373.6210.5687864374.554375.151110.058.5%5R.TTDVTGVVHLPEGTEMVMPGDNIAMEVHLIVPIAMEEKLR.F3
rpal_wt_anaer_light_2_crude_1.2895.2895.230.63790.5075641099.531100.31228.045.5%1R.TVGAGVVAAIIE.-2

URPA11408347289.2%547576265.5groEL1 chaperonin GroEL1, cpn60 1247853:1249496 reverse MW:57626
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_crude_1.1621.1621.234.00260.3767211386.191386.71148.045.8%1R.MLRGVDVLANAVK.V2
*rpal_wt_anaer_light_2_pellet_1.1970.1970.354.06560.3841871387.061386.71104.065.0%1R.MLRGVDVLANAVK.V3
*rpal_wt_anaer_light_2_crude_2a.930.930.142.00380.557147985.83986.157184.086.7%10R.GVDVLANAVK.V1
*rpal_wt_anaer_light_2_crude_1a.1031.1031.262.51790.498462986.95986.1571254.084.2%9R.GVDVLANAVK.V2
rpal_wt_anaer_light_2_crude_1a.299.299.125.84320.286126614.46614.7631236.070.0%1K.VTLGPK.G11
*rpal_wt_anaer_light_2_crude_1a.340.340.136.2520.173003715.41715.8681182.090.0%5R.NVLIEK.S1
rpal_wt_anaer_light_2_crude_1a.292.292.126.81630.166496634.53634.71319.090.0%4K.SFGAPR.I11
rpal_wt_anaer_light_2_pellet_2a.316.316.135.55270.3741431031.731032.231241.075.0%7R.ITKDGVTVAK.E11
rpal_wt_anaer_light_2_pellet_1.463.463.244.50350.5975551032.461032.231148.063.2%1R.ITKDGVTVAK.E22
*rpal_wt_anaer_light_2_pellet_full.2228.2228.391.97440.6298483039.053039.51216.063.0%6R.ITKDGVTVAKEVELEDKFENMGAQMVR.E3
*rpal_wt_anaer_light_2_pellet_2a.2346.2346.240.14340.4119463039.563039.5116.033.3%1R.ITKDGVTVAKEVELEDKFENMGAQMVR.E2
*rpal_wt_anaer_light_2_crude_2.2455.2455.370.29030.5741572696.282697.061115.050.0%6K.DGVTVAKEVELEDKFENMGAQMVR.E3
*rpal_wt_anaer_light_2_crude_4.2401.2401.268.00810.6585752696.432697.061143.054.8%5K.DGVTVAKEVELEDKFENMGAQMVR.E2
*rpal_wt_anaer_light_2_crude_1.2098.2098.351.46210.4718742023.822026.3169.057.4%1K.EVELEDKFENMGAQMVR.E32
*rpal_wt_anaer_light_2_pellet_full.2015.2015.262.2340.5308292025.112026.31110.066.7%7K.EVELEDKFENMGAQMVR.E2
*rpal_wt_anaer_light_2_pellet_3.2829.2829.268.68050.6609442089.952089.311188.060.5%17K.TNDLAGDGTTTATVLAQAIVR.E2
rpal_wt_anaer_light_2_pellet_full.1333.1333.266.68340.6720941217.931218.481111.077.3%8K.AVAAGMNPMDLK.R22
rpal_wt_anaer_light_2_crude_4.1120.1120.139.92580.4144891220.761218.481239.066.7%10K.AVAAGMNPMDLK.R11
rpal_wt_anaer_light_2_crude_full.695.695.136.79180.4463771373.561374.67186.068.4%9K.AVAAGMNPMDLKR.G11
rpal_wt_anaer_light_2_pellet_1a.1374.1374.262.41130.686931374.441374.671172.078.3%10K.AVAAGMNPMDLKR.G22
*rpal_wt_anaer_light_2_pellet_2.2670.2670.244.52860.5907461710.641711.061190.048.3%1R.GIEIAVAAVVKDIQKR.A2
*rpal_wt_anaer_light_2_pellet_4.1400.1400.239.39620.4948472611.052609.94116.039.6%1K.RAKPVASSAEIAQVGTISANGDAPIGK.M2
*rpal_wt_anaer_light_2_pellet_1a.1859.1859.361.38460.4564552453.562453.761225.050.7%5R.AKPVASSAEIAQVGTISANGDAPIGK.M3
*rpal_wt_anaer_light_2_pellet_full.1544.1544.281.33740.6989562453.612453.761232.060.9%13R.AKPVASSAEIAQVGTISANGDAPIGK.M2
*rpal_wt_anaer_light_2_pellet_1.504.504.244.47770.48672921.01921.1721151.081.2%2K.MIAQAMQK.V2
*rpal_wt_anaer_light_2_pellet_3.477.477.136.11990.352958922.79921.1721243.076.9%6K.MIAQAMQK.V1
*rpal_wt_anaer_light_2_pellet_1a.1100.1100.253.34760.6292371387.751388.521216.073.9%8K.VGNEGVITVEENK.S2
*rpal_wt_anaer_light_2_pellet_4.864.864.146.23240.5570731390.731388.521142.075.0%10K.VGNEGVITVEENK.S1
*rpal_wt_anaer_light_2_pellet_2a.2759.2759.259.0580.7197892819.772820.151119.045.7%3K.VGNEGVITVEENKSLETEVDIVEGMK.F2
*rpal_wt_anaer_light_2_pellet_1a.3056.3056.377.91470.6215592820.042820.151221.061.6%2K.VGNEGVITVEENKSLETEVDIVEGMK.F3
*rpal_wt_anaer_light_2_pellet_2a.2892.2892.351.47590.3005793239.523238.6150.040.5%1K.VGNEGVITVEENKSLETEVDIVEGMKFDR.G3
*rpal_wt_anaer_light_2_pellet_2a.2252.2252.139.52520.5006451449.691450.651199.065.0%4K.SLETEVDIVEGMK.F1
*rpal_wt_anaer_light_2_crude_2.2145.2145.270.68010.7276111452.121450.651209.078.3%4K.SLETEVDIVEGMK.F2
*rpal_wt_anaer_light_2_pellet_1a.2131.2131.261.51210.4465411907.251908.12160.065.5%5K.FDRGYLSPYFVTNAEK.M2
*rpal_wt_anaer_light_2_pellet_5.1084.1084.130.40040.4443071908.141908.1218.054.2%1K.FDRGYLSPYFVTNAEK.M1
*rpal_wt_anaer_light_2_crude_1.1801.1801.353.5460.5339481908.181908.121254.045.1%2K.FDRGYLSPYFVTNAEK.M3
*rpal_wt_anaer_light_2_crude_full.1539.1539.270.11790.7211411489.231489.671168.079.2%8R.GYLSPYFVTNAEK.M2
*rpal_wt_anaer_light_2_crude_4.1593.1593.146.33820.6022371491.771489.671180.065.0%11R.GYLSPYFVTNAEK.M1
*rpal_wt_anaer_light_2_pellet_full.2424.2424.143.77340.5535711789.711791.071169.069.6%7K.MTVELDDAYILLHEK.K1
*rpal_wt_anaer_light_2_pellet_full.2428.2428.273.42880.690711790.751791.071191.077.8%10K.MTVELDDAYILLHEK.K2
*rpal_wt_anaer_light_2_crude_full.2226.2226.365.40360.5553241791.061791.071226.059.2%6K.MTVELDDAYILLHEK.K3
*rpal_wt_anaer_light_2_pellet_5.1208.1208.134.38890.5250211918.061919.25152.054.2%2K.MTVELDDAYILLHEKK.L1
*rpal_wt_anaer_light_2_pellet_3.2267.2267.254.71440.6064691918.861919.251188.058.6%4K.MTVELDDAYILLHEKK.L2
*rpal_wt_anaer_light_2_pellet_full.5016.5016.364.59790.5157974302.064303.111179.053.3%3K.KLSGLQSMLPVLEAVVQSGKPLLIIAEDVEGEALATLVVNR.L3
*rpal_wt_anaer_light_2_pellet_2a.5204.5204.360.12570.5008524174.04174.931139.043.5%2K.LSGLQSMLPVLEAVVQSGKPLLIIAEDVEGEALATLVVNR.L3
*rpal_wt_anaer_light_2_pellet_4.628.628.125.39820.3339651203.951204.37148.052.6%1K.VSAVKAPGFGDR.R1
*rpal_wt_anaer_light_2_pellet_1a.865.865.236.66930.5164671204.221204.371240.047.8%1K.VSAVKAPGFGDR.R2
*rpal_wt_anaer_light_2_crude_4.3656.3656.258.99980.5913342430.122429.881228.055.0%5R.KAMLEDIAILTGGQLISEDLGIK.L2
*rpal_wt_anaer_light_2_pellet_full.3836.3836.361.27290.4260843214.063214.831115.051.2%3R.KAMLEDIAILTGGQLISEDLGIKLETVTLK.M3
*rpal_wt_anaer_light_2_pellet_5.2034.2034.251.15040.6359073214.463214.8315.034.6%1R.KAMLEDIAILTGGQLISEDLGIKLETVTLK.M2
*rpal_wt_anaer_light_2_pellet_2a.4014.4014.262.77630.6988962300.962301.711245.057.9%7K.AMLEDIAILTGGQLISEDLGIK.L2
*rpal_wt_anaer_light_2_pellet_1a.4330.4330.364.2460.5024922302.642301.711245.054.5%5K.AMLEDIAILTGGQLISEDLGIK.L3
*rpal_wt_anaer_light_2_pellet_2.701.701.130.66850.317231805.62803.9751181.075.0%1K.LETVTLK.M1
*rpal_wt_anaer_light_2_pellet_4.887.887.266.59080.5208232809.142810.27112.050.0%5R.AKKVVIDKENTTIVNGAGKKPEIEAR.V2
*rpal_wt_anaer_light_2_pellet_full.934.934.377.64240.5242162810.092810.271108.061.6%3R.AKKVVIDKENTTIVNGAGKKPEIEAR.V3
*rpal_wt_anaer_light_2_crude_4.586.586.260.64150.6128842611.552611.02117.055.0%1K.KVVIDKENTTIVNGAGKKPEIEAR.V2
*rpal_wt_anaer_light_2_pellet_2.1232.1232.362.08140.4648042482.062482.84122.055.2%2K.VVIDKENTTIVNGAGKKPEIEAR.V3
*rpal_wt_anaer_light_2_pellet_2a.1102.1102.247.75530.5062412482.442482.841128.048.8%6K.VVIDKENTTIVNGAGKKPEIEAR.V2
*rpal_wt_anaer_light_2_crude_1a.312.312.256.17930.6095681672.531671.72186.072.0%1K.AQIEETSSDYDREK.L2
rpal_wt_anaer_light_2_crude_full.477.477.258.47420.503121855.82856.0571240.088.2%22K.LAGGVAVIR.V22
rpal_wt_anaer_light_2_pellet_1a.392.392.132.3150.510995988.52989.1141140.073.3%5R.VGGATEVEVK.E11
rpal_wt_anaer_light_2_pellet_1a.394.394.244.60550.204264989.37989.1141208.073.7%1R.VGGATEVEVK.E22
*rpal_wt_anaer_light_2_pellet_2.1414.1414.364.20680.515292615.272615.911230.060.3%4R.VGGATEVEVKEKKDRVEDALNATR.A3
*rpal_wt_anaer_light_2_membrane_2a.1266.1266.238.03910.4766752615.772615.911192.036.6%6R.VGGATEVEVKEKKDRVEDALNATR.A2
*rpal_wt_anaer_light_2_pellet_5.497.497.135.01220.4441571646.951645.811128.068.4%1K.EKKDRVEDALNATR.A1
*rpal_wt_anaer_light_2_pellet_1.649.649.230.48560.1087071388.631388.521192.045.5%1K.KDRVEDALNATR.A2
*rpal_wt_anaer_light_2_pellet_1a.614.614.350.36960.1998921389.531388.521148.063.2%1K.KDRVEDALNATR.A3
*rpal_wt_anaer_light_2_pellet_4.901.901.126.81010.1936961259.851260.351131.056.2%1K.DRVEDALNATR.A1
*rpal_wt_anaer_light_2_pellet_1a.1147.1147.252.68110.4826441260.461260.351120.070.0%3K.DRVEDALNATR.A2
*rpal_wt_anaer_light_2_crude_full.1755.1755.137.02730.3051831607.981607.891136.059.3%11R.AAVQEGIVPGGGVALLR.A1
*rpal_wt_anaer_light_2_pellet_1.2348.2348.358.10280.1775751608.161607.891240.055.6%2R.AAVQEGIVPGGGVALLR.A3
*rpal_wt_anaer_light_2_crude_full.1752.1752.260.78090.2085031608.561607.891212.070.0%7R.AAVQEGIVPGGGVALLR.A2
*rpal_wt_anaer_light_2_pellet_3.2534.2534.246.03390.5569531810.791811.051178.053.6%5R.ISNDNPDVQAGINIVLK.A2
*rpal_wt_anaer_light_2_pellet_5.1393.1393.130.27230.4397321811.061811.0519.058.3%2R.ISNDNPDVQAGINIVLK.A1
*rpal_wt_anaer_light_2_pellet_3.2661.2661.239.05050.4743732322.842322.6718.037.5%2K.ALEAPIRQIAENAGVEGSIVVGK.I2
*rpal_wt_anaer_light_2_pellet_1a.2715.2715.346.41130.3129482323.142322.67185.043.5%1K.ALEAPIRQIAENAGVEGSIVVGK.I3
*rpal_wt_anaer_light_2_pellet_4.2955.2955.231.94020.3716762795.12794.11164.033.3%1K.ILENKTETFGFDAQTEEYVDMLAK.G2
*rpal_wt_anaer_light_2_crude_1a.305.305.130.2720.250677699.45699.8261236.081.8%5K.GIVDPAK.V1
*rpal_wt_anaer_light_2_crude_2a.4679.4679.272.16230.6499112545.982546.941226.060.0%33R.TALQDASSVASLLVTTEAMVAELPK.A2
*rpal_wt_anaer_light_2_crude_1a.4803.4803.381.7630.6322152548.022546.941239.055.1%58R.TALQDASSVASLLVTTEAMVAELPK.A3
*rpal_wt_anaer_light_2_pellet_4.4997.4997.365.5060.5459534268.054268.961255.047.0%11R.TALQDASSVASLLVTTEAMVAELPKADAPAMPAGGGMGGMGGMGF.-3
*rpal_wt_anaer_light_2_crude_2a.2344.2344.143.40120.6227431739.521741.041145.063.3%5K.ADAPAMPAGGGMGGMGGMGF.-1
*rpal_wt_anaer_light_2_pellet_1a.2667.2667.243.10640.5616131740.311741.041217.047.2%2K.ADAPAMPAGGGMGGMGGMGF.-2
Similarities: RPA2164(11:72)

URPA2164116107788.7%547577955.5groEL2 chaperonin GroEL2, cpn60 2437219:2438862 reverse MW:57796
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_pellet_2.2044.2044.255.85670.5000741402.431400.731223.066.7%3R.MLRGVDILANAVK.V2
*rpal_wt_anaer_light_2_pellet_4.1858.1858.128.75040.1654451402.811400.731132.055.0%1R.MLRGVDILANAVK.V1
*rpal_wt_anaer_light_2_cleared_1a.1418.1418.134.27820.420115999.631000.18174.073.3%12R.GVDILANAVK.V1
*rpal_wt_anaer_light_2_crude_1.1264.1264.254.03440.5341861000.121000.181252.073.7%8R.GVDILANAVK.V2
rpal_wt_anaer_light_2_crude_1a.299.299.125.84320.286126614.46614.7631236.070.0%1K.VTLGPK.G11
*rpal_wt_anaer_light_2_crude_1a.306.306.136.08510.276266688.54687.8151119.090.0%7R.NVVLDK.S1
*rpal_wt_anaer_light_2_pellet_1a.1301.1301.231.73580.2674331303.251303.5169.045.5%1R.NVVLDKSFGAPR.I2
rpal_wt_anaer_light_2_crude_1a.292.292.126.81630.166496634.53634.71319.090.0%4K.SFGAPR.I11
rpal_wt_anaer_light_2_pellet_2a.316.316.135.55270.3741431031.731032.231241.075.0%7R.ITKDGVTVAK.D11
rpal_wt_anaer_light_2_pellet_1.463.463.244.50350.5975551032.461032.231148.063.2%1R.ITKDGVTVAK.D22
*rpal_wt_anaer_light_2_pellet_5.1166.1166.256.94440.5927433025.383025.471211.041.7%5R.ITKDGVTVAKDIELDDKFENMGAQMVR.E2
*rpal_wt_anaer_light_2_pellet_2a.2111.2111.387.38680.5648063025.553025.471232.068.1%7R.ITKDGVTVAKDIELDDKFENMGAQMVR.E3
*rpal_wt_anaer_light_2_crude_full.2042.2042.268.16630.6904762682.182683.04177.057.1%7K.DGVTVAKDIELDDKFENMGAQMVR.E2
*rpal_wt_anaer_light_2_crude_full.2035.2035.377.81670.5634872683.722683.041191.065.2%3K.DGVTVAKDIELDDKFENMGAQMVR.E3
*rpal_wt_anaer_light_2_pellet_1.2470.2470.384.8870.5744072011.612012.271189.064.3%6K.DIELDDKFENMGAQMVR.E3
*rpal_wt_anaer_light_2_crude_full.1894.1894.273.4340.7177862011.672012.271234.076.7%10K.DIELDDKFENMGAQMVR.E2
*rpal_wt_anaer_light_2_pellet_1a.2484.2484.286.820.7246441989.521990.181215.077.8%33K.SADAAGDGTTTATVLAQAIVR.E2
*rpal_wt_anaer_light_2_pellet_1a.2491.2491.357.49430.4449541992.341990.181247.052.4%4K.SADAAGDGTTTATVLAQAIVR.E3
rpal_wt_anaer_light_2_pellet_full.1333.1333.266.68340.6720941217.931218.481111.077.3%8K.AVAAGMNPMDLK.R22
rpal_wt_anaer_light_2_crude_4.1120.1120.139.92580.4144891220.761218.481239.066.7%10K.AVAAGMNPMDLK.R11
rpal_wt_anaer_light_2_crude_full.695.695.136.79180.4463771373.561374.67186.068.4%9K.AVAAGMNPMDLKR.G11
rpal_wt_anaer_light_2_pellet_1a.1374.1374.262.41130.686931374.441374.671172.078.3%10K.AVAAGMNPMDLKR.G22
*rpal_wt_anaer_light_2_pellet_1.3824.3824.381.73130.5517411669.241668.981255.060.8%9K.RGIDLAVEAVVADLVK.N3
*rpal_wt_anaer_light_2_pellet_2.3664.3664.262.70080.632741671.341668.981116.072.4%7K.RGIDLAVEAVVADLVK.N2
*rpal_wt_anaer_light_2_pellet_5.2128.2128.148.64060.556271512.061512.791239.078.3%21R.GIDLAVEAVVADLVK.N1
*rpal_wt_anaer_light_2_pellet_1a.4133.4133.281.56510.6080791512.581512.791255.077.8%90R.GIDLAVEAVVADLVK.N2
*rpal_wt_anaer_light_2_crude_1.4224.4224.3105.5430.6616551513.011512.791252.071.7%15R.GIDLAVEAVVADLVK.N3
*rpal_wt_anaer_light_2_pellet_full.1516.1516.270.35930.6822082417.542418.621104.059.5%8K.KVTSNDEIAQVGTISANGDAEIGK.F2
*rpal_wt_anaer_light_2_pellet_1a.1822.1822.353.71590.5082092417.92418.621192.047.9%1K.KVTSNDEIAQVGTISANGDAEIGK.F3
*rpal_wt_anaer_light_2_pellet_full.3094.3094.367.04440.4710863194.863195.58150.054.0%4K.KVTSNDEIAQVGTISANGDAEIGKFLADAMK.K3
*rpal_wt_anaer_light_2_pellet_full.2894.2894.380.25130.5628963322.883323.75148.056.8%5K.KVTSNDEIAQVGTISANGDAEIGKFLADAMKK.V3
*rpal_wt_anaer_light_2_pellet_full.664.664.133.89790.524021795.42795.9771244.083.3%6K.FLADAMK.K1
*rpal_wt_anaer_light_2_pellet_full.459.459.134.67290.415301923.49924.1521212.078.6%5K.FLADAMKK.V1
*rpal_wt_anaer_light_2_pellet_1a.477.477.245.50590.36083924.12924.1521155.075.0%2K.FLADAMKK.V2
*rpal_wt_anaer_light_2_pellet_full.730.730.268.41360.6090461473.571473.671246.073.1%7K.KVGNEGVITVEEAK.S2
*rpal_wt_anaer_light_2_crude_4.485.485.147.75420.6549581473.961473.671107.076.2%8K.KVGNEGVITVEEAK.S1
*rpal_wt_anaer_light_2_pellet_full.734.734.358.19350.5065721474.131473.671222.059.1%4K.KVGNEGVITVEEAK.S3
*rpal_wt_anaer_light_2_crude_4.590.590.143.28680.5610651344.871345.491117.070.0%18K.VGNEGVITVEEAK.S1
*rpal_wt_anaer_light_2_pellet_1a.1210.1210.257.73020.6271541345.451345.491225.073.9%13K.VGNEGVITVEEAK.S2
*rpal_wt_anaer_light_2_pellet_2a.2882.2882.136.99870.2139481867.791869.061142.056.0%4K.SLETELDVVEGMQFDR.G1
*rpal_wt_anaer_light_2_pellet_1a.3191.3191.262.46870.2039491868.821869.061250.065.5%18K.SLETELDVVEGMQFDR.G2
*rpal_wt_anaer_light_2_pellet_full.1605.1605.147.57150.6545161474.561475.641157.078.9%11R.GYISPYFVTNADK.M1
*rpal_wt_anaer_light_2_crude_full.1396.1396.280.70420.7466921475.261475.641238.087.5%9R.GYISPYFVTNADK.M2
*rpal_wt_anaer_light_2_pellet_1a.2019.2019.260.59550.7290661762.321763.03151.070.4%7R.GYISPYFVTNADKMR.V2
*rpal_wt_anaer_light_2_crude_2a.2232.2232.150.90720.5938321568.731569.751158.080.0%15R.VEFDDAYILINEK.K1
*rpal_wt_anaer_light_2_crude_full.2094.2094.277.04370.7094781569.241569.751255.083.3%17R.VEFDDAYILINEK.K2
*rpal_wt_anaer_light_2_pellet_5.1148.1148.144.15170.6312461698.041697.93167.072.7%3R.VEFDDAYILINEKK.L1
*rpal_wt_anaer_light_2_crude_1.1965.1965.354.8330.2182411698.461697.931184.053.3%3R.VEFDDAYILINEKK.L3
*rpal_wt_anaer_light_2_pellet_1a.2284.2284.248.84210.5705431698.71697.931178.060.0%3R.VEFDDAYILINEKK.L2
*rpal_wt_anaer_light_2_pellet_full.5004.5004.375.64510.5690384369.084370.131161.056.8%5K.KLSNLNELLPLLEAVVQTGKPLVIVAEDVEGEALATLVVNR.L3
*rpal_wt_anaer_light_2_pellet_2a.5180.5180.357.84340.5157234240.884241.961148.049.5%3K.LSNLNELLPLLEAVVQTGKPLVIVAEDVEGEALATLVVNR.L3
*rpal_wt_anaer_light_2_pellet_2.473.473.128.82460.145528842.7843.0581184.069.2%1R.GGLKVAAVK.A1
*rpal_wt_anaer_light_2_pellet_2.1296.1296.248.39840.6178681544.311543.811116.048.3%1R.GGLKVAAVKAPGFGDR.R2
*rpal_wt_anaer_light_2_pellet_1a.1441.1441.357.40030.4473031544.431543.811201.057.4%1R.GGLKVAAVKAPGFGDR.R3
*rpal_wt_anaer_light_2_pellet_full.656.656.241.94630.5061881188.061188.371248.060.9%5K.VAAVKAPGFGDR.R2
*rpal_wt_anaer_light_2_pellet_1a.3282.3282.359.97640.4048092542.42543.01116.047.9%1R.RKAMLQDIAILTGGQAISEDLGIK.M3
*rpal_wt_anaer_light_2_pellet_4.3036.3036.249.99360.5341542542.752543.01208.046.5%2R.RKAMLQDIAILTGGQAISEDLGIK.M2
*rpal_wt_anaer_light_2_crude_full.2950.2950.280.74790.7377522385.462386.821238.065.0%22R.KAMLQDIAILTGGQAISEDLGIK.M2
*rpal_wt_anaer_light_2_pellet_1a.3529.3529.351.12280.3176232385.692386.821153.046.5%3R.KAMLQDIAILTGGQAISEDLGIK.M3
*rpal_wt_anaer_light_2_pellet_full.4084.4084.354.65580.4062413659.793660.3619.050.0%1R.KAMLQDIAILTGGQAISEDLGIKMENVTLQMLGR.A3
*rpal_wt_anaer_light_2_pellet_3.3905.3905.285.58140.6390222257.992258.641243.066.7%80K.AMLQDIAILTGGQAISEDLGIK.M2
*rpal_wt_anaer_light_2_crude_full.3381.3381.345.60110.4549822258.852258.641154.046.8%1K.AMLQDIAILTGGQAISEDLGIK.M3
*rpal_wt_anaer_light_2_pellet_2a.4510.4510.350.96950.3178983532.693532.181166.044.2%1K.AMLQDIAILTGGQAISEDLGIKMENVTLQMLGR.A3
*rpal_wt_anaer_light_2_pellet_2a.1781.1781.141.03530.5157711291.781292.571160.082.4%5K.MENVTLQMLGR.A1
*rpal_wt_anaer_light_2_crude_full.1519.1519.271.94320.6424861292.341292.571223.085.0%12K.MENVTLQMLGR.A2
*rpal_wt_anaer_light_2_pellet_2a.522.522.274.53380.7308382019.272018.391121.069.7%2R.AKKVMIDKENTTIVNGAGK.K2
*rpal_wt_anaer_light_2_pellet_5.646.646.143.50570.5797031818.051819.13157.064.0%1K.KVMIDKENTTIVNGAGK.K1
*rpal_wt_anaer_light_2_pellet_1.810.810.356.9290.4408211818.871819.131209.052.8%1K.KVMIDKENTTIVNGAGK.K3
*rpal_wt_anaer_light_2_pellet_3.758.758.259.57730.5981741820.211819.13118.066.7%2K.KVMIDKENTTIVNGAGK.K2
*rpal_wt_anaer_light_2_pellet_5.721.721.139.27550.448311689.991690.96124.069.6%1K.VMIDKENTTIVNGAGK.K1
*rpal_wt_anaer_light_2_pellet_1a.1185.1185.273.26640.5597781690.391690.961226.078.6%6K.VMIDKENTTIVNGAGK.K2
*rpal_wt_anaer_light_2_pellet_1a.1004.1004.259.44670.5328671818.651819.131148.067.7%3K.VMIDKENTTIVNGAGKK.A2
*rpal_wt_anaer_light_2_pellet_full.643.643.369.0790.4668831818.921819.131242.065.3%2K.VMIDKENTTIVNGAGKK.A3
*rpal_wt_anaer_light_2_pellet_5.631.631.139.03710.276661821.081819.13192.060.0%3K.VMIDKENTTIVNGAGKK.A1
*rpal_wt_anaer_light_2_pellet_4.1095.1095.254.94850.5974382474.352474.84123.051.2%1K.VMIDKENTTIVNGAGKKADIEAR.V2
*rpal_wt_anaer_light_2_pellet_2.1260.1260.351.83390.3470452474.632474.8413.046.5%1K.VMIDKENTTIVNGAGKKADIEAR.V3
*rpal_wt_anaer_light_2_pellet_4.534.534.131.00030.5304691427.711428.45184.063.2%1K.AQIEETTSDYDR.E1
*rpal_wt_anaer_light_2_pellet_2.597.597.243.04740.6078971428.481428.45111.059.1%1K.AQIEETTSDYDR.E2
*rpal_wt_anaer_light_2_crude_5.361.361.126.77590.2505241685.021685.741131.052.4%2K.AQIEETTSDYDREK.L1
*rpal_wt_anaer_light_2_pellet_full.438.438.262.77890.6900041685.471685.741222.076.0%5K.AQIEETTSDYDREK.L2
*rpal_wt_anaer_light_2_pellet_1a.504.504.362.76220.5315871686.21685.741195.067.4%1K.AQIEETTSDYDREK.L3
*rpal_wt_anaer_light_2_pellet_3.1014.1014.240.31920.5270962212.02212.341145.048.4%3K.AQIEETTSDYDREKLQER.L2
rpal_wt_anaer_light_2_crude_full.477.477.258.47420.503121855.82856.0571240.088.2%22K.LAGGVAVIR.V22
rpal_wt_anaer_light_2_pellet_1a.392.392.132.3150.510995988.52989.1141140.073.3%5R.VGGATEVEVK.E11
rpal_wt_anaer_light_2_pellet_1a.394.394.244.60550.204264989.37989.1141208.073.7%1R.VGGATEVEVK.E22
*rpal_wt_anaer_light_2_pellet_4.415.415.141.28640.4268061273.921274.42192.077.8%3R.VGGATEVEVKER.K1
*rpal_wt_anaer_light_2_pellet_4.375.375.129.36630.4195761414.781415.571136.061.1%2R.KDRVDDAMHATR.A1
*rpal_wt_anaer_light_2_pellet_1a.323.323.240.41530.4837851415.541415.57183.063.6%1R.KDRVDDAMHATR.A2
*rpal_wt_anaer_light_2_pellet_4.418.418.126.11360.3553781286.751287.41136.052.9%1K.DRVDDAMHATR.A1
*rpal_wt_anaer_light_2_pellet_1.481.481.245.64640.5568721289.751287.41112.070.0%1K.DRVDDAMHATR.A2
*rpal_wt_anaer_light_2_pellet_3.362.362.128.01070.3853961015.621016.121201.064.3%1R.VDDAMHATR.A1
*rpal_wt_anaer_light_2_pellet_full.2043.2043.269.9850.5768621608.381608.881212.073.3%18R.AAVEEGIVPGGGVALLR.A2
*rpal_wt_anaer_light_2_crude_1a.2088.2088.371.23650.3581931608.611608.881245.058.2%5R.AAVEEGIVPGGGVALLR.A3
*rpal_wt_anaer_light_2_crude_5.1084.1084.143.16840.5323921609.161608.881168.066.7%17R.AAVEEGIVPGGGVALLR.A1
*rpal_wt_anaer_light_2_pellet_3.425.425.140.84270.358894973.78974.1461177.085.7%3R.ASEQLKGLK.T1
*rpal_wt_anaer_light_2_pellet_1.453.453.247.25160.53602974.2974.146129.076.5%2R.ASEQLKGLK.T2
*rpal_wt_anaer_light_2_pellet_2.454.454.235.00620.3912791602.51603.7710.046.2%1K.TKNDDQKTGVEIVR.R2
*rpal_wt_anaer_light_2_pellet_5.401.401.129.12760.3072341603.161603.771162.054.5%1K.TKNDDQKTGVEIVR.R1
*rpal_wt_anaer_light_2_pellet_4.446.446.130.06220.3582141373.861374.491100.066.7%1K.NDDQKTGVEIVR.R1
*rpal_wt_anaer_light_2_pellet_1a.373.373.230.65140.186683930.21930.096132.060.0%1K.TGVEIVRR.A2
*rpal_wt_anaer_light_2_pellet_1a.2401.2401.372.68220.6083142610.122610.841153.053.7%3K.VLEKEQYAFGFDSQSGEYGDLVK.K3
*rpal_wt_anaer_light_2_pellet_2a.2131.2131.272.94090.7628372610.962610.841216.057.5%7K.VLEKEQYAFGFDSQSGEYGDLVK.K2
*rpal_wt_anaer_light_2_crude_2a.1729.1729.261.68440.7496742738.412739.011104.047.6%5K.VLEKEQYAFGFDSQSGEYGDLVKK.G2
*rpal_wt_anaer_light_2_pellet_3.1982.1982.381.50410.5995662739.12739.011246.065.2%6K.VLEKEQYAFGFDSQSGEYGDLVKK.G3
*rpal_wt_anaer_light_2_pellet_1a.347.347.139.62760.460505871.52872.0531225.091.7%3K.KGIIDPTK.V1
*rpal_wt_anaer_light_2_pellet_1a.349.349.241.25820.432813872.41872.0531225.075.0%2K.KGIIDPTK.V2
*rpal_wt_anaer_light_2_pellet_full.891.891.240.04240.3037481226.381226.511205.061.9%5K.KGIIDPTKVVR.T2
*rpal_wt_anaer_light_2_pellet_1.1089.1089.345.7010.3276431227.761226.511227.051.4%1K.KGIIDPTKVVR.T3
*rpal_wt_anaer_light_2_pellet_full.408.408.129.19970.176252743.54743.8791206.072.7%6K.GIIDPTK.V1
*rpal_wt_anaer_light_2_pellet_1.1370.1370.237.07730.1453751099.741098.331144.063.2%3K.GIIDPTKVVR.T2
*rpal_wt_anaer_light_2_pellet_2a.4889.4889.281.8660.7128752541.192542.011232.061.9%93R.TAIQNAASVAALLITTEAMIAELPK.K2
*rpal_wt_anaer_light_2_pellet_2.5378.5378.382.38980.6506532543.232542.011255.051.4%179R.TAIQNAASVAALLITTEAMIAELPK.K3
*rpal_wt_anaer_light_2_crude_full.4189.4189.366.86280.520442669.932670.19192.054.4%6R.TAIQNAASVAALLITTEAMIAELPKK.G3
*rpal_wt_anaer_light_2_pellet_2a.4509.4509.367.92920.6003164231.764232.96190.045.1%9R.TAIQNAASVAALLITTEAMIAELPKKGGAGAGGMPPGGGMGGMDF.-3
*rpal_wt_anaer_light_2_pellet_2a.1728.1728.155.31910.7265831708.631709.971193.066.7%6K.KGGAGAGGMPPGGGMGGMDF.-1
*rpal_wt_anaer_light_2_pellet_1a.1982.1982.254.58830.6298551710.031709.971192.055.6%7K.KGGAGAGGMPPGGGMGGMDF.-2
Similarities: RPA1140(11:105)

URPA21534721487.8%476505036.1RPA2153 aldehyde dehydrogenase 2423788:2425218 forward MW:50503
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_pellet_3.2444.2444.262.82650.6689341897.041897.251248.076.9%3R.MQFYIDGAWVDPVVKK.S2
*rpal_wt_anaer_light_2_pellet_1a.2580.2580.364.58780.4502181897.961897.251117.061.7%2R.MQFYIDGAWVDPVVKK.S3
*rpal_wt_anaer_light_2_crude_2a.1972.1972.242.00380.5683872322.112322.64180.047.4%1K.KSTPVVNPATEEAMYEVALGSK.A2
*rpal_wt_anaer_light_2_cleared_full.2277.2277.275.86780.6843712193.842194.471132.069.4%12K.STPVVNPATEEAMYEVALGSK.A2
*rpal_wt_anaer_light_2_cleared_3.404.404.139.27950.5054291058.641059.211238.075.0%3K.ADVDKAVAAAK.R1
*rpal_wt_anaer_light_2_pellet_4.401.401.130.34460.3663061214.881215.41202.057.9%1K.ADVDKAVAAAKR.A1
*rpal_wt_anaer_light_2_crude_1.1065.1065.232.60230.4588051147.731145.2614.061.1%2R.AFETFSVTSR.E2
*rpal_wt_anaer_light_2_pellet_full.683.683.128.36580.277701686.57686.87160.088.9%6R.IALLEK.V1
*rpal_wt_anaer_light_2_pellet_full.421.421.132.17020.40462690.44692.87718.088.9%2K.VVAIYK.S1
*rpal_wt_anaer_light_2_pellet_full.2046.2046.283.2260.701592189.832190.611158.071.1%8R.MKEIGAAISDEMGAPLPMAEK.M2
*rpal_wt_anaer_light_2_cleared_1a.2190.2190.366.19250.4779032190.972190.611169.055.4%6R.MKEIGAAISDEMGAPLPMAEK.M3
*rpal_wt_anaer_light_2_pellet_full.2709.2709.278.56260.7429931842.811843.221158.078.1%9K.MQAGAGLGHIMSTLDVLK.N2
*rpal_wt_anaer_light_2_pellet_1a.3116.3116.357.96060.5240841843.61843.221214.053.6%7K.MQAGAGLGHIMSTLDVLK.N3
*rpal_wt_anaer_light_2_crude_5.1400.1400.147.02620.5350781844.111843.221224.068.0%4K.MQAGAGLGHIMSTLDVLK.N1
*rpal_wt_anaer_light_2_pellet_full.4044.4044.362.75440.5266534202.274203.941154.053.0%6K.NYQFEEPLGSAMIVREPIGVVGMITPWNWPLNQIACK.V3
*rpal_wt_anaer_light_2_cleared_2a.3782.3782.249.78380.5404892467.432467.961192.047.4%9R.EPIGVVGMITPWNWPLNQIACK.V2
*rpal_wt_anaer_light_2_crude_1a.3962.3962.355.23410.4076012469.352467.961155.050.8%2R.EPIGVVGMITPWNWPLNQIACK.V3
*rpal_wt_anaer_light_2_pellet_full.3913.3913.370.06550.4676883782.473782.51204.061.2%8K.VAPAIAAGCTMVLKPSEFTPTSALLFAEILHEAGVPK.G3
*rpal_wt_anaer_light_2_crude_full.3352.3352.357.50960.3021113419.853420.851110.050.0%3K.GVFNLVNGLGPEVGAAMSEHPDIDMISFTGSTR.A3
*rpal_wt_anaer_light_2_pellet_5.1865.1865.230.0030.3553713421.583420.851141.020.7%1K.GVFNLVNGLGPEVGAAMSEHPDIDMISFTGSTR.A2
*rpal_wt_anaer_light_2_pellet_1.473.473.243.93190.464137829.98829.9321242.080.0%2R.AGIDVAQR.A2
*rpal_wt_anaer_light_2_cleared_2.1786.1786.354.21710.3508082370.572370.671120.044.8%1K.RVSQELGGKSPNVILEDADLTK.A3
*rpal_wt_anaer_light_2_cleared_2a.1615.1615.256.80240.6751352371.462370.67121.050.0%4K.RVSQELGGKSPNVILEDADLTK.A2
*rpal_wt_anaer_light_2_pellet_2.2055.2055.383.69440.514152213.792214.481253.059.4%6R.VSQELGGKSPNVILEDADLTK.A3
*rpal_wt_anaer_light_2_crude_full.1622.1622.282.37870.7361272214.12214.481215.073.7%9R.VSQELGGKSPNVILEDADLTK.A2
*rpal_wt_anaer_light_2_crude_full.1432.1432.270.80390.7785691414.381415.581236.082.6%5K.SPNVILEDADLTK.A2
*rpal_wt_anaer_light_2_crude_2a.1534.1534.156.97710.6941951414.631415.581212.090.0%5K.SPNVILEDADLTK.A1
*rpal_wt_anaer_light_2_pellet_1a.1750.1750.373.4920.5784582265.672266.551222.060.9%7K.AVTGGVMHMFNNSGQSCNAPSR.M3
*rpal_wt_anaer_light_2_pellet_2a.1493.1493.268.57530.7417292266.982266.551233.064.1%6K.AVTGGVMHMFNNSGQSCNAPSR.M2
*rpal_wt_anaer_light_2_cleared_1a.901.901.135.87230.424762787.53788.0421180.090.9%2R.MIVPLSK.M1
*rpal_wt_anaer_light_2_cleared_3.455.455.130.51450.13137960.8961.2141205.071.4%3K.MKEVAAIAK.G1
*rpal_wt_anaer_light_2_pellet_2a.677.677.126.05270.2157591199.851200.341132.055.6%1R.GEGTTIGPVVNR.I1
*rpal_wt_anaer_light_2_pellet_1a.819.819.244.75540.3196311200.391200.341147.063.6%6R.GEGTTIGPVVNR.I2
*rpal_wt_anaer_light_2_crude_4.1823.1823.139.37760.5115881499.681500.781163.068.4%4R.IQWDKIQTLINK.G1
*rpal_wt_anaer_light_2_pellet_2.2207.2207.260.12080.6960451501.051500.781112.077.3%5R.IQWDKIQTLINK.G2
*rpal_wt_anaer_light_2_cleared_5.2042.2042.241.54330.5338263446.863447.96156.031.0%2R.IQWDKIQTLINKGIEEGATLVAGGPGLPEGVNK.G2
*rpal_wt_anaer_light_2_cleared_full.3732.3732.358.71230.3668723447.673447.961212.042.0%3R.IQWDKIQTLINKGIEEGATLVAGGPGLPEGVNK.G3
*rpal_wt_anaer_light_2_pellet_2a.2764.2764.260.40410.6683652776.412777.19148.042.9%4K.IQTLINKGIEEGATLVAGGPGLPEGVNK.G2
*rpal_wt_anaer_light_2_cleared_1a.2866.2866.350.09620.3867742778.322777.191217.036.9%1K.IQTLINKGIEEGATLVAGGPGLPEGVNK.G3
*rpal_wt_anaer_light_2_crude_full.1601.1601.267.05040.5495521964.821966.21246.060.5%8K.GIEEGATLVAGGPGLPEGVNK.G2
*rpal_wt_anaer_light_2_cleared_5.1163.1163.145.66530.579281966.031966.21141.061.3%6K.GIEEGATLVAGGPGLPEGVNK.G1
*rpal_wt_anaer_light_2_pellet_full.1769.1769.255.17270.5571671600.341600.861203.064.0%9K.GFYVRPTVFADVTK.D2
*rpal_wt_anaer_light_2_pellet_2.2765.2765.350.760.3889642289.132288.681188.044.1%1K.GFYVRPTVFADVTKDMTIAR.E3
*rpal_wt_anaer_light_2_pellet_2a.3887.3887.348.16480.3964264297.874298.77140.043.7%1R.EEIFGPVLVIMGAKDENEAVELANDTPYGLAGYVSAGSVDR.A3
*rpal_wt_anaer_light_2_pellet_2a.943.943.136.21880.5016791367.881368.49116.065.0%7R.AGNVNLQGVPNER.T1
*rpal_wt_anaer_light_2_cleared_1a.965.965.248.30170.6464061368.051368.491216.065.2%10R.AGNVNLQGVPNER.T2
*rpal_wt_anaer_light_2_cleared_5.1425.1425.125.90450.1392191728.241727.95166.045.0%1R.EWGKFGLEEYLEVK.A1

URPA46425022787.8%361393416.3cbbA fructose-bisphosphate aldolase 5225636:5226721 reverse MW:39341
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_pellet_full.4264.4264.352.01150.4571474662.914661.321134.045.6%1R.QLLDHAAEHGYGVPAFNINNMEQGLAIMEAAALVDAPVIIQASR.G3
*rpal_wt_anaer_light_2_crude_full.1005.1005.257.07220.64941126.271126.321154.083.3%9R.SYANDIMLAK.M2
*rpal_wt_anaer_light_2_crude_3.951.951.133.91640.4819141128.71126.32164.075.0%10R.SYANDIMLAK.M1
*rpal_wt_anaer_light_2_crude_full.2531.2531.363.60120.4117893547.953548.061182.059.3%5K.MIDALAEMYPDIPLCMHQDHGNDEATCATAIR.Y3
*rpal_wt_anaer_light_2_pellet_4.2035.2035.131.44710.5306021435.711436.69183.065.0%2R.YGFTSVMMDGSLK.A1
*rpal_wt_anaer_light_2_pellet_1a.2322.2322.253.33820.69781435.861436.691242.070.8%2R.YGFTSVMMDGSLK.A2
*rpal_wt_anaer_light_2_pellet_1a.1499.1499.264.23390.7160771530.491530.631240.073.9%5K.TAADYQYNVDITR.R2
*rpal_wt_anaer_light_2_pellet_5.847.847.130.44570.457461531.211530.631128.068.4%1K.TAADYQYNVDITR.R1
*rpal_wt_anaer_light_2_crude_full.2951.2951.372.92730.5378333987.173986.33136.057.9%8R.RVVDMAHWVGASVEGELGVLGSLEHGGGEQEDGHGVEGK.V3
*rpal_wt_anaer_light_2_crude_full.3114.3114.379.68890.4705343829.083830.141250.060.6%6R.VVDMAHWVGASVEGELGVLGSLEHGGGEQEDGHGVEGK.V3
*rpal_wt_anaer_light_2_cleared_full.1924.1924.238.61170.3259012102.642103.341204.050.0%2K.VSREQLLTDPDQAVEFVR.A2
*rpal_wt_anaer_light_2_pellet_full.1968.1968.384.97030.5912612102.772103.341253.064.3%8K.VSREQLLTDPDQAVEFVR.A3
*rpal_wt_anaer_light_2_pellet_full.2129.2129.361.44460.5471691760.551760.941253.057.1%3R.EQLLTDPDQAVEFVR.A3
*rpal_wt_anaer_light_2_crude_full.1944.1944.271.77160.7291131760.581760.941225.078.6%10R.EQLLTDPDQAVEFVR.A2
*rpal_wt_anaer_light_2_crude_5.820.820.149.64470.6709031905.071906.21167.072.4%2R.ATKVDALAIAMGTSHGAYK.F1
*rpal_wt_anaer_light_2_pellet_1.1770.1770.369.36370.4778091906.461906.211179.059.0%3R.ATKVDALAIAMGTSHGAYK.F3
*rpal_wt_anaer_light_2_pellet_3.1598.1598.273.78140.6195911907.271906.211182.071.4%4R.ATKVDALAIAMGTSHGAYK.F2
*rpal_wt_anaer_light_2_cleared_full.1598.1598.365.70510.5039462296.662296.66141.056.9%6R.ATKVDALAIAMGTSHGAYKFSR.K3
*rpal_wt_anaer_light_2_pellet_2a.1778.1778.270.66940.6385212297.112296.661164.064.1%3R.ATKVDALAIAMGTSHGAYKFSR.K2
*rpal_wt_anaer_light_2_pellet_5.1006.1006.142.65660.6159331606.051605.861232.062.5%2K.VDALAIAMGTSHGAYK.F1
*rpal_wt_anaer_light_2_pellet_full.1598.1598.365.45410.4817851606.21605.861230.063.5%4K.VDALAIAMGTSHGAYK.F3
*rpal_wt_anaer_light_2_crude_2.1486.1486.261.32980.6946071606.591605.861225.069.0%6K.VDALAIAMGTSHGAYK.F2
*rpal_wt_anaer_light_2_pellet_2a.1913.1913.247.96120.6286541996.911996.3148.050.0%1K.VDALAIAMGTSHGAYKFSR.K2
*rpal_wt_anaer_light_2_pellet_1.2187.2187.348.19640.4494531997.121996.31234.048.3%1K.VDALAIAMGTSHGAYKFSR.K3
*rpal_wt_anaer_light_2_pellet_full.486.486.145.19220.5572891073.671074.291190.081.2%7R.KPDGDVLAMK.V1
*rpal_wt_anaer_light_2_pellet_1a.538.538.253.6670.6838491075.081074.291151.083.3%7R.KPDGDVLAMK.V2
*rpal_wt_anaer_light_2_crude_full.3675.3675.368.42340.5728764752.744752.391199.056.3%10R.RLPNTHLVMHGSSSVPQDLQDIFNEFGGAMPQTFGVPVEEIVR.G3
*rpal_wt_anaer_light_2_crude_5.1964.1964.353.24430.4559764598.024596.21164.050.6%7R.LPNTHLVMHGSSSVPQDLQDIFNEFGGAMPQTFGVPVEEIVR.G3
*rpal_wt_anaer_light_2_pellet_full.375.375.135.64530.6048461063.581064.211105.078.6%4R.KVNIDTDCR.L1
*rpal_wt_anaer_light_2_pellet_full.371.371.237.85850.4322461064.581064.211220.058.8%1R.KVNIDTDCR.L2
*rpal_wt_anaer_light_2_pellet_1a.1619.1619.242.57180.56668894.9895.1131180.080.0%6R.LAMTGVFR.K2
*rpal_wt_anaer_light_2_pellet_1a.1245.1245.236.96320.5623271022.921023.291201.058.8%4R.LAMTGVFRK.V2
*rpal_wt_anaer_light_2_pellet_4.838.838.134.650.3907591307.841308.65176.061.1%1R.KFLKPAMDAMR.D1
*rpal_wt_anaer_light_2_pellet_1.1070.1070.237.33640.476881308.381308.651151.050.0%1R.KFLKPAMDAMR.D2
*rpal_wt_anaer_light_2_pellet_1.1984.1984.345.10360.2744421767.531768.22187.042.9%1R.KFLKPAMDAMRDICK.L3
*rpal_wt_anaer_light_2_pellet_2a.1077.1077.128.92630.3018431179.831180.48120.068.8%2K.FLKPAMDAMR.D1
*rpal_wt_anaer_light_2_pellet_full.1065.1065.234.87670.3518311179.851180.481133.055.6%2K.FLKPAMDAMR.D2
*rpal_wt_anaer_light_2_pellet_1.2199.2199.358.40170.4532521641.411640.051151.064.3%3K.FLKPAMDAMRDICK.L3
*rpal_wt_anaer_light_2_pellet_2.1246.1246.263.03080.7234031526.821526.691106.069.2%3K.LRFEQFGTAGNASK.I2
*rpal_wt_anaer_light_2_crude_2a.785.785.127.89780.2588591526.891526.6918.052.4%1K.LRFEQFGTAGNASK.I1
*rpal_wt_anaer_light_2_pellet_full.523.523.137.94320.6216691256.531257.35174.068.4%8R.FEQFGTAGNASK.I1
*rpal_wt_anaer_light_2_pellet_1a.632.632.257.38010.5346731257.211257.351250.077.3%3R.FEQFGTAGNASK.I2
*rpal_wt_anaer_light_2_crude_full.644.644.136.01540.3759671216.651217.581205.064.7%10K.IKVVPMAEMAK.R1
*rpal_wt_anaer_light_2_crude_full.645.645.243.93650.4588531216.681217.581226.065.0%6K.IKVVPMAEMAK.R2
*rpal_wt_anaer_light_2_pellet_1a.1341.1341.365.70580.5648121217.621217.581228.072.2%6K.IKVVPMAEMAK.R3
*rpal_wt_anaer_light_2_pellet_full.738.738.127.21230.351231975.45976.2481148.069.2%1K.VVPMAEMAK.R1
*rpal_wt_anaer_light_2_crude_1a.859.859.271.08710.6563811603.451603.821204.075.0%9R.YKSGALDPQIGQVAR.A2
*rpal_wt_anaer_light_2_pellet_1.1329.1329.374.0180.3991991603.61603.821235.070.2%8R.YKSGALDPQIGQVAR.A3
*rpal_wt_anaer_light_2_pellet_full.1095.1095.128.7630.4271461603.771603.821137.060.9%2R.YKSGALDPQIGQVAR.A1
*rpal_wt_anaer_light_2_pellet_1a.1405.1405.263.20280.5763491312.681312.471220.082.6%10K.SGALDPQIGQVAR.A2

URPA16004887.2%7883915.3RPA1600 BolA-like protein 1779811:1780047 forward MW:8390
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_cleared_full.1085.1085.131.98010.461143819.41819.9971108.075.0%4R.DIEAMIK.A1
*rpal_wt_anaer_light_2_cleared_3.4076.4076.348.69630.285283177.863176.471132.043.4%1K.AAIPDAEVTIRDLAGDGDHYAATVISETFR.G3
*rpal_wt_anaer_light_2_crude_3.2475.2475.242.8480.574822039.232039.171122.041.2%1R.DLAGDGDHYAATVISETFR.G2
*rpal_wt_anaer_light_2_crude_full.3145.3145.238.50440.5097083301.063302.7812.029.1%2R.VQQHQIVYQSLQGQMGGVLHALALQTGVPEA.-2

URPA2165229786.5%104111648.4groES2 chaperonin GroES2, cpn10 2439028:2439342 reverse MW:11164
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_pellet_1a.564.564.237.48680.402911186.221186.381140.064.7%4-.MNFRPLHDR.V2
*rpal_wt_anaer_light_2_pellet_1a.1357.1357.247.34620.4789151157.191157.351187.063.6%13K.TAGGIIIPDTAK.E2
*rpal_wt_anaer_light_2_crude_2a.781.781.144.37450.4528011159.741157.351222.082.4%15K.TAGGIIIPDTAK.E1
*rpal_wt_anaer_light_2_cleared_4.2259.2259.355.110.383664014.284013.63142.046.7%1K.TAGGIIIPDTAKEKPSQGEIVAVGPGGRDEAGKLIPIDLK.V3
*rpal_wt_anaer_light_2_pellet_2.685.685.251.77820.6167691580.651581.77122.063.3%2K.EKPSQGEIVAVGPGGR.D2
*rpal_wt_anaer_light_2_pellet_5.594.594.135.67060.5385561582.211581.771145.056.5%1K.EKPSQGEIVAVGPGGR.D1
*rpal_wt_anaer_light_2_pellet_1a.700.700.345.83840.3740072081.972082.281131.050.0%1K.EKPSQGEIVAVGPGGRDEAGK.L3
*rpal_wt_anaer_light_2_cleared_3.600.600.243.70380.5749452082.022082.28134.045.9%5K.EKPSQGEIVAVGPGGRDEAGK.L2
*rpal_wt_anaer_light_2_pellet_2a.1918.1918.236.79510.4648422874.132875.310.032.0%6K.EKPSQGEIVAVGPGGRDEAGKLIPIDLK.V2
*rpal_wt_anaer_light_2_cleared_full.1783.1783.352.65670.4384762874.762875.3143.052.6%3K.EKPSQGEIVAVGPGGRDEAGKLIPIDLK.V3
rpal_wt_anaer_light_2_cleared_1.730.730.241.38790.231435991.09991.1791228.070.6%1K.VGDRVLFGK.W22
rpal_wt_anaer_light_2_pellet_full.448.448.127.86140.329883563.39563.7181214.087.5%6R.VLFGK.W11
*rpal_wt_anaer_light_2_cleared_4.1369.1369.132.27890.4648181351.891351.591212.061.1%1R.VLFGKWSGTEVK.I1
*rpal_wt_anaer_light_2_cleared_2a.672.672.132.92120.4261571220.91220.37197.071.4%3K.WSGTEVKIDGK.E1
*rpal_wt_anaer_light_2_crude_3.1099.1099.139.81640.2998661159.761160.461233.080.0%8K.IDGKELLIMK.E1
*rpal_wt_anaer_light_2_crude_1a.1268.1268.246.98650.3445011160.661160.46196.077.8%4K.IDGKELLIMK.E2
*rpal_wt_anaer_light_2_cleared_4.3086.3086.261.67820.7169292575.352577.08153.050.0%1K.IDGKELLIMKESDIMGVITDVGAK.K2
*rpal_wt_anaer_light_2_cleared_2.3222.3222.366.68240.5653252575.482577.081229.056.1%1K.IDGKELLIMKESDIMGVITDVGAK.K3
*rpal_wt_anaer_light_2_crude_2.689.689.136.66190.186496748.66746.9891186.090.0%4K.ELLIMK.E1
*rpal_wt_anaer_light_2_cleared_1a.2208.2208.264.72990.6696241435.111435.641234.073.1%5K.ESDIMGVITDVGAK.K2
*rpal_wt_anaer_light_2_cleared_2a.2048.2048.160.59690.6624781437.731435.641171.090.5%10K.ESDIMGVITDVGAK.K1
*rpal_wt_anaer_light_2_crude_2.1707.1707.238.74510.5905161563.381563.811203.044.4%2K.ESDIMGVITDVGAKK.K2
Similarities: RPA1141(2:20)

URPA40166333385.7%398434185.7metK methionine S-adenosyltransferase 4544761:4545957 reverse MW:43418
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_pellet_2.1391.1391.365.32160.509272634.22633.94158.047.8%3-.MRASYMFTSESVSEGHPDKVCDR.I3
*rpal_wt_anaer_light_2_pellet_2a.1272.1272.252.87660.6322442346.672346.56159.051.4%6R.ASYMFTSESVSEGHPDKVCDR.I2
*rpal_wt_anaer_light_2_pellet_2a.2659.2659.142.08570.6143841369.791370.551212.082.4%7R.ISDEIVDLFYR.E1
*rpal_wt_anaer_light_2_pellet_1.3036.3036.271.85930.6803421371.511370.551191.090.0%10R.ISDEIVDLFYR.E2
*rpal_wt_anaer_light_2_crude_5.1225.1225.129.48160.3019171781.081782.0122.045.5%2R.ISDEIVDLFYREGPK.A1
*rpal_wt_anaer_light_2_crude_full.2135.2135.262.79420.6150581781.921782.01185.065.4%12R.ISDEIVDLFYREGPK.A2
*rpal_wt_anaer_light_2_crude_1a.2411.2411.352.29130.2872641782.611782.01213.054.5%5R.ISDEIVDLFYREGPK.A3
*rpal_wt_anaer_light_2_crude_4.1167.1167.125.78980.223341409.851410.621208.050.0%1R.EGPKAGIDPWAIR.A1
*rpal_wt_anaer_light_2_crude_1a.1567.1567.256.48540.2982541000.03999.1581224.087.5%9K.AGIDPWAIR.A2
*rpal_wt_anaer_light_2_pellet_3.1395.1395.255.47710.6680341948.911949.241230.054.5%8R.AACETLATTNKVVIAGETR.G2
*rpal_wt_anaer_light_2_cleared_1.1450.1450.356.73710.392041949.321949.241214.051.8%3R.AACETLATTNKVVIAGETR.G3
*rpal_wt_anaer_light_2_crude_full.1525.1525.357.42080.42542453.862453.76118.054.5%3K.VVIAGETRGPASVTNEQIEQVVR.D3
*rpal_wt_anaer_light_2_crude_4.1571.1571.232.74670.2515552454.062453.7610.031.7%1K.VVIAGETRGPASVTNEQIEQVVR.D2
*rpal_wt_anaer_light_2_pellet_full.1438.1438.143.32710.5922531626.881627.8173.072.7%7R.GPASVTNEQIEQVVR.D1
*rpal_wt_anaer_light_2_cleared_full.1368.1368.274.47940.6589241628.551627.81247.084.6%11R.GPASVTNEQIEQVVR.D2
*rpal_wt_anaer_light_2_cleared_1.1650.1650.352.3080.2331561629.141627.8122.059.1%1R.GPASVTNEQIEQVVR.D3
*rpal_wt_anaer_light_2_pellet_2a.1713.1713.147.06540.5804881935.91937.12184.070.8%7R.DAIKDIGYEQEGFHWK.T1
*rpal_wt_anaer_light_2_cleared_1a.1735.1735.273.74520.7487951936.861937.121154.075.9%9R.DAIKDIGYEQEGFHWK.T2
*rpal_wt_anaer_light_2_crude_1a.1671.1671.368.63030.5535911937.561937.121252.064.0%5R.DAIKDIGYEQEGFHWK.T3
*rpal_wt_anaer_light_2_crude_4.2575.2575.244.90740.527472916.392917.25183.037.5%2K.TADIEILLHPQSADIAQGVDALQPGTNK.E2
*rpal_wt_anaer_light_2_crude_full.590.590.348.0570.2686522864.472865.221211.047.7%1K.EKVLGPDSKSQVTIQYENGKPQYVR.E3
*rpal_wt_anaer_light_2_cleared_2.370.370.132.56410.285458716.67715.8251212.075.0%6K.VLGPDSK.S1
*rpal_wt_anaer_light_2_crude_full.590.590.258.58490.6991441909.981911.131209.065.5%8K.SQVTIQYENGKPQYVR.E3
*rpal_wt_anaer_light_2_cleared_1a.1102.1102.352.00210.473961912.151911.13187.049.0%5K.SQVTIQYENGKPQYVR.E3
*rpal_wt_anaer_light_2_crude_1a.1692.1692.382.82510.5847252217.812218.481127.067.9%7R.EIVVSHQHLIEDLSSNQIR.D3
*rpal_wt_anaer_light_2_pellet_2a.1721.1721.268.510.685112220.152218.481203.067.6%9R.EIVVSHQHLIEDLSSNQIR.D2
*rpal_wt_anaer_light_2_cleared_full.2257.2257.238.12120.4744393180.013180.571208.029.8%6R.EIVVSHQHLIEDLSSNQIRDCVEPYVR.Q2
*rpal_wt_anaer_light_2_cleared_3.2516.2516.366.24020.5488663181.423180.571203.052.8%12R.EIVVSHQHLIEDLSSNQIRDCVEPYVR.Q3
*rpal_wt_anaer_light_2_pellet_1a.742.742.235.73130.453516981.02981.1171240.066.7%1R.DCVEPYVR.Q2
*rpal_wt_anaer_light_2_pellet_3.2943.2943.246.36370.5494672378.012378.6514.044.4%4R.QALPDGWITDNTIWHINPTGK.F2
*rpal_wt_anaer_light_2_pellet_2.2997.2997.351.9930.4402962379.682378.651166.050.8%2R.QALPDGWITDNTIWHINPTGK.F3
*rpal_wt_anaer_light_2_cleared_full.1470.1470.261.65740.6358051526.061526.651110.071.4%6K.FYIGGPDGDTGLTGR.K2
*rpal_wt_anaer_light_2_cleared_2a.1236.1236.125.30070.3458441653.831654.82156.045.8%1K.FYIGGPDGDTGLTGRK.I1
*rpal_wt_anaer_light_2_pellet_1a.1592.1592.261.96080.6002881654.281654.821195.063.3%8K.FYIGGPDGDTGLTGRK.I2
*rpal_wt_anaer_light_2_crude_4.686.686.249.86530.635462445.642445.7410.045.7%4R.KIIVDTYGGAAPHGGGAFSGKDPTK.V2
*rpal_wt_anaer_light_2_crude_2.645.645.350.80770.4054432447.072445.74141.045.0%2R.KIIVDTYGGAAPHGGGAFSGKDPTK.V3
*rpal_wt_anaer_light_2_crude_full.936.936.377.11530.5558922815.332816.151253.056.5%6R.KIIVDTYGGAAPHGGGAFSGKDPTKVDR.S3
*rpal_wt_anaer_light_2_cleared_2a.1090.1090.259.93470.6944472815.592816.151144.050.0%4R.KIIVDTYGGAAPHGGGAFSGKDPTKVDR.S2
*rpal_wt_anaer_light_2_crude_3.874.874.237.7870.5125732316.842317.56132.037.2%1K.IIVDTYGGAAPHGGGAFSGKDPTK.V2
*rpal_wt_anaer_light_2_crude_2.1084.1084.362.27910.4756122687.532687.971215.048.2%7K.IIVDTYGGAAPHGGGAFSGKDPTKVDR.S3
*rpal_wt_anaer_light_2_crude_2a.1095.1095.255.63620.6847022688.52687.971164.052.1%5K.IIVDTYGGAAPHGGGAFSGKDPTKVDR.S2
*rpal_wt_anaer_light_2_cleared_full.483.483.151.12160.673936973.51974.1031108.093.8%9K.NVVASGLADK.C1
*rpal_wt_anaer_light_2_cleared_full.488.488.242.06350.580625974.38974.1031229.068.4%5K.NVVASGLADK.C2
*rpal_wt_anaer_light_2_pellet_2a.3527.3527.350.66030.381643717.663718.31177.045.3%1K.NVVASGLADKCTLQLAYAIGVARPLSIYIDTHGTGK.V3
*rpal_wt_anaer_light_2_cleared_full.3597.3597.367.63490.5245952146.252146.471213.059.3%11K.VSEDKLETIVAEVMDLTPR.G3
*rpal_wt_anaer_light_2_crude_full.3464.3464.2100.8360.7284242147.12146.471223.078.8%15K.VSEDKLETIVAEVMDLTPR.G2
*rpal_wt_anaer_light_2_crude_1.796.796.348.20360.3795531768.381768.071221.054.5%1R.GIRTHLDLNKPIYAR.T3
*rpal_wt_anaer_light_2_pellet_full.960.960.142.43170.5709031440.691441.671131.073.7%10R.THLDLNKPIYAR.T1
*rpal_wt_anaer_light_2_pellet_full.953.953.358.94040.5452851442.241441.671231.073.0%8R.THLDLNKPIYAR.T3
*rpal_wt_anaer_light_2_pellet_1a.1186.1186.260.73030.6520681442.391441.671252.072.7%8R.THLDLNKPIYAR.T2
*rpal_wt_anaer_light_2_cleared_2.1508.1508.350.43130.3816682303.312303.411220.040.6%1R.TSSYGHFGRTPDADGGFSWEK.T3
*rpal_wt_anaer_light_2_cleared_3.1464.1464.250.94130.6495792304.042303.411204.050.0%3R.TSSYGHFGRTPDADGGFSWEK.T2
*rpal_wt_anaer_light_2_cleared_3.1961.1961.349.69380.340573305.693305.571118.046.1%1R.TSSYGHFGRTPDADGGFSWEKTDLADAMKR.A3
*rpal_wt_anaer_light_2_pellet_4.1166.1166.140.58080.625661309.651310.361120.073.7%7R.TPDADGGFSWEK.T1
*rpal_wt_anaer_light_2_crude_1a.1083.1083.259.90250.7569631310.191310.361185.077.3%6R.TPDADGGFSWEK.T2
*rpal_wt_anaer_light_2_crude_2.1992.1992.350.57690.457312156.562156.331177.046.7%3R.TPDADGGFSWEKTDLADAMK.R3
*rpal_wt_anaer_light_2_cleared_3.2186.2186.253.68130.6879572157.382156.3316.054.3%4R.TPDADGGFSWEKTDLADAMK.R2
*rpal_wt_anaer_light_2_pellet_3.2048.2048.243.3120.6179972311.142312.5210.045.9%5R.TPDADGGFSWEKTDLADAMKR.A2
*rpal_wt_anaer_light_2_cleared_2.2040.2040.359.8830.5526232314.642312.521243.047.8%4R.TPDADGGFSWEKTDLADAMKR.A3
*rpal_wt_anaer_light_2_pellet_full.549.549.131.62460.535801864.45864.9951142.076.9%4K.TDLADAMK.R1
*rpal_wt_anaer_light_2_pellet_1a.659.659.239.4210.492999865.22864.9951229.073.3%2K.TDLADAMK.R2
*rpal_wt_anaer_light_2_pellet_1.603.603.246.63260.5258981021.381021.181115.076.5%6K.TDLADAMKR.A2
*rpal_wt_anaer_light_2_cleared_3.540.540.128.1720.3907181021.721021.181164.066.7%2K.TDLADAMKR.A1

URPA47493015285.4%314324175.4etfA electron transfer flavoprotein alpha-subunit, (ETFLS) 5360445:5361389 reverse MW:32417
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_crude_5.522.522.137.95420.5344051547.01546.771168.066.7%1M.ATLLIAEHDNAHLK.D1
*rpal_wt_anaer_light_2_pellet_2a.960.960.267.76230.6341282075.882076.321193.069.7%4M.ATLLIAEHDNAHLKDATNK.A2
*rpal_wt_anaer_light_2_pellet_1a.1176.1176.353.41390.425942076.542076.321224.058.2%4M.ATLLIAEHDNAHLKDATNK.A3
*rpal_wt_anaer_light_2_pellet_1a.249.249.129.84620.173979714.64716.8131176.076.9%3K.AVADAAAK.L1
*rpal_wt_anaer_light_2_crude_full.4811.4811.354.45680.4015313881.13880.43179.048.3%2K.VLLAEAPAYEHDLAEPLAALIVSLAGSYDAIVAPATSR.F3
*rpal_wt_anaer_light_2_crude_full.356.356.236.65250.370788891.88892.1121143.064.3%6R.FKNVMPR.V2
*rpal_wt_anaer_light_2_cleared_2.524.524.126.60850.198617892.5892.1121168.075.0%1R.FKNVMPR.V1
*rpal_wt_anaer_light_2_cleared_2a.3164.3164.140.2990.5491331628.931630.01171.065.2%4R.VAALLDVMQVSEIIK.V1
*rpal_wt_anaer_light_2_crude_1.3474.3474.348.05850.4453951630.451630.01193.055.3%2R.VAALLDVMQVSEIIK.V3
*rpal_wt_anaer_light_2_pellet_full.3103.3103.274.96150.6627841630.551630.01250.074.1%26R.VAALLDVMQVSEIIK.V2
*rpal_wt_anaer_light_2_cleared_3.1910.1910.248.34260.5293882290.232290.63114.054.1%8K.VVAPDTFERPIYAGNAIQTVK.S2
*rpal_wt_anaer_light_2_crude_full.1594.1594.360.34420.4703172291.772290.631160.054.8%5K.VVAPDTFERPIYAGNAIQTVK.S3
*2rpal_wt_anaer_light_2_cleared_1a.310.310.125.92420.268093715.63715.915148.080.0%1K.KVITVR.T1
*rpal_wt_anaer_light_2_pellet_2a.3215.3215.248.12880.5458623427.263428.691177.032.8%9R.TSTFQATGEGGSAAIETVAAAADPGLSSFVGEEVAK.S2
*rpal_wt_anaer_light_2_pellet_2a.3214.3214.375.55960.5147163428.613428.691213.053.7%4R.TSTFQATGEGGSAAIETVAAAADPGLSSFVGEEVAK.S3
*rpal_wt_anaer_light_2_cleared_full.2963.2963.348.16780.4331254500.464499.851134.040.0%1R.TSTFQATGEGGSAAIETVAAAADPGLSSFVGEEVAKSDRPELSSAK.I3
*rpal_wt_anaer_light_2_cleared_3.2607.2607.239.91230.4517582336.92337.641161.041.0%2R.ENFTKYIEPLADKLGAGVGASR.A2
*rpal_wt_anaer_light_2_cleared_1a.2578.2578.353.66390.4975042337.652337.641244.047.7%1R.ENFTKYIEPLADKLGAGVGASR.A3
*rpal_wt_anaer_light_2_cleared_1a.581.581.134.53430.362231948.44949.0921152.083.3%2K.YIEPLADK.L1
*rpal_wt_anaer_light_2_pellet_full.1458.1458.267.08150.6326861717.761717.96186.068.8%9K.YIEPLADKLGAGVGASR.A2
*rpal_wt_anaer_light_2_pellet_2a.1529.1529.133.6330.4150061717.881717.961208.059.3%4K.YIEPLADKLGAGVGASR.A1
*rpal_wt_anaer_light_2_cleared_full.1389.1389.383.32790.5818531718.11717.961172.075.5%9K.YIEPLADKLGAGVGASR.A3
*rpal_wt_anaer_light_2_cleared_1a.1538.1538.269.76340.6860261948.411949.091172.063.6%8R.AAVDAGYAPNDWQVGQTGK.V2
*rpal_wt_anaer_light_2_cleared_2a.1408.1408.150.59350.5318651948.931949.091176.066.7%5R.AAVDAGYAPNDWQVGQTGK.V1
*rpal_wt_anaer_light_2_cleared_1.1655.1655.354.56210.4485621949.531949.091190.049.1%1R.AAVDAGYAPNDWQVGQTGK.V3
*rpal_wt_anaer_light_2_crude_2a.3890.3890.241.5020.5009712669.652669.16127.037.8%8K.VVAPELYIAVGISGAIQHLAGMKDSK.V2
*rpal_wt_anaer_light_2_crude_2a.4634.4634.360.53730.5159744147.694148.71150.052.4%14K.VIVAINKDEDAPIFQVADYGLVADLYQAVPELTEELGK.L3
*rpal_wt_anaer_light_2_cleared_full.4622.4622.355.39780.4576284446.234447.081165.051.8%3K.VIVAINKDEDAPIFQVADYGLVADLYQAVPELTEELGKLGK.-3
*rpal_wt_anaer_light_2_cleared_5.2459.2459.246.26290.6227023411.233410.761178.031.4%2K.DEDAPIFQVADYGLVADLYQAVPELTEELGK.L2
*rpal_wt_anaer_light_2_cleared_full.4792.4792.355.42190.4209533709.243709.141189.045.8%3K.DEDAPIFQVADYGLVADLYQAVPELTEELGKLGK.-3

URPA26042510185.2%155169265.9RPA2604 peptidyl prolyl cis-trans isomerase 2961628:2962095 forward MW:16926
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_cleared_2a.1864.1864.140.8620.6463951844.841846.05186.061.5%5M.ADNDNILILETTQGTVK.I1
*rpal_wt_anaer_light_2_cleared_full.1849.1849.258.26570.6828431845.581846.051233.056.7%7M.ADNDNILILETTQGTVK.I2
*rpal_wt_anaer_light_2_cleared_2a.901.901.129.29990.4424721619.021619.89120.061.9%3K.IEMRPDLAPNHVAR.I1
*rpal_wt_anaer_light_2_crude_full.500.500.242.59150.5226491619.641619.891104.053.8%6K.IEMRPDLAPNHVAR.I2
*rpal_wt_anaer_light_2_crude_1a.546.546.365.82990.4147481621.021619.891249.065.1%8K.IEMRPDLAPNHVAR.I3
*rpal_wt_anaer_light_2_cleared_full.1484.1484.128.16750.4163341339.61340.481180.064.7%1R.EGFYDGIVFHR.V1
*rpal_wt_anaer_light_2_cleared_full.1483.1483.241.67560.4454671340.161340.481116.063.2%5R.EGFYDGIVFHR.V2
*rpal_wt_anaer_light_2_cleared_3.1672.1672.274.63450.6583672114.92114.431249.064.1%7R.VIEGFMAQTGCPQGTGMGGSGK.K2
*rpal_wt_anaer_light_2_crude_full.1172.1172.252.27920.5655212242.22242.61232.050.0%7R.VIEGFMAQTGCPQGTGMGGSGKK.L2
*rpal_wt_anaer_light_2_cleared_1a.1449.1449.358.41680.409362242.242242.61187.046.6%2R.VIEGFMAQTGCPQGTGMGGSGKK.L3
*rpal_wt_anaer_light_2_cleared_2a.597.597.130.0090.4309311410.921411.6188.055.6%3K.LKAEFNAEPHVR.G1
*rpal_wt_anaer_light_2_cleared_2.777.777.237.51970.5318621412.111411.61244.050.0%2K.LKAEFNAEPHVR.G2
*rpal_wt_anaer_light_2_cleared_1.833.833.346.91140.4090631412.851411.61206.055.6%1K.LKAEFNAEPHVR.G3
*rpal_wt_anaer_light_2_cleared_1.557.557.238.56830.6036331167.981170.271132.061.1%1K.AEFNAEPHVR.G2
*rpal_wt_anaer_light_2_cleared_2a.2416.2416.252.34140.5832192076.512077.191100.051.5%6R.AANPDSGDSQFFICFDDAR.F2
*rpal_wt_anaer_light_2_crude_4.1114.1114.144.21450.6411581384.791385.611216.081.2%7R.FLDKQYTVWGK.V1
*rpal_wt_anaer_light_2_crude_1.1241.1241.261.97890.6339511384.91385.611234.080.0%9R.FLDKQYTVWGK.V2
*rpal_wt_anaer_light_2_cleared_1.1514.1514.365.93770.5487621386.361385.611174.064.9%3R.FLDKQYTVWGK.V3
*rpal_wt_anaer_light_2_cleared_3.683.683.131.86480.3989891133.561134.31108.062.5%2K.VIEGMENVDK.I1
*rpal_wt_anaer_light_2_cleared_4.1066.1066.141.98020.4782951374.741375.631150.077.8%4K.VIEGMENVDKIK.R1
*rpal_wt_anaer_light_2_crude_1.686.686.257.63760.5913411374.991375.631110.072.7%6K.VIEGMENVDKIK.R2
*rpal_wt_anaer_light_2_cleared_1a.1126.1126.350.60050.5237641377.121375.631156.052.6%1K.VIEGMENVDKIK.R3
*rpal_wt_anaer_light_2_crude_4.370.370.136.53750.5383511482.031481.741168.070.0%2K.RGEPVKDPDKIVK.A1
*rpal_wt_anaer_light_2_cleared_4.450.450.139.9240.4305761325.911325.551240.070.6%2R.GEPVKDPDKIVK.A1
*rpal_wt_anaer_light_2_crude_full.315.315.242.56330.5512261327.981325.55192.061.9%1R.GEPVKDPDKIVK.A2

URPA3246134084.8%921022010.4rpsS 30S ribosomal protein S19 3656696:3656974 reverse MW:10219
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_membrane_1a.1937.1937.346.16960.430531946.011945.36184.041.8%1M.VRSVWKGPFVEASLLKK.A3
*rpal_wt_anaer_light_2_crude_2.2079.2079.231.87750.4520991561.711561.861160.047.8%1R.SVWKGPFVEASLLK.K2
*rpal_wt_anaer_light_2_membrane_5.1365.1365.129.49670.2085011564.121561.861169.055.0%2R.SVWKGPFVEASLLK.K1
*rpal_wt_anaer_light_2_membrane_2a.261.261.127.95220.295812983.74983.116174.069.2%1R.ASGRHDVIK.I1
*rpal_wt_anaer_light_2_pellet_1a.3109.3109.345.04810.4045142227.22226.581108.046.8%1R.RSTILPQFVGLTFGVYNGQK.H3
*rpal_wt_anaer_light_2_membrane_2a.2813.2813.251.97890.6104272227.322226.58149.052.9%5R.RSTILPQFVGLTFGVYNGQK.H2
*rpal_wt_anaer_light_2_membrane_2a.3147.3147.236.33070.3928392071.422070.4180.041.2%6R.STILPQFVGLTFGVYNGQK.H2
*rpal_wt_anaer_light_2_cleared_1.897.897.357.26390.4608941562.71562.791192.057.8%4K.HVPVSVNEEMVGHK.F3
*rpal_wt_anaer_light_2_cleared_5.738.738.138.55960.5655581563.341562.791198.060.0%3K.HVPVSVNEEMVGHK.F1
*rpal_wt_anaer_light_2_crude_4.1376.1376.261.35740.6390952484.02484.8151.059.0%6K.HVPVSVNEEMVGHKFGEFSPTR.T2
*rpal_wt_anaer_light_2_pellet_full.770.770.125.31740.499174940.3941.0311160.075.0%1K.FGEFSPTR.T1
*rpal_wt_anaer_light_2_pellet_full.769.769.243.73970.691367941.61941.0311249.073.3%8K.FGEFSPTR.T2
*rpal_wt_anaer_light_2_pellet_3.338.338.128.16520.3579741097.531098.211208.056.2%1R.TFHGHAGDKK.S1

URPA42683112984.5%161173965.6RPA4268 peroxiredoxin-like protein 4816864:4817349 forward MW:17396
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_cleared_2.1309.1309.232.40850.4595091616.951616.861192.044.0%1M.TIKVGDRLPDAQFR.V2
*rpal_wt_anaer_light_2_crude_2a.531.531.129.69110.4033231273.91274.421163.058.8%2K.VGDRLPDAQFR.V1
*rpal_wt_anaer_light_2_crude_1.572.572.239.19540.4603011274.61274.421199.057.9%8K.VGDRLPDAQFR.V2
*rpal_wt_anaer_light_2_crude_1.576.576.358.28590.5645771275.181274.421197.061.1%5K.VGDRLPDAQFR.V3
*rpal_wt_anaer_light_2_crude_2a.351.351.132.83150.354721105.641106.291182.062.5%6R.VMTEDGVQVK.T1
*rpal_wt_anaer_light_2_cleared_1.597.597.243.28560.528121105.721106.29176.072.2%3R.VMTEDGVQVK.T2
*rpal_wt_anaer_light_2_cleared_2.625.625.125.21060.330317839.59839.92115.072.7%2K.TTDDIFK.G1
*rpal_wt_anaer_light_2_cleared_2a.389.389.137.96140.4494751024.871025.151211.078.6%2K.TTDDIFKGK.K1
*rpal_wt_anaer_light_2_cleared_2a.339.339.141.44760.5334471152.911153.321203.080.0%2K.TTDDIFKGKK.V1
*rpal_wt_anaer_light_2_cleared_1.441.441.240.77450.5375571153.381153.32179.061.1%1K.TTDDIFKGKK.V2
*rpal_wt_anaer_light_2_crude_5.805.805.149.610.6624311762.971764.11164.076.9%2K.KVALFAVPGAYTGTCHK.M1
*rpal_wt_anaer_light_2_pellet_2.1606.1606.235.43080.5215941764.21764.11144.045.2%3K.KVALFAVPGAYTGTCHK.M2
*rpal_wt_anaer_light_2_cleared_2a.1590.1590.132.55950.278531634.981635.931144.058.3%3K.VALFAVPGAYTGTCHK.M1
*rpal_wt_anaer_light_2_crude_1a.1663.1663.243.52850.3498311636.251635.931176.051.9%4K.VALFAVPGAYTGTCHK.M2
*rpal_wt_anaer_light_2_crude_1a.1661.1661.351.24050.435551637.161635.931230.044.9%4K.VALFAVPGAYTGTCHK.M3
*rpal_wt_anaer_light_2_crude_1a.2617.2617.244.21730.4606121635.991637.021172.057.7%7K.MHLPSIFLNAYAMK.D2
*rpal_wt_anaer_light_2_cleared_5.1490.1490.149.09690.652411636.951637.021233.072.7%7K.MHLPSIFLNAYAMK.D1
*rpal_wt_anaer_light_2_crude_1.2658.2658.349.69190.4153131637.111637.021244.052.5%1K.MHLPSIFLNAYAMK.D3
*rpal_wt_anaer_light_2_cleared_5.1348.1348.144.20330.6152731879.061880.28112.072.7%2K.MHLPSIFLNAYAMKDK.G1
*rpal_wt_anaer_light_2_crude_1a.2263.2263.358.26320.4230341880.181880.281242.062.2%2K.MHLPSIFLNAYAMKDK.G3
*rpal_wt_anaer_light_2_crude_3.2100.2100.246.26360.5838851881.731880.281152.060.7%3K.MHLPSIFLNAYAMKDK.G2
*rpal_wt_anaer_light_2_cleared_2a.1565.1565.258.18520.6429452227.672228.34197.051.4%2R.DTDQRNEAIFLGDGNADFTK.A2
*rpal_wt_anaer_light_2_cleared_2.1883.1883.283.23620.7384821612.481612.741207.078.6%3R.NEAIFLGDGNADFTK.A2
*rpal_wt_anaer_light_2_cleared_2a.1675.1675.140.47440.5159561612.821612.74177.060.9%5R.NEAIFLGDGNADFTK.A1
*rpal_wt_anaer_light_2_crude_full.1727.1727.280.88540.7537911599.461599.831247.082.8%9K.AIGMEMDGSGFGLGTR.S2
*rpal_wt_anaer_light_2_cleared_2a.1881.1881.129.6380.3996491599.841599.831152.054.2%4K.AIGMEMDGSGFGLGTR.S1
*rpal_wt_anaer_light_2_crude_1.1104.1104.257.5960.6932671225.831226.441182.085.0%6R.YSMVVEDGVVK.T2
*rpal_wt_anaer_light_2_crude_4.989.989.142.93090.5892331228.841226.441236.072.2%12R.YSMVVEDGVVK.T1
*rpal_wt_anaer_light_2_cleared_1a.698.698.235.67590.4970221081.911083.231235.055.6%3K.TLNLEPNPGK.V2
*rpal_wt_anaer_light_2_cleared_full.2655.2655.253.09930.6855462352.082352.651114.047.5%12K.TLNLEPNPGKVEVSGGDTLLGQL.-2
*rpal_wt_anaer_light_2_cleared_2.2997.2997.352.66320.4487442355.372352.651178.047.8%3K.TLNLEPNPGKVEVSGGDTLLGQL.-3

URPA30561910284.3%140152196.8RPA3056 nucleoside-diphosphate-kinase 3458619:3459041 reverse MW:15219
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_crude_2a.931.931.141.53490.53771377.761378.57152.073.7%9R.TFSILKPDATER.N1
*rpal_wt_anaer_light_2_pellet_1a.1456.1456.351.53810.4553891378.061378.571195.060.5%3R.TFSILKPDATER.N3
*rpal_wt_anaer_light_2_cleared_full.1068.1068.243.91470.5683811378.511378.571224.059.1%19R.TFSILKPDATER.N2
*rpal_wt_anaer_light_2_crude_full.2079.2079.140.16150.5330351256.681257.47114.073.7%14R.NITGAINALIEK.A1
*rpal_wt_anaer_light_2_pellet_1a.2619.2619.272.93390.7169331257.21257.471182.086.4%10R.NITGAINALIEK.A2
*rpal_wt_anaer_light_2_cleared_2.1005.1005.236.69420.5959251697.391697.91172.044.0%1R.MTRDQAETFYAVHK.E2
*rpal_wt_anaer_light_2_cleared_1a.956.956.353.60030.4389861697.471697.91175.053.5%2R.MTRDQAETFYAVHK.E3
*rpal_wt_anaer_light_2_crude_4.458.458.137.22480.418641308.781309.421110.076.5%8R.DQAETFYAVHK.E1
*rpal_wt_anaer_light_2_crude_1.460.460.264.59930.5331481308.881309.421244.085.0%7R.DQAETFYAVHK.E2
*rpal_wt_anaer_light_2_pellet_5.2388.2388.243.53810.5483133235.393235.771138.036.5%1K.ERPFFGELVDFMISGPVVVQVLEGEGAIAK.Y2
*rpal_wt_anaer_light_2_pellet_2a.4674.4674.356.09720.451993235.423235.77143.043.6%5K.ERPFFGELVDFMISGPVVVQVLEGEGAIAK.Y3
*rpal_wt_anaer_light_2_crude_4.388.388.127.47480.452761339.771340.51145.057.9%3K.YRDVMGATDPSK.A1
*rpal_wt_anaer_light_2_cleared_full.427.427.255.58070.6441861340.421340.51161.077.3%4K.YRDVMGATDPSK.A2
*rpal_wt_anaer_light_2_cleared_3.1101.1101.232.39920.4724412025.12025.251168.036.1%2K.YRDVMGATDPSKAADGTIR.K2
*rpal_wt_anaer_light_2_cleared_1a.1111.1111.357.00850.4002322025.582025.251150.052.5%1K.YRDVMGATDPSKAADGTIR.K3
*rpal_wt_anaer_light_2_crude_2a.278.278.131.33340.4615551018.611021.141137.068.8%1R.DVMGATDPSK.A1
*rpal_wt_anaer_light_2_cleared_2a.351.351.154.68320.6584911672.811673.73192.065.4%7K.SIGENSVHGSDAAETAK.I1
*rpal_wt_anaer_light_2_cleared_full.377.377.268.34140.7277831673.321673.731203.070.0%4K.SIGENSVHGSDAAETAK.I2
*rpal_wt_anaer_light_2_cleared_5.1814.1814.127.0250.3794631526.921524.711192.052.4%1K.IEIAQFFSGNEIVG.-1

URPA40504418984.2%265299856.4RPA4050 unknown protein 4582156:4582953 forward MW:29985
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_pellet_4.961.961.128.16720.2241511288.951289.581146.062.5%1R.EREMLEILKK.L1
*rpal_wt_anaer_light_2_pellet_2.1629.1629.132.61440.155548875.52876.1051145.075.0%2R.EMLEILK.K1
*rpal_wt_anaer_light_2_pellet_1.1751.1751.237.70310.113489876.26876.1051149.071.4%3R.EMLEILK.K2
*rpal_wt_anaer_light_2_cleared_3.1095.1095.133.53940.2890571003.661004.281176.091.7%7R.EMLEILKK.L1
*rpal_wt_anaer_light_2_pellet_4.477.477.128.2460.3452031377.921378.621144.058.8%2K.KLRQEYGAVSVK.A1
*rpal_wt_anaer_light_2_pellet_2a.464.464.136.52030.4173241249.761250.44120.076.5%3K.LRQEYGAVSVK.A1
*rpal_wt_anaer_light_2_pellet_1a.537.537.250.56120.5651551250.491250.441246.070.0%4K.LRQEYGAVSVK.A2
*rpal_wt_anaer_light_2_pellet_3.490.490.125.44560.34716980.54981.094140.064.3%1R.QEYGAVSVK.A1
*rpal_wt_anaer_light_2_pellet_2a.1347.1347.127.6560.3071851736.961737.861134.052.2%1K.AEFEAEGTRTDELLR.L1
*rpal_wt_anaer_light_2_cleared_full.1232.1232.241.44640.50221737.711737.861192.055.6%6K.AEFEAEGTRTDELLR.L2
*rpal_wt_anaer_light_2_pellet_1.1563.1563.351.07360.5035541737.791737.861231.051.1%2K.AEFEAEGTRTDELLR.L3
*rpal_wt_anaer_light_2_pellet_full.691.691.125.89850.104566700.57700.8571140.080.0%1R.LIDLAR.R1
*rpal_wt_anaer_light_2_pellet_4.1745.1745.134.55950.1258031489.851490.72144.057.1%6K.IGGCEAVRDLIESK.Q1
*rpal_wt_anaer_light_2_cleared_1a.1819.1819.246.86750.3342471491.551490.721181.060.0%6K.IGGCEAVRDLIESK.Q2
*rpal_wt_anaer_light_2_pellet_1.2054.2054.360.21360.4250971491.581490.721201.057.8%2K.IGGCEAVRDLIESK.Q3
*rpal_wt_anaer_light_2_pellet_2.438.438.137.15610.41949704.76704.7991175.090.0%4R.DLIESK.Q1
*rpal_wt_anaer_light_2_crude_full.2599.2599.249.79740.5821072172.172172.551204.052.9%6K.QFGTEYIIAPMVETPYALK.K2
*rpal_wt_anaer_light_2_crude_2a.2412.2412.241.02840.4135572300.32300.721168.047.2%8K.QFGTEYIIAPMVETPYALKK.F2
*rpal_wt_anaer_light_2_pellet_2.2747.2747.365.4330.522932300.672300.721122.058.7%5K.QFGTEYIIAPMVETPYALKK.F3
*rpal_wt_anaer_light_2_pellet_1.413.413.128.22820.1034607.42607.7281248.087.5%2K.FIEAK.N1
*rpal_wt_anaer_light_2_pellet_2a.4171.4171.237.09380.4872512692.292693.01160.040.0%1K.EDTSFLFNLETITAFNNIDDMIK.V2
*rpal_wt_anaer_light_2_crude_1a.1433.1433.272.57610.6228221496.931497.71202.077.8%9K.VGIGHDGVQGVVFGR.V2
*rpal_wt_anaer_light_2_pellet_5.936.936.156.86540.6819591497.081497.71150.078.3%11K.VGIGHDGVQGVVFGR.V1
*rpal_wt_anaer_light_2_crude_1.1394.1394.370.54740.4674471497.521497.71246.071.1%6K.VGIGHDGVQGVVFGR.V3
*rpal_wt_anaer_light_2_pellet_1.433.433.241.22150.5398641190.351189.23150.057.1%2R.VDFAGSHGQDR.S2
*rpal_wt_anaer_light_2_pellet_4.378.378.129.49810.3608061190.61189.231202.064.7%1R.VDFAGSHGQDR.S1
*rpal_wt_anaer_light_2_pellet_2a.1731.1731.140.92960.5249161509.781510.681176.061.9%10R.SVIDSADVTNYVVK.T1
*rpal_wt_anaer_light_2_crude_full.1514.1514.283.01030.7042571510.491510.681219.088.0%9R.SVIDSADVTNYVVK.T2
*rpal_wt_anaer_light_2_pellet_1a.2881.2881.364.2080.480782496.452496.931122.056.3%2K.CKANNLELVVGGAVGIDSLPELKR.I3
*rpal_wt_anaer_light_2_pellet_4.2627.2627.235.76220.4423272497.772496.931115.031.0%1K.CKANNLELVVGGAVGIDSLPELKR.I2
*rpal_wt_anaer_light_2_pellet_full.434.434.129.6850.352784896.59897.0661116.069.2%5R.IASVHLTR.F1
*rpal_wt_anaer_light_2_pellet_full.439.439.245.44690.389463897.11897.066198.086.7%4R.IASVHLTR.F2
*rpal_wt_anaer_light_2_cleared_2a.1130.1130.146.70750.4871941387.831388.611164.080.0%8R.KVIFGADALSNPR.M1
*rpal_wt_anaer_light_2_pellet_1a.1465.1465.285.5340.6550451388.791388.611229.087.5%15R.KVIFGADALSNPR.M2
*rpal_wt_anaer_light_2_pellet_1a.1471.1471.357.25360.3997151389.281388.611181.056.8%6R.KVIFGADALSNPR.M3
*rpal_wt_anaer_light_2_pellet_4.1440.1440.126.4530.2558051259.91260.441193.055.0%2K.VIFGADALSNPR.M1
*rpal_wt_anaer_light_2_pellet_1a.1737.1737.260.8160.5845781259.931260.44153.081.8%5K.VIFGADALSNPR.M2
*rpal_wt_anaer_light_2_pellet_1a.3092.3092.245.85930.5225941440.891441.671190.065.0%2R.NTVYFELQWLK.N2
*rpal_wt_anaer_light_2_pellet_4.2898.2898.132.6770.5221471440.931441.67132.070.6%3R.NTVYFELQWLK.N1
*rpal_wt_anaer_light_2_pellet_3.713.713.241.65480.476081885.771885.9910.050.0%2K.NKRDYYGEIQGEDAAR.I2
*rpal_wt_anaer_light_2_pellet_2a.1116.1116.135.38080.6022331486.721487.521133.061.9%2R.DYYGEIQGEDAAR.I1
*rpal_wt_anaer_light_2_pellet_1a.1351.1351.269.37630.7203271487.311487.521173.079.2%6R.DYYGEIQGEDAAR.I2
*rpal_wt_anaer_light_2_cleared_3.474.474.134.43130.219312904.82905.1061197.090.9%2R.IEMLDKR.W1
*rpal_wt_anaer_light_2_cleared_1.505.505.240.73850.288548905.55905.1061242.076.9%3R.IEMLDKR.W2

URPA16932111583.8%198225156.8sodB superoxide dismutase 1889961:1890557 forward MW:22515
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_crude_full.3144.3144.261.7010.6714982348.792349.711153.063.9%16M.TFTLPELPYAYDALQPYMSK.E2
*rpal_wt_anaer_light_2_crude_1a.3527.3527.373.38870.578982352.152349.711253.056.9%5M.TFTLPELPYAYDALQPYMSK.E3
*rpal_wt_anaer_light_2_cleared_3.1035.1035.346.43660.3979812760.312763.012.057.4%1K.ETLEYHHDKHHQAYVTNGNNLLK.G3
*rpal_wt_anaer_light_2_pellet_4.902.902.246.61020.5875712762.452763.015.045.0%2K.ETLEYHHDKHHQAYVTNGNNLLK.G2
*rpal_wt_anaer_light_2_cleared_3.1350.1350.348.63360.369823511.473511.7912.045.5%2K.ETLEYHHDKHHQAYVTNGNNLLKGTEFEGK.S3
*rpal_wt_anaer_light_2_crude_1a.391.391.129.50370.346987803.5803.9311101.081.8%7K.SLEEVVK.G1
*rpal_wt_anaer_light_2_cleared_1.604.604.236.96460.421244804.56803.9311149.076.9%2K.SLEEVVK.G2
*rpal_wt_anaer_light_2_crude_2a.1183.1183.147.56210.5813121336.791337.52170.073.7%4K.SLEEVVKGSFNK.N1
*rpal_wt_anaer_light_2_cleared_1a.1399.1399.253.4370.620331338.811337.521236.072.7%4K.SLEEVVKGSFNK.N2
*rpal_wt_anaer_light_2_crude_full.1847.1847.250.99370.6663822307.032307.5810.052.9%9K.NAPLFNNAAQHFNHIHFWK.W2
*rpal_wt_anaer_light_2_crude_2.655.655.242.17190.5977871771.171771.091210.046.9%5K.WMKPNGGGSKLPGALEK.K2
*rpal_wt_anaer_light_2_cleared_full.1019.1019.351.2670.4074431771.841771.091228.058.2%1K.WMKPNGGGSKLPGALEK.K3
*rpal_wt_anaer_light_2_cleared_5.849.849.136.12450.4528841773.131771.09173.052.0%7K.WMKPNGGGSKLPGALEK.K1
*rpal_wt_anaer_light_2_cleared_3.1013.1013.238.51230.4350971898.971899.271192.045.5%1K.WMKPNGGGSKLPGALEKK.I2
*rpal_wt_anaer_light_2_pellet_2a.974.974.149.28710.6084311249.681250.391233.082.4%11K.KINEDLGGFEK.F1
*rpal_wt_anaer_light_2_cleared_1.1082.1082.255.70960.6227061250.391250.391230.080.0%7K.KINEDLGGFEK.F2
*rpal_wt_anaer_light_2_cleared_full.884.884.353.2910.4924551250.711250.391225.055.6%2K.KINEDLGGFEK.F3
*rpal_wt_anaer_light_2_cleared_3.1155.1155.141.12960.5603411121.681122.221142.081.2%9K.INEDLGGFEK.F1
*rpal_wt_anaer_light_2_cleared_1.1267.1267.255.11430.5226771121.741122.221220.083.3%7K.INEDLGGFEK.F2
*rpal_wt_anaer_light_2_cleared_4.2674.2674.359.70430.4859064284.614284.78133.051.8%2K.NGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYR.N3
*rpal_wt_anaer_light_2_cleared_full.3693.3693.274.43310.7310472277.062277.541182.068.8%11K.AFVDSLINWEYVEELYSKA.-2

URPA20477639883.5%334364739.0dctP1 TrapT family, dctP subunit, C4-dicarboxylate periplasmic binding protein 2305049:2306053 forward MW:36473
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_crude_full.354.354.145.18010.5302691196.571197.381238.076.5%17K.FSHVVAPNTPK.G1
*rpal_wt_anaer_light_2_cleared_1.576.576.245.31740.4943181196.851197.381187.060.0%6K.FSHVVAPNTPK.G2
*rpal_wt_anaer_light_2_cleared_full.479.479.357.72210.5025421199.061197.381184.070.6%1K.FSHVVAPNTPK.G3
*rpal_wt_anaer_light_2_cleared_2a.1362.1362.237.03370.4719492616.882617.041107.039.0%2K.FSHVVAPNTPKGMAADKFKELAEK.Y2
*rpal_wt_anaer_light_2_crude_1a.711.711.259.29120.5522791437.871438.691172.073.9%8K.GMAADKFKELAEK.Y2
*rpal_wt_anaer_light_2_crude_1.665.665.345.9790.4465931438.791438.691202.059.0%1K.GMAADKFKELAEK.Y3
*rpal_wt_anaer_light_2_crude_4.672.672.150.270.3927251440.81438.691180.084.2%7K.GMAADKFKELAEK.Y1
*rpal_wt_anaer_light_2_cleared_3.1697.1697.263.19190.6701442002.482003.2816.064.5%3K.GMAADKFKELAEKYTDGK.V2
*rpal_wt_anaer_light_2_cleared_full.1535.1535.359.07550.4479062003.332003.281165.055.6%1K.GMAADKFKELAEKYTDGK.V3
*rpal_wt_anaer_light_2_cleared_3.1768.1768.240.35940.5466932230.262230.5910.042.9%1K.GMAADKFKELAEKYTDGKVK.V2
*rpal_wt_anaer_light_2_crude_2.371.371.125.02890.175901867.52865.01710.080.0%1K.FKELAEK.Y1
*rpal_wt_anaer_light_2_cleared_5.1047.1047.134.5640.4911791551.31551.831104.063.2%1K.VKVEVYPNSQLFK.D1
*rpal_wt_anaer_light_2_crude_2.1411.1411.232.6120.5596991551.871551.831230.041.7%1K.VKVEVYPNSQLFK.D2
*rpal_wt_anaer_light_2_crude_1a.1897.1897.349.53440.4315432592.992593.981124.047.7%3K.VKVEVYPNSQLFKDKEELDALK.L3
*rpal_wt_anaer_light_2_crude_4.1700.1700.243.64830.5178692594.712593.981128.044.7%5K.VKVEVYPNSQLFKDKEELDALK.L2
*rpal_wt_anaer_light_2_crude_4.2793.2793.374.93250.5816193891.043890.581123.063.4%6K.VKVEVYPNSQLFKDKEELDALKLGAVQMLAPSISK.F3
*rpal_wt_anaer_light_2_cleared_1.1736.1736.237.02890.4058241323.791324.521214.055.0%1K.VEVYPNSQLFK.D2
*rpal_wt_anaer_light_2_crude_1a.1931.1931.351.77510.372366.082366.671176.051.7%3K.VEVYPNSQLFKDKEELDALK.L3
*rpal_wt_anaer_light_2_crude_3.1785.1785.243.92430.5600662366.172366.6718.052.9%4K.VEVYPNSQLFKDKEELDALK.L2
*rpal_wt_anaer_light_2_cleared_full.2868.2868.359.97150.3783533661.913663.271122.047.6%8K.VEVYPNSQLFKDKEELDALKLGAVQMLAPSISK.F3
*rpal_wt_anaer_light_2_cleared_2.2699.2699.363.58650.5027812355.592357.77138.055.7%1K.DKEELDALKLGAVQMLAPSISK.F3
*rpal_wt_anaer_light_2_crude_2a.2417.2417.279.56370.7171882357.252357.771195.062.5%4K.DKEELDALKLGAVQMLAPSISK.F2
*rpal_wt_anaer_light_2_cleared_2a.1580.1580.141.11510.4220181314.831315.621206.073.7%10K.LGAVQMLAPSISK.F1
*rpal_wt_anaer_light_2_cleared_full.1572.1572.268.39640.5290251315.491315.621254.082.6%10K.LGAVQMLAPSISK.F2
*rpal_wt_anaer_light_2_cleared_full.4047.4047.286.83940.7659742778.072779.251240.061.0%17K.FGPAGVKEFEVFDLPYILPDIAALR.K2
*rpal_wt_anaer_light_2_pellet_1a.4443.4443.366.67460.4642712779.12779.251252.058.8%16K.FGPAGVKEFEVFDLPYILPDIAALR.K3
*rpal_wt_anaer_light_2_cleared_full.3637.3637.276.26990.7238192906.442907.431210.052.3%14K.FGPAGVKEFEVFDLPYILPDIAALRK.V2
*rpal_wt_anaer_light_2_crude_1a.3916.3916.390.85540.6132322908.542907.431205.067.6%14K.FGPAGVKEFEVFDLPYILPDIAALRK.V3
*rpal_wt_anaer_light_2_crude_1a.4456.4456.378.98930.6020442122.232122.471219.058.3%4K.EFEVFDLPYILPDIAALR.K3
*rpal_wt_anaer_light_2_cleared_2a.4249.4249.260.32840.6966172122.612122.471238.062.5%9K.EFEVFDLPYILPDIAALR.K2
*rpal_wt_anaer_light_2_crude_full.3601.3601.352.18220.3025942249.892250.64160.046.0%6K.EFEVFDLPYILPDIAALRK.V3
*rpal_wt_anaer_light_2_cleared_2a.3804.3804.257.51310.6424432250.512250.641162.055.9%6K.EFEVFDLPYILPDIAALRK.V2
*rpal_wt_anaer_light_2_cleared_3.334.334.132.37690.33661970.65971.1461106.060.0%3R.KVTNGPVGAK.L1
*rpal_wt_anaer_light_2_cleared_1.364.364.127.95770.337453575.44575.6831240.087.5%2K.LLDSK.G1
*rpal_wt_anaer_light_2_cleared_4.2227.2227.146.76130.6897111459.771460.65160.078.9%10K.GMTGLAYWDNGFK.I1
*rpal_wt_anaer_light_2_crude_full.1902.1902.263.27830.6665681460.121460.651226.078.3%10K.GMTGLAYWDNGFK.I2
*rpal_wt_anaer_light_2_cleared_3.2360.2360.246.14710.5008382232.732233.621176.054.5%2K.GMTGLAYWDNGFKIMSANKK.L2
*rpal_wt_anaer_light_2_cleared_2a.484.484.141.00060.5091971076.841077.271249.078.6%2K.KLIAPEDYK.G1
*rpal_wt_anaer_light_2_cleared_1.642.642.240.11790.4178511077.61077.27199.068.8%1K.KLIAPEDYK.G2
*rpal_wt_anaer_light_2_cleared_3.742.742.131.85570.397075948.61949.0921200.084.6%8K.LIAPEDYK.G1
*rpal_wt_anaer_light_2_cleared_1a.645.645.235.15830.436921950.47949.0921212.066.7%4K.LIAPEDYK.G2
*rpal_wt_anaer_light_2_crude_2.624.624.242.35010.6125771395.551392.61106.054.5%1R.IQSSKVLDAQFR.A2
*rpal_wt_anaer_light_2_crude_1a.444.444.134.79230.435766848.52848.9781128.090.9%2K.VLDAQFR.A1
*rpal_wt_anaer_light_2_crude_1.495.495.244.01190.408787848.95848.9781200.084.6%9K.VLDAQFR.A2
*rpal_wt_anaer_light_2_pellet_2a.3969.3969.369.28860.5572493970.333970.451162.051.1%18R.ALGAIPQVLAFSEVYQALQTGVVDGQENTPSNMYTQK.M3
*rpal_wt_anaer_light_2_cleared_2.347.347.134.39810.430565771.51771.9151237.090.0%2K.MHEVQK.Y1
*rpal_wt_anaer_light_2_crude_full.1669.1669.251.57480.5504681303.991304.451133.075.0%8K.QFWDGIPADVR.A2
*rpal_wt_anaer_light_2_cleared_full.272.272.126.61520.139067574.42574.6551116.087.5%2R.AQLDK.A1
*rpal_wt_anaer_light_2_cleared_3.1870.1870.348.23070.312563485.093485.88117.041.6%1R.AQLDKAMKEATEFGNSQSQKENAEALEEMKK.S3
*rpal_wt_anaer_light_2_cleared_4.1353.1353.247.41850.6036952802.342802.071110.035.6%2K.AMKEATEFGNSQSQKENAEALEEMK.K2
*rpal_wt_anaer_light_2_cleared_1a.1288.1288.371.09870.5604152929.52930.241241.055.4%6K.AMKEATEFGNSQSQKENAEALEEMKK.S3
*rpal_wt_anaer_light_2_cleared_2a.1170.1170.245.70610.4518962930.592930.2414.037.0%6K.AMKEATEFGNSQSQKENAEALEEMKK.S2
*rpal_wt_anaer_light_2_cleared_1a.1230.1230.349.97170.4224692599.512599.791214.044.1%3K.EATEFGNSQSQKENAEALEEMKK.S3
*rpal_wt_anaer_light_2_crude_full.942.942.246.95890.5605262600.862599.79156.046.3%5K.EATEFGNSQSQKENAEALEEMKK.S2
*rpal_wt_anaer_light_2_cleared_3.1564.1564.240.77240.4345592131.822131.51120.043.8%1K.KSGKTEIITLTPEQNLAMR.K2
*rpal_wt_anaer_light_2_crude_full.1466.1466.373.6690.5977852003.032003.331230.067.3%6K.SGKTEIITLTPEQNLAMR.K3
*rpal_wt_anaer_light_2_crude_full.1459.1459.261.96390.5605022003.692003.331214.059.4%10K.SGKTEIITLTPEQNLAMR.K2
*rpal_wt_anaer_light_2_cleared_full.1340.1340.259.77420.5667612130.642131.51206.060.6%8K.SGKTEIITLTPEQNLAMRK.A2
*rpal_wt_anaer_light_2_crude_1a.1407.1407.374.03760.5961542130.732131.51123.062.1%7K.SGKTEIITLTPEQNLAMRK.A3
*rpal_wt_anaer_light_2_crude_2.1974.1974.248.14570.1662411730.11731.021195.066.7%2K.TEIITLTPEQNLAMR.K2
*rpal_wt_anaer_light_2_cleared_2a.1940.1940.127.60890.2453341731.081731.0215.047.8%1K.TEIITLTPEQNLAMR.K1
*rpal_wt_anaer_light_2_crude_1.1649.1649.348.46620.3084751858.441859.21238.049.0%2K.TEIITLTPEQNLAMRK.A3
*rpal_wt_anaer_light_2_crude_full.1412.1412.240.00210.5242351860.271859.21164.048.3%3K.TEIITLTPEQNLAMRK.A2
*rpal_wt_anaer_light_2_crude_4.469.469.141.91010.5767131378.821379.581174.075.0%5R.KAMAPVYDDVGGR.V1
*rpal_wt_anaer_light_2_crude_1.480.480.259.51920.6562051379.171379.581184.066.7%8R.KAMAPVYDDVGGR.V2
*rpal_wt_anaer_light_2_cleared_1a.606.606.367.00340.4407031381.151379.581222.069.2%2R.KAMAPVYDDVGGR.V3
*rpal_wt_anaer_light_2_cleared_1a.886.886.364.4930.5208191663.741663.941244.066.0%2R.KAMAPVYDDVGGRVGK.A3
*rpal_wt_anaer_light_2_cleared_2.982.982.244.2380.6299881664.121663.94178.053.6%1R.KAMAPVYDDVGGRVGK.A2
*rpal_wt_anaer_light_2_cleared_2a.950.950.136.82580.383221250.871251.411236.072.2%7K.AMAPVYDDVGGR.V1
*rpal_wt_anaer_light_2_crude_1.612.612.272.14520.6531161251.161251.41143.087.0%9K.AMAPVYDDVGGR.V2
*rpal_wt_anaer_light_2_cleared_2.1164.1164.240.76770.3926641535.641535.76161.050.0%1K.AMAPVYDDVGGRVGK.A2
*rpal_wt_anaer_light_2_cleared_full.1758.1758.130.70290.447485962.38963.1621194.083.3%3K.ALIEEFIK.E1
*rpal_wt_anaer_light_2_cleared_full.1760.1760.251.97670.487005963.42963.1621178.086.7%6K.ALIEEFIK.E2
*rpal_wt_anaer_light_2_cleared_2a.1808.1808.171.70180.7080051676.011676.91173.091.3%3K.ALIEEFIKESGGGPTK.-1
*rpal_wt_anaer_light_2_pellet_1a.2195.2195.263.59040.6358921676.711676.911249.069.0%5K.ALIEEFIKESGGGPTK.-2
*rpal_wt_anaer_light_2_crude_1a.1861.1861.372.56520.5753671676.911676.911203.066.7%8K.ALIEEFIKESGGGPTK.-3

URPA3822205183.2%107119404.9RPA3822 conserved unknown protein 4317533:4317856 forward MW:11940
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_cleared_3.486.486.129.53650.4200131110.721108.241147.069.2%1R.KFALDEEQK.F1
*rpal_wt_anaer_light_2_membrane_4.933.933.125.32060.4144931382.811383.5913.058.8%1R.KFALDEEQKFK.A1
*rpal_wt_anaer_light_2_membrane_5.827.827.137.93740.5788171810.11811.051188.059.1%2R.KFALDEEQKFKAEAR.R1
*rpal_wt_anaer_light_2_membrane_3.1126.1126.261.57970.6701061810.551811.05131.063.0%1R.KFALDEEQKFKAEAR.R2
*rpal_wt_anaer_light_2_membrane_2.1937.1937.248.08520.4831591442.961442.75151.072.7%3R.RDKLLGLWIAEK.L2
*rpal_wt_anaer_light_2_cleared_1.1886.1886.358.82640.510211443.31442.751169.067.5%1R.RDKLLGLWIAEK.L3
*rpal_wt_anaer_light_2_crude_1.2256.2256.254.16550.590491043.021043.291178.087.5%2K.LLGLWIAEK.L2
*rpal_wt_anaer_light_2_membrane_full.1145.1145.137.71420.3789321207.581208.361236.066.7%5K.LGLSGDAAAAYAK.E1
*rpal_wt_anaer_light_2_membrane_1.1338.1338.276.69250.7565261207.981208.361197.087.5%9K.LGLSGDAAAAYAK.E2
*rpal_wt_anaer_light_2_membrane_1a.2367.2367.277.430.7444491843.461844.971255.080.6%3K.EVVIADLEEAGDDDVVR.K2
*rpal_wt_anaer_light_2_membrane_3.1983.1983.235.50690.523691972.71973.1518.045.5%2K.EVVIADLEEAGDDDVVRK.V2
*rpal_wt_anaer_light_2_membrane_3.2182.2182.232.86950.3673162302.742301.56196.034.2%1K.EVVIADLEEAGDDDVVRKVTK.D2
*rpal_wt_anaer_light_2_membrane_2a.3140.3140.345.67070.36533984.053984.451252.042.9%1K.EVVIADLEEAGDDDVVRKVTKDLTDKGITLPETELR.A3
*rpal_wt_anaer_light_2_membrane_3.1517.1517.267.65750.610342158.02158.51124.061.8%5R.KVTKDLTDKGITLPETELR.A2
*rpal_wt_anaer_light_2_membrane_2.1561.1561.359.27840.4829432158.082158.51214.047.6%2R.KVTKDLTDKGITLPETELR.A3
*rpal_wt_anaer_light_2_crude_1.1775.1775.352.1210.3709711701.521701.921243.052.2%2K.DLTDKGITLPETELR.A3
*rpal_wt_anaer_light_2_crude_full.1529.1529.257.42530.5688641701.771701.921229.066.7%6K.DLTDKGITLPETELR.A2
*rpal_wt_anaer_light_2_cleared_2a.1690.1690.131.23110.390711701.951701.921196.056.5%2K.DLTDKGITLPETELR.A1
*rpal_wt_anaer_light_2_cleared_2.1927.1927.231.01740.2350581514.651514.7411.047.8%1K.MAEFYAQAVQEVK.A2
*rpal_wt_anaer_light_2_membrane_5.1172.1172.137.17430.5683931514.951514.74141.070.0%1K.MAEFYAQAVQEVK.A1

URPA2919217082.3%186207647.6rrf ribosome releasing factor 3299823:3300383 reverse MW:20764
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_cleared_4.920.920.139.81910.5550951195.811195.321200.080.0%5M.SDKFDVNELK.R1
*rpal_wt_anaer_light_2_cleared_2a.593.593.135.71110.3778941350.71351.51181.070.6%2M.SDKFDVNELKR.R1
*rpal_wt_anaer_light_2_cleared_1.790.790.240.40290.4271051351.541351.5192.063.2%1M.SDKFDVNELKR.R2
*rpal_wt_anaer_light_2_cleared_full.634.634.348.89620.2248211352.491351.51241.051.4%2M.SDKFDVNELKR.R3
*rpal_wt_anaer_light_2_crude_full.1102.1102.250.94170.5872581696.541696.971203.056.7%4R.MQGAAQSLKHELGGLR.T2
*rpal_wt_anaer_light_2_cleared_2a.2479.2479.248.09160.6555183381.63382.84168.033.9%7R.ASASMLEPVQVDAYGSHMPLNQVATVSVPEPR.L2
*rpal_wt_anaer_light_2_cleared_3.2672.2672.370.21280.5302983382.113382.841138.051.2%8R.ASASMLEPVQVDAYGSHMPLNQVATVSVPEPR.L3
*rpal_wt_anaer_light_2_crude_3.1451.1451.134.55450.5125441087.771088.291224.078.6%2R.LISVQVWDK.S1
*rpal_wt_anaer_light_2_cleared_3.1883.1883.250.88280.6154242354.32354.671114.046.3%3K.AVEKGIVDSNLGLSPATEGQVIR.L2
*rpal_wt_anaer_light_2_crude_5.1034.1034.127.63590.3934411926.181927.171132.041.4%1K.GIVDSNLGLSPATEGQVIR.L1
*rpal_wt_anaer_light_2_crude_full.1746.1746.260.67150.590211926.781927.171224.058.8%9K.GIVDSNLGLSPATEGQVIR.L2
*rpal_wt_anaer_light_2_cleared_full.1898.1898.385.67460.520391927.521927.171253.068.3%2K.GIVDSNLGLSPATEGQVIR.L3
*rpal_wt_anaer_light_2_cleared_1.1452.1452.244.74710.3541641270.011269.441239.066.7%2R.LRIPELNEER.R2
*rpal_wt_anaer_light_2_cleared_3.340.340.132.21460.2954931115.711116.27152.073.3%1K.VAHKYAEAAR.V1
*rpal_wt_anaer_light_2_cleared_4.1045.1045.139.4190.4461881259.931260.471186.076.5%1R.DGLDTIKKLEK.A1
*rpal_wt_anaer_light_2_cleared_3.360.360.130.40230.2368541015.691016.14112.075.0%1K.RLDQEVQK.A1
*rpal_wt_anaer_light_2_crude_1a.3078.3078.261.8290.5590161657.61657.86195.069.0%1K.ATDAAIAEIDQLLANK.E2
*rpal_wt_anaer_light_2_crude_3.2444.2444.250.82960.5395481916.421915.151210.048.5%3K.ATDAAIAEIDQLLANKEK.E2
*rpal_wt_anaer_light_2_crude_1.2612.2612.352.06440.3291941917.971915.151150.052.6%2K.ATDAAIAEIDQLLANKEK.E3
*rpal_wt_anaer_light_2_crude_full.3365.3365.250.82720.4653572469.932470.8214.050.0%6K.ATDAAIAEIDQLLANKEKEILTV.-2
*rpal_wt_anaer_light_2_crude_full.3362.3362.387.51930.4959692471.772470.821218.073.1%7K.ATDAAIAEIDQLLANKEKEILTV.-3

URPA16593410881.1%196230165.1RPA1659 conserved unknown protein 1843683:1844273 reverse MW:23016
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_cleared_1a.1249.1249.265.25470.5765291495.851495.681185.081.8%7M.SRIIELLNDEHR.N2
*rpal_wt_anaer_light_2_crude_1.970.970.363.40530.4310441496.01495.681245.067.6%6M.SRIIELLNDEHR.N3
*rpal_wt_anaer_light_2_cleared_full.1330.1330.351.61910.4444941950.461950.211236.058.7%1M.SRIIELLNDEHRNIAR.L3
*rpal_wt_anaer_light_2_crude_2a.759.759.128.83040.3276921251.781252.411108.066.7%2R.IIELLNDEHR.N1
*rpal_wt_anaer_light_2_crude_1a.809.809.241.27240.3542371252.631252.411177.066.7%1R.IIELLNDEHR.N2
*rpal_wt_anaer_light_2_crude_full.3139.3139.276.04810.7345921676.241676.911237.080.0%6R.LLDVLEQELSVFDR.R2
*rpal_wt_anaer_light_2_crude_1a.3172.3172.231.37480.3590461832.521833.1180.044.4%1R.LLDVLEQELSVFDRR.E2
*rpal_wt_anaer_light_2_crude_1.3259.3259.346.16470.4159671833.091833.11187.050.0%1R.LLDVLEQELSVFDRR.E3
*rpal_wt_anaer_light_2_cleared_4.3342.3342.357.57690.4750274015.744015.51140.052.6%1R.ERPDYEIFQAIIQYFKEYPEACHHPKEDVVYR.I3
*rpal_wt_anaer_light_2_cleared_4.1518.1518.233.32820.4380072919.432919.27196.034.8%1R.ILKERNPAVAGTVGDIEKEHELEVDR.L2
*rpal_wt_anaer_light_2_cleared_3.1568.1568.352.40730.348942920.912919.27112.045.5%2R.ILKERNPAVAGTVGDIEKEHELEVDR.L3
*rpal_wt_anaer_light_2_cleared_4.1449.1449.249.4230.5898372565.12564.77184.042.9%2K.ERNPAVAGTVGDIEKEHELEVDR.L2
*rpal_wt_anaer_light_2_cleared_2.1537.1537.377.55410.5121812565.252564.77155.062.9%1K.ERNPAVAGTVGDIEKEHELEVDR.L3
*rpal_wt_anaer_light_2_cleared_3.2280.2280.350.69380.349073209.973209.54110.044.7%1K.ERNPAVAGTVGDIEKEHELEVDRLANFAK.V3
*rpal_wt_anaer_light_2_crude_full.1312.1312.275.5920.7353542278.722279.471209.070.3%9R.NPAVAGTVGDIEKEHELEVDR.L2
*rpal_wt_anaer_light_2_crude_full.1310.1310.352.99650.4387232279.132279.471225.049.2%3R.NPAVAGTVGDIEKEHELEVDR.L3
*rpal_wt_anaer_light_2_cleared_full.2169.2169.361.95490.455272924.222924.241204.057.1%1R.NPAVAGTVGDIEKEHELEVDRLANFAK.V3
*rpal_wt_anaer_light_2_cleared_2a.2229.2229.238.71010.3374652924.462924.24168.036.2%1R.NPAVAGTVGDIEKEHELEVDRLANFAK.V2
*rpal_wt_anaer_light_2_cleared_1.459.459.125.02770.188967663.48663.795136.080.0%1R.LANFAK.V1
*rpal_wt_anaer_light_2_crude_1.1551.1551.369.92990.5367191469.411469.641253.075.0%1K.VVDDVLADQELPR.Q3
*rpal_wt_anaer_light_2_crude_2.1480.1480.279.40320.573531469.791469.641187.087.0%9K.VVDDVLADQELPR.Q2
*rpal_wt_anaer_light_2_cleared_4.1583.1583.143.32210.4023581471.971469.641184.084.2%6K.VVDDVLADQELPR.Q1
*rpal_wt_anaer_light_2_cleared_4.3029.3029.251.640.5791482967.32968.451204.044.4%2R.RHMLKEEQLLFPAALETLTPEDWAK.I2
*rpal_wt_anaer_light_2_cleared_1a.3080.3080.361.60030.5372052968.32968.451245.047.1%4R.RHMLKEEQLLFPAALETLTPEDWAK.I3
*rpal_wt_anaer_light_2_crude_2a.3130.3130.275.18250.6502672811.182812.261210.057.1%11R.HMLKEEQLLFPAALETLTPEDWAK.I2
*rpal_wt_anaer_light_2_cleared_1a.3318.3318.371.32520.5720452812.562812.261242.058.6%8R.HMLKEEQLLFPAALETLTPEDWAK.I3
*rpal_wt_anaer_light_2_cleared_3.614.614.243.72580.4881881826.21825.991106.057.1%1R.IDDRKDPMFDGETASK.F2
*rpal_wt_anaer_light_2_cleared_1.655.655.345.15910.3890581826.841825.991121.047.8%1R.IDDRKDPMFDGETASK.F3
*rpal_wt_anaer_light_2_cleared_5.645.645.135.00310.4649791828.111825.991176.054.2%2R.IDDRKDPMFDGETASK.F1
*rpal_wt_anaer_light_2_cleared_full.2595.2595.363.99130.4234083046.33046.431104.056.3%2R.IDDRKDPMFDGETASKFQNLYATILR.W3
*rpal_wt_anaer_light_2_cleared_4.489.489.137.08640.4574751325.681326.471179.061.1%1R.KDPMFDGETASK.F1
*rpal_wt_anaer_light_2_cleared_4.2854.2854.246.57140.5896732547.22546.91134.043.6%2R.KDPMFDGETASKFQNLYATILR.W2
*rpal_wt_anaer_light_2_cleared_full.1977.1977.131.10750.3376391238.691239.46164.075.0%3K.FQNLYATILR.W1
*rpal_wt_anaer_light_2_crude_full.1812.1812.263.65510.5681951239.331239.461247.084.2%7K.FQNLYATILR.W2

URPA201292880.6%108112506.5RPA2012 conserved unknown protein 2265975:2266301 forward MW:11249
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_crude_2a.770.770.135.50220.5138951484.621485.631186.061.9%4M.AGQVEDLTPQEVAK.G1
*rpal_wt_anaer_light_2_cleared_1a.1137.1137.260.15160.6196211485.161485.631229.072.0%7M.AGQVEDLTPQEVAK.G2
*rpal_wt_anaer_light_2_cleared_2a.3154.3154.356.69360.4223493447.383446.921157.039.5%2R.YLLVDVREPNEVAVEAYPDAVVVPLSTFDPK.A3
*rpal_wt_anaer_light_2_crude_4.2753.2753.247.07360.6119712587.052587.891211.042.5%3R.EPNEVAVEAYPDAVVVPLSTFDPK.A2
*rpal_wt_anaer_light_2_cleared_2.1609.1609.233.81580.4476871575.121573.86114.037.0%1K.AIPDPAGKEVVFACR.S2
*rpal_wt_anaer_light_2_cleared_2.1752.1752.240.72310.5391121708.721708.941201.048.3%4R.SVTASMAAQAAGLPYNR.H2
*rpal_wt_anaer_light_2_cleared_5.1089.1089.134.80940.551071709.961708.941144.054.2%1R.SVTASMAAQAAGLPYNR.H1
*rpal_wt_anaer_light_2_cleared_2a.1306.1306.142.76620.3528791051.751052.261206.076.5%5R.HLAGGILGWK.A1
*rpal_wt_anaer_light_2_cleared_1.1561.1561.243.65730.3968941052.41052.261184.066.7%1R.HLAGGILGWK.A2

URPA115751080.5%8294426.2RPA1157 conserved unknown protein 1264853:1265101 forward MW:9441
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_crude_full.4027.4027.355.75450.3366443296.753297.65187.044.4%3M.SDNAQQLLHLVIGGELEDLENVTFRDLEK.V3
*rpal_wt_anaer_light_2_cleared_3.2707.2707.234.87070.2637172002.622002.281192.042.4%1K.VDIVGVYPNYATAYAAWK.A2
*rpal_wt_anaer_light_2_cleared_4.359.359.126.96510.2879681279.811280.411177.052.9%1R.AHQTVDNAHMR.Y1
*rpal_wt_anaer_light_2_crude_2a.587.587.130.83430.3150391084.791085.31161.071.4%3R.YFIVHLHR.L1
*rpal_wt_anaer_light_2_cleared_1a.1021.1021.240.9490.5349071085.451085.31246.068.8%2R.YFIVHLHR.L2

URPA277051080.0%100112475.8RPA2770 conserved unknown protein 3141558:3141860 forward MW:11246
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_cleared_4.2661.2661.234.57320.5077172536.312534.891129.035.0%1-.MITEIAQIDVKPGSEADFEAAVAK.A2
*rpal_wt_anaer_light_2_cleared_4.1040.1040.126.93790.3823831253.991253.471193.052.9%1R.SKGFCGFELHK.S1
*rpal_wt_anaer_light_2_cleared_2.1441.1441.246.4040.6519611546.461546.681200.063.6%3K.WQTLENHTVDFR.G2
*rpal_wt_anaer_light_2_crude_1a.887.887.230.5530.2872911124.921126.171200.056.2%1R.GSENFTEWR.G2
*rpal_wt_anaer_light_2_crude_full.2690.2690.239.30730.3817052443.362444.71142.036.6%4R.GLVGGFFAAPPDVEHTETVLTSQA.-2

URPA01767233279.2%476507175.2atpD putative H+-transporting ATP synthase beta chain. 194774:196204 reverse MW:50717
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_membrane_1a.2460.2460.378.52050.5264272208.182208.441222.067.2%7K.NGDNRLVLEVAQHLGESTVR.T3
*rpal_wt_anaer_light_2_membrane_full.2100.2100.245.6720.5586492209.682208.4413.054.3%5K.NGDNRLVLEVAQHLGESTVR.T2
*rpal_wt_anaer_light_2_membrane_full.1669.1669.264.94340.5956821651.161651.91246.074.1%6R.LVLEVAQHLGESTVR.T2
*rpal_wt_anaer_light_2_membrane_full.1668.1668.388.99950.6921811652.181651.91186.070.0%5R.LVLEVAQHLGESTVR.T3
*rpal_wt_anaer_light_2_membrane_1.1502.1502.271.59930.7017251307.061307.511190.086.4%10R.TIAMDTTEGLVR.G2
*rpal_wt_anaer_light_2_membrane_4.1407.1407.131.99420.4298281308.841307.511194.063.2%3R.TIAMDTTEGLVR.G1
*rpal_wt_anaer_light_2_membrane_full.2270.2270.364.32520.5285553369.973371.791225.048.3%6R.TIAMDTTEGLVRGQEVTDTGAPISVPVGAGTLGR.I3
*rpal_wt_anaer_light_2_membrane_5.1403.1403.232.93640.4001173370.93371.791160.026.7%2R.TIAMDTTEGLVRGQEVTDTGAPISVPVGAGTLGR.I2
*rpal_wt_anaer_light_2_membrane_full.1690.1690.388.69170.6554972083.392083.311175.065.6%4R.GQEVTDTGAPISVPVGAGTLGR.I3
*rpal_wt_anaer_light_2_crude_full.1574.1574.267.69960.6816212083.612083.311224.064.1%10R.GQEVTDTGAPISVPVGAGTLGR.I2
*rpal_wt_anaer_light_2_membrane_full.1688.1688.363.060.5282982281.952282.621215.050.0%6R.IMNVIGEPVDEQGPIKSEGLR.A3
*rpal_wt_anaer_light_2_membrane_full.1691.1691.271.11370.7063442282.432282.621164.068.4%6R.IMNVIGEPVDEQGPIKSEGLR.A2
*rpal_wt_anaer_light_2_pellet_full.1970.1970.277.81550.7821672585.882586.861150.061.9%11R.AIHQEAPAYTDQSTEAEILVTGIK.V2
*rpal_wt_anaer_light_2_membrane_full.1920.1920.374.45530.5805632586.472586.86195.054.3%6R.AIHQEAPAYTDQSTEAEILVTGIK.V3
*rpal_wt_anaer_light_2_membrane_5.2229.2229.236.31610.4570073656.343657.161160.028.3%2R.AIHQEAPAYTDQSTEAEILVTGIKVVDLLAPYAK.G2
*rpal_wt_anaer_light_2_membrane_2a.4205.4205.372.63540.5760473658.363657.161136.055.2%5R.AIHQEAPAYTDQSTEAEILVTGIKVVDLLAPYAK.G3
*rpal_wt_anaer_light_2_membrane_full.1578.1578.252.65710.6889941088.641089.321250.077.8%11K.VVDLLAPYAK.G2
*rpal_wt_anaer_light_2_pellet_2a.1667.1667.133.63610.4838611088.751089.321229.068.8%6K.VVDLLAPYAK.G1
*rpal_wt_anaer_light_2_membrane_4.1359.1359.126.71680.1486371331.81331.61224.050.0%1K.VVDLLAPYAKGGK.I1
*rpal_wt_anaer_light_2_membrane_full.1334.1334.137.72330.493427975.61976.164190.080.0%2K.IGLFGGAGVGK.T1
*rpal_wt_anaer_light_2_membrane_1a.1582.1582.244.64160.375625976.27976.1641203.072.2%4K.IGLFGGAGVGK.T2
*rpal_wt_anaer_light_2_membrane_full.3471.3471.234.76640.3410252439.012440.8918.032.6%1K.IGLFGGAGVGKTVLIQELINNVAR.A2
*rpal_wt_anaer_light_2_membrane_1a.3920.3920.375.92150.5334842440.872440.891217.054.7%2K.IGLFGGAGVGKTVLIQELINNVAR.A3
*rpal_wt_anaer_light_2_membrane_full.2948.2948.128.28460.3653971482.911483.7515.063.2%2K.TVLIQELINNVAR.A1
*rpal_wt_anaer_light_2_membrane_full.2956.2956.390.89580.5142811483.411483.751255.089.5%2K.TVLIQELINNVAR.A3
*rpal_wt_anaer_light_2_crude_1a.3163.3163.277.73160.675321484.081483.751217.087.0%18K.TVLIQELINNVAR.A2
*rpal_wt_anaer_light_2_membrane_full.1129.1129.149.93320.6284181406.681407.531197.081.0%5R.AHGGYSVFAGVGER.T1
*rpal_wt_anaer_light_2_membrane_full.1130.1130.264.64980.6332561407.181407.53147.069.2%3R.AHGGYSVFAGVGER.T2
*rpal_wt_anaer_light_2_membrane_1.1317.1317.351.8440.4771181407.731407.531182.057.8%2R.AHGGYSVFAGVGER.T3
*rpal_wt_anaer_light_2_membrane_3.1720.1720.268.45270.7010872108.512109.261172.068.8%1R.TREGNDLYHEFIESGVNK.K2
*rpal_wt_anaer_light_2_membrane_2.1766.1766.364.57180.5742072110.972109.261253.059.3%1R.TREGNDLYHEFIESGVNK.K3
*rpal_wt_anaer_light_2_membrane_1a.1623.1623.367.93150.4407442236.932237.431254.049.2%2R.TREGNDLYHEFIESGVNKK.G3
*rpal_wt_anaer_light_2_membrane_3.1519.1519.247.84880.5477092236.992237.43134.050.0%2R.TREGNDLYHEFIESGVNKK.G2
*rpal_wt_anaer_light_2_membrane_2a.1235.1235.259.22330.6358262809.172810.01196.050.0%3R.TREGNDLYHEFIESGVNKKGGGEGSK.C2
*rpal_wt_anaer_light_2_membrane_1a.1457.1457.378.83230.6079542809.812810.011119.056.2%3R.TREGNDLYHEFIESGVNKKGGGEGSK.C3
*rpal_wt_anaer_light_2_membrane_3.1682.1682.230.02650.3706931978.831980.1410.040.0%1R.EGNDLYHEFIESGVNKK.G2
*rpal_wt_anaer_light_2_membrane_4.1377.1377.252.01810.6104262552.372552.7210.050.0%2R.EGNDLYHEFIESGVNKKGGGEGSK.C2
*rpal_wt_anaer_light_2_pellet_1.2044.2044.345.32890.4454181401.141400.621234.057.5%1R.VGLTGLTVAEHFR.D3
*rpal_wt_anaer_light_2_pellet_full.4083.4083.367.15250.5314833193.073195.611191.057.5%3R.VGLTGLTVAEHFRDQGQDVLFFVDNIFR.F3
*rpal_wt_anaer_light_2_pellet_3.4145.4145.255.66090.6614571813.91814.011254.063.0%7R.DQGQDVLFFVDNIFR.F2
*rpal_wt_anaer_light_2_membrane_2a.1965.1965.139.91620.4963121435.811436.61172.068.2%4R.FTQAGSEVSALLGR.I1
*rpal_wt_anaer_light_2_crude_1a.1982.1982.271.66580.703611435.981436.611215.073.1%4R.FTQAGSEVSALLGR.I2
*rpal_wt_anaer_light_2_membrane_1.2270.2270.355.21890.3244361436.961436.611244.057.4%1R.FTQAGSEVSALLGR.I3
*rpal_wt_anaer_light_2_membrane_full.3209.3209.230.57250.4774493635.223637.111144.023.2%1R.FTQAGSEVSALLGRIPSAVGYQPTLATDMGALQER.I2
*rpal_wt_anaer_light_2_crude_full.3094.3094.381.2980.5516033635.833637.111114.062.2%10R.FTQAGSEVSALLGRIPSAVGYQPTLATDMGALQER.I3
*rpal_wt_anaer_light_2_membrane_2.2430.2430.382.30990.6078882218.892219.521219.052.2%5R.IPSAVGYQPTLATDMGALQER.I3
*rpal_wt_anaer_light_2_membrane_2a.2202.2202.265.30030.6922852220.12219.521173.059.5%7R.IPSAVGYQPTLATDMGALQER.I2
*rpal_wt_anaer_light_2_membrane_full.1571.1571.373.73430.626252019.452020.251254.054.0%3R.AISEKGIYPAVDPLDSTSR.M3
*rpal_wt_anaer_light_2_membrane_full.1570.1570.262.8110.711032020.272020.251234.054.5%3R.AISEKGIYPAVDPLDSTSR.M2
*rpal_wt_anaer_light_2_membrane_full.1539.1539.246.25410.6431621491.331491.64160.060.0%11K.GIYPAVDPLDSTSR.M2
*rpal_wt_anaer_light_2_membrane_4.1671.1671.125.76290.3298581493.81491.641184.050.0%1K.GIYPAVDPLDSTSR.M1
*rpal_wt_anaer_light_2_membrane_2a.1245.1245.131.19090.5804451777.671778.98156.056.5%3R.MLSASIVGEEHYNTAR.M1
*rpal_wt_anaer_light_2_membrane_full.1218.1218.255.02850.5290511778.51778.981206.064.3%5R.MLSASIVGEEHYNTAR.M2
*rpal_wt_anaer_light_2_membrane_1a.1466.1466.360.03050.4983121779.011778.981157.058.3%2R.MLSASIVGEEHYNTAR.M3
*rpal_wt_anaer_light_2_pellet_1a.944.944.133.91440.294202987.45988.2391208.083.3%16R.MVQQILQK.Y1
*rpal_wt_anaer_light_2_membrane_full.595.595.254.59460.504497987.94988.2391227.086.7%11R.MVQQILQK.Y2
*rpal_wt_anaer_light_2_membrane_2a.3575.3575.386.61110.6123592951.842952.41165.063.2%5K.YKSLQDIIAILGMDELSEEDKLTVAR.A3
*rpal_wt_anaer_light_2_membrane_full.3400.3400.259.59680.6008812951.962952.41175.043.5%1K.YKSLQDIIAILGMDELSEEDKLTVAR.A2
*rpal_wt_anaer_light_2_membrane_full.3611.3611.271.8570.6808082659.992661.051185.059.5%8K.SLQDIIAILGMDELSEEDKLTVAR.A2
*rpal_wt_anaer_light_2_membrane_1a.4090.4090.362.42970.4653172660.822661.051247.051.4%5K.SLQDIIAILGMDELSEEDKLTVAR.A3
*rpal_wt_anaer_light_2_membrane_2a.2773.2773.346.73330.2699833363.13360.881226.043.2%3K.IERFLSQPFFVAEVFTGSPGKFVDLADTIK.G3
*rpal_wt_anaer_light_2_membrane_3.3425.3425.263.7250.6525341958.471959.251172.065.6%12R.FLSQPFFVAEVFTGSPGK.F2
*rpal_wt_anaer_light_2_membrane_full.3681.3681.239.62530.5633932962.022962.42176.034.8%4R.FLSQPFFVAEVFTGSPGKFVDLADTIK.G2
*rpal_wt_anaer_light_2_membrane_2a.3991.3991.237.2950.3563133321.393322.831204.029.6%3R.FLSQPFFVAEVFTGSPGKFVDLADTIKGFR.A2
*rpal_wt_anaer_light_2_membrane_3.1676.1676.143.65260.6125521021.761022.191211.085.7%3K.FVDLADTIK.G1
*rpal_wt_anaer_light_2_membrane_full.1480.1480.251.33760.5213041022.191022.191173.072.2%4K.FVDLADTIK.G2
*rpal_wt_anaer_light_2_membrane_2.2382.2382.255.41620.6320881382.031382.6179.077.3%3K.FVDLADTIKGFR.A2
*rpal_wt_anaer_light_2_membrane_4.2262.2262.125.25950.2520081382.081382.61208.050.0%1K.FVDLADTIKGFR.A1
*rpal_wt_anaer_light_2_membrane_full.3524.3524.253.71730.644713014.123015.43199.038.3%4R.AICEGKYDHLPEAAFYMVGTIEEAVEK.G2
*rpal_wt_anaer_light_2_membrane_2a.3700.3700.372.80650.5961383014.493015.431245.055.6%6R.AICEGKYDHLPEAAFYMVGTIEEAVEK.G3
*rpal_wt_anaer_light_2_membrane_2a.3410.3410.359.92760.5017923328.933328.831203.051.4%3R.AICEGKYDHLPEAAFYMVGTIEEAVEKGKK.L3
*rpal_wt_anaer_light_2_membrane_2a.4008.4008.356.91340.441873857.083855.421192.047.7%1R.AICEGKYDHLPEAAFYMVGTIEEAVEKGKKLAAEAA.-3

URPA1620103179.2%106115355.8RPA1620 unknown protein 1801160:1801480 reverse MW:11535
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_cleared_full.3279.3279.233.31880.3844052340.982341.671130.042.4%2K.INALLEQETSLRQWLEQIR.A2
*rpal_wt_anaer_light_2_crude_1a.3524.3524.368.12610.5337262341.482341.671248.052.5%5K.INALLEQETSLRQWLEQIR.A3
*rpal_wt_anaer_light_2_cleared_2a.947.947.134.0490.4364741058.891059.251146.070.6%3R.GATVIAGLTQK.E1
*rpal_wt_anaer_light_2_cleared_2a.3448.3448.280.25460.6485772587.42587.031249.057.1%7R.GATVIAGLTQKETEEFLLLSPLVR.A2
*rpal_wt_anaer_light_2_crude_2a.2812.2812.125.89380.2397561545.871546.81156.055.0%1K.ETEEFLLLSPLVR.A1
*rpal_wt_anaer_light_2_crude_2.2926.2926.231.64460.4344091546.91546.81242.041.7%1K.ETEEFLLLSPLVR.A2
*rpal_wt_anaer_light_2_cleared_2a.765.765.131.06940.4593681519.921520.671201.054.5%3R.AFDSGMTADHAAAVR.A1
*rpal_wt_anaer_light_2_cleared_1a.846.846.279.27170.7408651521.131520.671184.078.6%6R.AFDSGMTADHAAAVR.A2
*rpal_wt_anaer_light_2_cleared_1.1008.1008.348.74540.4327851521.371520.671173.054.3%2R.AFDSGMTADHAAAVR.A3
*rpal_wt_anaer_light_2_cleared_4.2603.2603.281.17680.7860132630.182630.881216.060.0%1K.AKLEGALQDNAIESLSGWGEATAAAR.-2

URPA31112278.9%95103844.6gatC Glu-tRNA(Gln) amidotransferase subunit C 3515973:3516260 reverse MW:10383
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_pellet_5.2459.2459.345.23270.4332994943.324943.691120.044.6%1R.IAVTEDEVPHLQGELNAMLAFVEQLSEVNVEGVEPMTSVTPMQMK.K3
*rpal_wt_anaer_light_2_crude_3.2476.2476.347.40950.2776663255.313255.57142.049.4%1K.RADVVNDGEIADQVVANAPSTEDHFFLVPK.V3

URPA29213616477.6%308322065.8tsf elongation factor Ts 3301233:3302159 reverse MW:32206
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_cleared_1a.631.631.230.44620.346562905.92906.1341195.058.8%1M.ATITAAMVK.E2
*rpal_wt_anaer_light_2_cleared_2.1127.1127.234.61720.4782331570.411570.85118.050.0%1K.ELRETTGVGMMDCK.Q2
*rpal_wt_anaer_light_2_cleared_2a.622.622.132.44060.5034931171.791172.39164.070.6%1R.ETTGVGMMDCK.Q1
*rpal_wt_anaer_light_2_cleared_5.1943.1943.232.91060.3196453128.553126.511202.025.0%1R.ETTGVGMMDCKQALAETDGNIDAAIDWLR.K2
*rpal_wt_anaer_light_2_pellet_2a.2228.2228.146.28170.5503321416.411416.621186.078.3%7R.VAAEGLIGALTDGTK.G1
*rpal_wt_anaer_light_2_crude_full.1955.1955.274.46320.6733351416.791416.621247.077.8%8R.VAAEGLIGALTDGTK.G2
*rpal_wt_anaer_light_2_pellet_full.999.999.134.26990.5425371062.491063.212.085.7%7R.NEQFQGLVK.M1
*rpal_wt_anaer_light_2_cleared_1a.982.982.245.6430.5613571063.21063.21219.075.0%5R.NEQFQGLVK.M2
*rpal_wt_anaer_light_2_cleared_1.1117.1117.237.27260.207461872.84874.1351162.080.0%3K.MIAQVALK.V2
*rpal_wt_anaer_light_2_cleared_2.1057.1057.128.54440.102293874.65874.1351196.076.9%1K.MIAQVALK.V1
*rpal_wt_anaer_light_2_crude_2a.5079.5079.266.3850.6311153441.073441.891209.035.9%9K.VGADLDAINAAPVGSTTVAGAIADAIATIGENMTLR.R2
*rpal_wt_anaer_light_2_crude_2a.5099.5099.360.37920.4414223441.983441.89139.046.4%11K.VGADLDAINAAPVGSTTVAGAIADAIATIGENMTLR.R3
*rpal_wt_anaer_light_2_cleared_3.5110.5110.350.91690.3732813596.873598.071167.040.6%5K.VGADLDAINAAPVGSTTVAGAIADAIATIGENMTLRR.A3
*rpal_wt_anaer_light_2_pellet_4.2532.2532.244.73960.5896662554.932555.9116.038.6%4R.RAAALSVSQGVVASYIHNAVIDGAGK.M2
*rpal_wt_anaer_light_2_pellet_1a.2800.2800.386.75540.6110292556.52555.91236.058.9%8R.RAAALSVSQGVVASYIHNAVIDGAGK.M3
*rpal_wt_anaer_light_2_crude_full.2425.2425.269.80590.662512398.752399.711234.058.1%11R.AAALSVSQGVVASYIHNAVIDGAGK.M2
*rpal_wt_anaer_light_2_crude_1a.2736.2736.370.5350.4956082399.42399.711228.060.3%8R.AAALSVSQGVVASYIHNAVIDGAGK.M3
*rpal_wt_anaer_light_2_crude_1.1067.1067.248.47310.361204943.58944.0761254.076.5%2K.ADELAVLGR.Q2
*rpal_wt_anaer_light_2_cleared_3.1293.1293.135.30970.346545943.91944.0761163.071.4%2K.ADELAVLGR.Q1
*rpal_wt_anaer_light_2_crude_full.1917.1917.251.16490.5678272715.172715.111197.044.7%7R.QLAMHVAAANPQALDPTSLDPAVVQR.E2
*rpal_wt_anaer_light_2_pellet_full.2095.2095.365.50880.504572716.772715.111219.048.7%2R.QLAMHVAAANPQALDPTSLDPAVVQR.E3
*rpal_wt_anaer_light_2_cleared_4.2107.2107.255.67270.5949432431.182431.7712.057.1%2K.TYYKEVCLLEQAYIHDEKGK.S2
*rpal_wt_anaer_light_2_crude_2.451.451.234.13330.5228441402.541402.5910.044.0%1K.GKSVAQAVKEAEGK.V2
*rpal_wt_anaer_light_2_pellet_4.591.591.128.25050.3401211402.811402.59168.057.1%1K.GKSVAQAVKEAEGK.V1
*rpal_wt_anaer_light_2_cleared_2a.606.606.137.81910.5223131216.81217.371209.077.8%5K.SVAQAVKEAEGK.V1
*rpal_wt_anaer_light_2_cleared_1a.640.640.249.3970.5942931217.281217.371125.068.2%4K.SVAQAVKEAEGK.V2
*rpal_wt_anaer_light_2_cleared_2.2628.2628.348.19830.3484332454.822454.92167.045.8%1K.SVAQAVKEAEGKVGAPIKIVGFVR.Y3
*rpal_wt_anaer_light_2_cleared_4.1649.1649.137.03090.4400191255.971256.58142.066.7%3K.VGAPIKIVGFVR.Y1
*rpal_wt_anaer_light_2_cleared_1a.1679.1679.244.94930.6723291256.621256.581116.061.9%3K.VGAPIKIVGFVR.Y2
*rpal_wt_anaer_light_2_cleared_full.1524.1524.372.08230.5338151257.611256.581205.075.7%4K.VGAPIKIVGFVR.Y3
*rpal_wt_anaer_light_2_pellet_full.938.938.139.28090.345873979.5980.1061215.085.7%14R.YALGEGIEK.Q1
*rpal_wt_anaer_light_2_crude_1a.540.540.239.86430.256596980.31980.1061224.066.7%4R.YALGEGIEK.Q2
*rpal_wt_anaer_light_2_cleared_2a.2693.2693.277.06120.7353552542.312542.761100.061.4%4R.YALGEGIEKQTSDFAAEVAAASGQK.-2
*rpal_wt_anaer_light_2_cleared_2.2948.2948.364.14940.5604542543.842542.761222.050.0%5R.YALGEGIEKQTSDFAAEVAAASGQK.-3
*rpal_wt_anaer_light_2_pellet_2a.1543.1543.130.80310.4696091580.751581.68140.058.3%2K.QTSDFAAEVAAASGQK.-1
*rpal_wt_anaer_light_2_cleared_full.1408.1408.257.48170.6778711581.611581.681120.063.3%7K.QTSDFAAEVAAASGQK.-2

URPA28743510977.3%427450015.2eno enolase 3250857:3252140 reverse MW:45001
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_pellet_full.1463.1463.134.10580.375446957.57958.147176.085.7%2M.TAIVDIIGR.E1
*rpal_wt_anaer_light_2_crude_1a.1439.1439.254.38980.520778957.83958.1471252.082.4%5M.TAIVDIIGR.E2
*rpal_wt_anaer_light_2_pellet_1.3226.3226.356.32920.4482131673.661671.941216.055.1%1M.TAIVDIIGREILDSR.G3
*rpal_wt_anaer_light_2_pellet_1a.1271.1271.269.59270.6954091722.861723.88177.072.7%3R.AAVPSGASTGAHEAVELR.D2
*rpal_wt_anaer_light_2_crude_5.551.551.135.8620.4757571723.071723.881154.051.9%2R.AAVPSGASTGAHEAVELR.D1
*rpal_wt_anaer_light_2_pellet_1a.1269.1269.349.12830.4576571725.411723.881153.041.1%1R.AAVPSGASTGAHEAVELR.D3
*rpal_wt_anaer_light_2_pellet_3.1045.1045.233.72550.4769832366.272366.55127.033.3%1R.AAVPSGASTGAHEAVELRDGDKAR.Y2
*rpal_wt_anaer_light_2_pellet_2.391.391.128.60610.304865893.57893.0741202.064.3%2R.YLGKGVQK.A1
*rpal_wt_anaer_light_2_pellet_2a.3421.3421.351.50090.3685454164.624162.6132.045.3%2K.AVEAVNGELFDALGGMDAEQQVQIDQTMIELDGTPNKGR.I3
*rpal_wt_anaer_light_2_pellet_full.1293.1293.132.74330.5508181328.671329.521154.064.7%2K.AAAASYDMPLYR.Y1
*rpal_wt_anaer_light_2_crude_1a.1242.1242.257.59450.7009191329.181329.521250.076.2%5K.AAAASYDMPLYR.Y2
*rpal_wt_anaer_light_2_crude_2a.4170.4170.345.00060.3866394328.74329.091165.039.1%1R.TLPVPMMNIVNGGVHADNPIDFQEFMIMPVGAPTFADALR.C3
*rpal_wt_anaer_light_2_pellet_5.2098.2098.245.72980.5252113356.523357.731124.032.2%4K.KAGHNTNVGDEGGFAPNLPSADAALDFVMAAIGK.A2
*rpal_wt_anaer_light_2_pellet_2a.4074.4074.355.2980.4212393357.223357.731170.045.5%2K.KAGHNTNVGDEGGFAPNLPSADAALDFVMAAIGK.A3
*rpal_wt_anaer_light_2_pellet_full.4118.4118.381.45650.5888333229.173229.551224.058.6%10K.AGHNTNVGDEGGFAPNLPSADAALDFVMAAIGK.A3
*rpal_wt_anaer_light_2_pellet_2a.4219.4219.251.72420.6553623229.313229.551154.036.8%7K.AGHNTNVGDEGGFAPNLPSADAALDFVMAAIGK.A2
*rpal_wt_anaer_light_2_pellet_1a.4245.4245.230.15970.4222091862.51860.16113.038.7%1K.AGGDVMLALDCAATEFFK.D2
*rpal_wt_anaer_light_2_pellet_2a.3974.3974.351.49850.2884323031.733030.361219.048.6%1K.AGGDVMLALDCAATEFFKDGSYVYGGENK.T3
*rpal_wt_anaer_light_2_crude_1a.1036.1036.131.87370.309453920.61921.0851147.084.6%2K.YLADLVAR.Y1
*rpal_wt_anaer_light_2_crude_1.927.927.242.26920.439147921.27921.0851166.075.0%2K.YLADLVAR.Y2
*rpal_wt_anaer_light_2_pellet_2a.4067.4067.355.84450.3466814047.64047.55127.050.0%3K.YLADLVARYPIVSIEDGMSEDDMDGWKELTDLIGSK.C3
*rpal_wt_anaer_light_2_crude_full.3391.3391.258.09120.6923443144.113145.491185.044.9%6R.YPIVSIEDGMSEDDMDGWKELTDLIGSK.C2
*rpal_wt_anaer_light_2_pellet_full.3508.3508.383.50340.6131533144.533145.491196.063.9%9R.YPIVSIEDGMSEDDMDGWKELTDLIGSK.C3
*rpal_wt_anaer_light_2_pellet_2a.2238.2238.127.39520.3199681679.681680.921192.047.6%1K.CQLVGDDLFVTNVTR.L1
*rpal_wt_anaer_light_2_pellet_1a.2521.2521.264.50910.6829861680.861680.921250.070.4%2K.CQLVGDDLFVTNVTR.L2
*rpal_wt_anaer_light_2_pellet_4.3526.3526.239.16520.4249792766.542767.261132.040.0%1R.ANSILIKVNQIGTLTETLAAVEMAHK.A2
*rpal_wt_anaer_light_2_pellet_3.3640.3640.352.79450.3344212766.692767.261211.043.4%3R.ANSILIKVNQIGTLTETLAAVEMAHK.A3
*rpal_wt_anaer_light_2_crude_full.2335.2335.266.21340.7043092026.412027.351187.061.8%5K.VNQIGTLTETLAAVEMAHK.A2
*rpal_wt_anaer_light_2_crude_full.2329.2329.361.81860.3943212027.292027.351232.052.3%5K.VNQIGTLTETLAAVEMAHK.A3
*rpal_wt_anaer_light_2_pellet_3.505.505.125.29380.3924281092.671093.25166.066.7%1K.AGYTAVMSHR.S1
*rpal_wt_anaer_light_2_pellet_1.544.544.238.49730.5320581093.111093.25192.061.1%2K.AGYTAVMSHR.S2
*rpal_wt_anaer_light_2_pellet_3.2356.2356.259.2720.6547612223.092224.411243.056.4%7R.SGETEDSTIADLAVATNCGQIK.T2
*rpal_wt_anaer_light_2_pellet_full.471.471.236.93570.28144807.41806.9411240.075.0%3K.YNQLLR.I2
*rpal_wt_anaer_light_2_pellet_2.505.505.251.26150.6390251524.541524.68193.060.0%1R.IEQELGAHAHYAGK.A2
*rpal_wt_anaer_light_2_pellet_5.447.447.146.09560.5548341526.551524.681169.070.0%4R.IEQELGAHAHYAGK.A1

URPA32263912677.3%339375355.0rpoA DNA-directed RNA polymerase alpha subunit 3645359:3646378 reverse MW:37535
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_pellet_1a.2039.2039.362.42760.4608142894.922895.291107.051.5%6M.TIQKNWQELIRPNKLQVTPGSDATR.F3
*rpal_wt_anaer_light_2_pellet_1.1522.1522.240.24490.5738271298.671298.49148.061.1%1K.NWQELIRPNK.L2
*rpal_wt_anaer_light_2_pellet_1a.2059.2059.359.14250.3142992424.322424.721255.048.5%4K.NWQELIRPNKLQVTPGSDATR.F3
*rpal_wt_anaer_light_2_pellet_4.1757.1757.235.72660.4521282425.332424.7214.042.1%1K.NWQELIRPNKLQVTPGSDATR.F2
*rpal_wt_anaer_light_2_pellet_1a.448.448.237.62250.3863191144.891145.261229.052.4%1K.LQVTPGSDATR.F2
*rpal_wt_anaer_light_2_crude_1a.1539.1539.252.38910.5421381246.391246.451237.070.0%9R.FATLVAEPLER.G2
*rpal_wt_anaer_light_2_crude_full.1326.1326.140.37070.4731431246.911246.451162.082.4%6R.FATLVAEPLER.G1
*rpal_wt_anaer_light_2_crude_1.1412.1412.247.70790.548531133.721134.281225.066.7%3R.GFGQTLGNALR.R2
*rpal_wt_anaer_light_2_pellet_2a.3279.3279.348.46730.3559623248.23247.73150.041.5%1R.RVLLSSLQGAAVQSVHIDGVLHEFSSIAGVR.E3
*rpal_wt_anaer_light_2_crude_full.3231.3231.347.37160.2426943090.193091.541206.045.1%1R.VLLSSLQGAAVQSVHIDGVLHEFSSIAGVR.E3
*rpal_wt_anaer_light_2_pellet_5.1557.1557.136.34810.4586351815.091816.11138.058.3%1R.EDVTDIVLNIKDISLK.M1
*rpal_wt_anaer_light_2_pellet_full.2778.2778.269.01590.6471251815.711816.11208.075.0%7R.EDVTDIVLNIKDISLK.M2
*rpal_wt_anaer_light_2_pellet_1a.263.263.125.24440.258544604.44604.8351116.075.0%1R.MVVKK.Q1
*rpal_wt_anaer_light_2_pellet_2a.3330.3330.360.61990.4292523793.943794.281177.048.4%1K.KQGPGAVTAGDIQTVGDIVVLNPDLQLCTLDDGAEIR.M3
*rpal_wt_anaer_light_2_pellet_2a.947.947.132.26920.5227151027.771027.19194.071.4%2R.MEFTVNTGK.G1
*rpal_wt_anaer_light_2_pellet_1a.1645.1645.258.50490.6811261773.371774.011226.066.7%4R.MEFTVNTGKGYVAAER.N2
*rpal_wt_anaer_light_2_pellet_1a.1644.1644.350.12990.495911774.171774.011205.046.4%1R.MEFTVNTGKGYVAAER.N3
*rpal_wt_anaer_light_2_pellet_5.884.884.131.56110.4675031775.121774.01190.050.0%2R.MEFTVNTGKGYVAAER.N1
*rpal_wt_anaer_light_2_crude_full.2217.2217.370.75230.548972309.412309.631238.059.4%5R.NRPEDAPIGLIPVDSLYSPVR.K3
*rpal_wt_anaer_light_2_pellet_3.2674.2674.254.23470.610952309.822309.631240.050.0%12R.NRPEDAPIGLIPVDSLYSPVR.K2
*rpal_wt_anaer_light_2_crude_1a.2131.2131.377.33150.5664542436.892437.81238.054.5%9R.NRPEDAPIGLIPVDSLYSPVRK.V3
*rpal_wt_anaer_light_2_pellet_full.2080.2080.267.47210.709412437.512437.81170.062.5%7R.NRPEDAPIGLIPVDSLYSPVRK.V2
*rpal_wt_anaer_light_2_pellet_3.406.406.135.29540.6118811095.711096.23188.085.7%1K.VSYKVENTR.E1
*rpal_wt_anaer_light_2_pellet_3.803.803.130.20060.3671121082.671081.171128.071.4%1R.EGQILDYDK.L1
*rpal_wt_anaer_light_2_pellet_full.3569.3569.365.30820.5204524116.714117.741151.057.1%4R.ILQDQLNVFVNFEEPRKEVTQEIIPDLAFNPAFLK.K3
*rpal_wt_anaer_light_2_pellet_1a.3209.3209.381.5590.6191752174.632174.551229.062.9%3R.KEVTQEIIPDLAFNPAFLK.K3
*rpal_wt_anaer_light_2_crude_full.2625.2625.276.29370.7185862174.652174.551165.070.6%7R.KEVTQEIIPDLAFNPAFLK.K2
*rpal_wt_anaer_light_2_crude_3.2468.2468.233.64340.4881792302.062302.721144.038.9%1R.KEVTQEIIPDLAFNPAFLKK.V2
*rpal_wt_anaer_light_2_pellet_2.2783.2783.352.68550.3334792302.422302.721244.052.5%1R.KEVTQEIIPDLAFNPAFLKK.V3
*rpal_wt_anaer_light_2_pellet_3.3621.3621.354.42230.3435783342.883343.89125.041.1%1R.KEVTQEIIPDLAFNPAFLKKVDELELSVR.S3
*rpal_wt_anaer_light_2_pellet_5.1758.1758.231.23090.3754333344.973343.89198.030.0%1R.KEVTQEIIPDLAFNPAFLKKVDELELSVR.S2
*rpal_wt_anaer_light_2_pellet_3.3408.3408.240.75590.5059492045.832046.371173.046.9%1K.EVTQEIIPDLAFNPAFLK.K2
*rpal_wt_anaer_light_2_pellet_2a.1078.1078.136.12170.377541187.811188.371135.075.0%5K.KVDELELSVR.S1
*rpal_wt_anaer_light_2_pellet_1a.1307.1307.244.55330.4230661188.191188.371213.068.4%1K.KVDELELSVR.S2
*rpal_wt_anaer_light_2_pellet_full.2058.2058.270.05670.7057142107.322108.421239.060.6%7R.SANCLKNDNIVYIGDLVQK.S2
*rpal_wt_anaer_light_2_pellet_2.2318.2318.370.48240.5726292109.792108.421239.052.6%2R.SANCLKNDNIVYIGDLVQK.S3
*rpal_wt_anaer_light_2_crude_full.2877.2877.363.0470.4761352925.762925.361149.056.2%2R.SANCLKNDNIVYIGDLVQKSEAEMLR.T3
*rpal_wt_anaer_light_2_pellet_4.3270.3270.246.43870.5124542927.112925.361233.041.3%1R.SANCLKNDNIVYIGDLVQKSEAEMLR.T2
*rpal_wt_anaer_light_2_crude_4.1815.1815.140.39950.5461281490.881491.68162.070.0%2K.NDNIVYIGDLVQK.S1

URPA1442279876.7%270288016.9RPA1442 possible uridine monophosphate kinase 1598614:1599426 reverse MW:28801
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_crude_2a.1955.1955.143.06990.5019861579.921580.85171.071.4%4M.AHTPAELEALLMQR.S1
*rpal_wt_anaer_light_2_crude_full.1831.1831.256.8420.1286211580.351580.851133.072.0%6M.AHTPAELEALLMQR.S2
*rpal_wt_anaer_light_2_pellet_1a.2411.2411.365.0750.4216011580.931580.851246.064.3%3M.AHTPAELEALLMQR.S3
*rpal_wt_anaer_light_2_crude_full.2011.2011.294.83420.758381941.41942.111254.078.8%6R.SMSDPELLAATEAATDYR.I2
*rpal_wt_anaer_light_2_pellet_2a.2261.2261.126.54840.5329931941.841942.111134.050.0%3R.SMSDPELLAATEAATDYR.I1
*rpal_wt_anaer_light_2_crude_1.2299.2299.348.78410.4353141944.591942.1110.046.7%1R.SMSDPELLAATEAATDYR.I3
*rpal_wt_anaer_light_2_pellet_full.1139.1139.129.15490.400135969.54970.1981164.071.4%4R.ILPDATVIK.I1
*rpal_wt_anaer_light_2_pellet_1a.545.545.245.5030.534424976.83977.1291117.076.5%1K.IGGQSMIDR.G2
*rpal_wt_anaer_light_2_pellet_1a.3122.3122.261.01530.6794151517.361517.771129.072.0%9R.AAVYPLVEEIVSAR.K2
*rpal_wt_anaer_light_2_crude_1.531.531.240.66120.574329959.0959.1351176.068.4%4K.LLIGTGAGTR.A2
*rpal_wt_anaer_light_2_pellet_2a.4296.4296.379.18050.6591333934.53935.581246.059.4%5R.ARHLYSIAAGLNLPAGVLSQLGASVASQNAEMLGQLLAK.H3
*rpal_wt_anaer_light_2_crude_full.4317.4317.255.52160.6012633707.173708.321246.034.8%6R.HLYSIAAGLNLPAGVLSQLGASVASQNAEMLGQLLAK.H2
*rpal_wt_anaer_light_2_pellet_full.4379.4379.384.24410.6171713708.663708.321229.057.0%5R.HLYSIAAGLNLPAGVLSQLGASVASQNAEMLGQLLAK.H3
*rpal_wt_anaer_light_2_pellet_5.1234.1234.135.63670.5392141884.061885.171156.050.0%2K.HGISSVGDAGLSAVPLYLK.E1
*rpal_wt_anaer_light_2_pellet_1a.2452.2452.283.88320.7302451885.831885.171218.076.5%5K.HGISSVGDAGLSAVPLYLK.E2
*rpal_wt_anaer_light_2_pellet_1a.2450.2450.353.43160.4566871885.871885.171126.052.4%1K.HGISSVGDAGLSAVPLYLK.E3
*rpal_wt_anaer_light_2_pellet_5.1207.1207.126.53160.3400441636.861637.9166.052.4%1R.TDAGCYLMAEQFGCK.A1
*rpal_wt_anaer_light_2_pellet_2.596.596.126.01130.24008724.77724.9421120.070.0%1K.AMIYVK.D1
*rpal_wt_anaer_light_2_pellet_full.524.524.133.88930.478535821.46821.971161.090.9%2K.ISVDEMK.A1
*rpal_wt_anaer_light_2_pellet_3.3526.3526.254.5310.6857752010.92009.41251.054.8%2K.AKGLHDSILEFPVLDLLK.S2
*rpal_wt_anaer_light_2_crude_5.1814.1814.155.19130.6671781809.251810.141199.075.0%2K.GLHDSILEFPVLDLLK.S1
*rpal_wt_anaer_light_2_pellet_full.3491.3491.261.36490.6971351809.721810.141251.062.1%6K.GLHDSILEFPVLDLLK.S2
*rpal_wt_anaer_light_2_pellet_1a.3929.3929.357.43490.4411051811.251810.141190.053.2%6K.GLHDSILEFPVLDLLK.S3
*rpal_wt_anaer_light_2_pellet_1a.2125.2125.251.67340.6169251594.871595.841199.070.4%6R.EVQVVNGLVPGNLTR.A2
*rpal_wt_anaer_light_2_pellet_full.1816.1816.134.86370.52081594.931595.84172.058.3%3R.EVQVVNGLVPGNLTR.A1
*rpal_wt_anaer_light_2_pellet_4.1281.1281.138.59090.5897871366.761367.55157.065.0%2R.ALAGEHVGTIITAN.-1
*rpal_wt_anaer_light_2_pellet_1a.1562.1562.233.84850.4779331367.631367.551192.048.0%2R.ALAGEHVGTIITAN.-2

URPA43086229076.0%529562155.6serA2 putative phosphoglycerate dehydrogenase 4858096:4859685 reverse MW:56215
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_crude_1a.3587.3587.265.94190.4974851703.921705.01223.069.0%7K.VLISDALSEAAVQIFK.D2
*rpal_wt_anaer_light_2_crude_1.3698.3698.379.69590.4218211704.491705.01255.068.0%1K.VLISDALSEAAVQIFK.D3
*rpal_wt_anaer_light_2_pellet_full.3186.3186.268.26280.6658821975.951976.281173.063.6%12K.VLISDALSEAAVQIFKDR.G2
*rpal_wt_anaer_light_2_pellet_full.3183.3183.353.97320.4716951977.131976.281205.048.3%8K.VLISDALSEAAVQIFKDR.G3
*rpal_wt_anaer_light_2_pellet_5.844.844.126.88810.255311789.11789.98184.047.8%1R.GIDVDFQPNLGKDKDK.L1
*rpal_wt_anaer_light_2_pellet_2.1396.1396.242.68940.4909911789.781789.981133.055.2%2R.GIDVDFQPNLGKDKDK.L2
*rpal_wt_anaer_light_2_crude_full.2776.2776.239.98660.4292993288.253289.71167.032.7%3R.GIDVDFQPNLGKDKDKLAEIIGNYDGLAIR.S2
*rpal_wt_anaer_light_2_pellet_full.2920.2920.387.26070.598113288.623289.711252.064.5%8R.GIDVDFQPNLGKDKDKLAEIIGNYDGLAIR.S3
*rpal_wt_anaer_light_2_pellet_1a.2462.2462.248.99790.5331561518.541518.751186.064.0%2K.LAEIIGNYDGLAIR.S2
*rpal_wt_anaer_light_2_crude_5.869.869.141.80340.5263211526.081526.731206.065.2%6R.AGIGVDNVEIPAATAK.G1
*rpal_wt_anaer_light_2_crude_full.1339.1339.253.55480.4083141526.531526.731244.064.3%6R.AGIGVDNVEIPAATAK.G2
*rpal_wt_anaer_light_2_crude_full.4812.4812.254.37550.6179572990.62991.571123.038.8%11K.GIIVMNTPFGNSITTAEHAITMMLSLAR.E2
*rpal_wt_anaer_light_2_crude_full.4809.4809.377.3020.5603312991.232991.57150.061.5%8K.GIIVMNTPFGNSITTAEHAITMMLSLAR.E3
*rpal_wt_anaer_light_2_crude_1a.649.649.246.35090.6332461702.171702.8610.056.7%7R.EIPAADASTQAGKWEK.N2
*rpal_wt_anaer_light_2_crude_5.531.531.135.09540.4015481703.031702.861156.056.0%4R.EIPAADASTQAGKWEK.N1
*rpal_wt_anaer_light_2_pellet_full.1423.1423.127.64010.366793995.45996.215128.071.4%2R.FMGVEITAK.T1
*rpal_wt_anaer_light_2_pellet_full.2313.2313.256.31880.5929171646.281645.921218.058.1%7K.TLGVIGCGNIGSIVADR.A2
*3rpal_wt_anaer_light_2_pellet_full.361.361.126.18840.204484501.67501.6471114.088.9%1R.ALGLK.M11
*rpal_wt_anaer_light_2_crude_1.2349.2349.354.14830.462571650.841650.981238.044.7%2K.MKVIAFDPFLSPER.A3
*rpal_wt_anaer_light_2_pellet_2.2537.2537.252.07860.5769491651.291650.981237.057.7%2K.MKVIAFDPFLSPER.A2
*rpal_wt_anaer_light_2_cleared_1a.2409.2409.263.73440.6244241391.051391.611252.072.7%16K.VIAFDPFLSPER.A2
*rpal_wt_anaer_light_2_pellet_3.2018.2018.257.21080.5977821989.911990.311123.058.1%1R.AKDLGVEKVELEDIFKR.A2
*rpal_wt_anaer_light_2_crude_2a.1482.1482.132.03960.4422251148.741149.331226.071.4%2K.VELEDIFKR.A1
*rpal_wt_anaer_light_2_pellet_1.1953.1953.243.84050.5540581149.611149.331120.070.6%1K.VELEDIFKR.A2
*rpal_wt_anaer_light_2_crude_4.1560.1560.133.8170.4215811471.821472.681180.060.0%3R.ADFITLHTPLTDK.T1
*rpal_wt_anaer_light_2_crude_1a.1756.1756.230.64890.3136161472.541472.6811.043.5%1R.ADFITLHTPLTDK.T2
*rpal_wt_anaer_light_2_pellet_5.952.952.141.40160.574071701.071701.961103.060.9%5R.ADFITLHTPLTDKTK.N1
*rpal_wt_anaer_light_2_pellet_full.1473.1473.239.79630.4464691701.71701.9617.053.8%5R.ADFITLHTPLTDKTK.N2
*rpal_wt_anaer_light_2_pellet_4.2551.2551.235.62680.4364942684.682683.12148.038.6%1R.ADFITLHTPLTDKTKNIIDAAAIAK.M2
*rpal_wt_anaer_light_2_cleared_full.2375.2375.345.03870.254252685.322683.12188.046.3%1R.ADFITLHTPLTDKTKNIIDAAAIAK.M3
*rpal_wt_anaer_light_2_crude_4.636.636.131.88760.4083971229.881229.461198.061.1%2K.TKNIIDAAAIAK.M1
*rpal_wt_anaer_light_2_crude_full.995.995.249.74750.599932999.691000.181172.078.9%6K.NIIDAAAIAK.M2
*rpal_wt_anaer_light_2_crude_2a.1047.1047.136.16840.552756999.751000.18142.075.0%6K.NIIDAAAIAK.M1
*rpal_wt_anaer_light_2_pellet_full.2108.2108.137.25630.520981399.551400.57144.066.7%9R.GGLVDENALAEALK.S1
*rpal_wt_anaer_light_2_crude_2.2116.2116.285.32680.652471400.891400.571191.084.0%9R.GGLVDENALAEALK.S2
*rpal_wt_anaer_light_2_pellet_full.3043.3043.374.91450.4968383302.123302.62189.052.4%4R.GGLVDENALAEALKSGHVAGAAFDVFSEEPATK.N3
*rpal_wt_anaer_light_2_pellet_5.1663.1663.241.02980.5559573302.43302.621195.027.3%2R.GGLVDENALAEALKSGHVAGAAFDVFSEEPATK.N2
*rpal_wt_anaer_light_2_pellet_5.1001.1001.165.32830.7744221920.081921.071143.078.6%5K.SGHVAGAAFDVFSEEPATK.N1
*rpal_wt_anaer_light_2_pellet_1.1914.1914.355.96130.4950941920.941921.071250.049.1%2K.SGHVAGAAFDVFSEEPATK.N3
*rpal_wt_anaer_light_2_pellet_full.1584.1584.287.88010.7651541921.891921.07154.076.5%5K.SGHVAGAAFDVFSEEPATK.N2
*rpal_wt_anaer_light_2_crude_3.1148.1148.132.26070.2661881187.891188.451196.068.8%5K.LKPFIELAEK.L1
*rpal_wt_anaer_light_2_crude_1a.1326.1326.231.68880.465781188.11188.451136.061.1%1K.LKPFIELAEK.L2
*rpal_wt_anaer_light_2_pellet_2a.1703.1703.141.37750.581841522.81523.73168.068.2%6K.LGSFAGQLTETGITK.V1
*rpal_wt_anaer_light_2_crude_full.1454.1454.260.14480.6387091523.491523.731233.070.4%8K.LGSFAGQLTETGITK.V2
*rpal_wt_anaer_light_2_pellet_full.3628.3628.385.13880.5375773048.083048.75157.058.9%6K.IKALTSAVLSGLLRPMLGDINVVSAPVIAK.E3
*rpal_wt_anaer_light_2_pellet_5.1929.1929.230.39620.1863653049.373048.75137.030.4%2K.IKALTSAVLSGLLRPMLGDINVVSAPVIAK.E2
*rpal_wt_anaer_light_2_crude_4.4000.4000.253.27780.5633452806.082807.421226.040.8%11K.ALTSAVLSGLLRPMLGDINVVSAPVIAK.E2
*rpal_wt_anaer_light_2_crude_1a.4081.4081.389.14530.5983582806.62807.421238.068.4%11K.ALTSAVLSGLLRPMLGDINVVSAPVIAK.E3
*rpal_wt_anaer_light_2_crude_2a.3750.3750.356.80270.4110673091.613092.72163.046.3%2K.ALTSAVLSGLLRPMLGDINVVSAPVIAKER.G3
*rpal_wt_anaer_light_2_crude_2a.802.802.134.7630.311231003.641004.21164.084.6%4R.GMVVDEVVR.A1
*rpal_wt_anaer_light_2_pellet_1.1334.1334.246.78580.2203511004.411004.21250.075.0%4R.GMVVDEVVR.A2
*rpal_wt_anaer_light_2_pellet_4.2319.2319.235.00850.3358132385.332385.59198.035.1%1R.AAESDYESLITLTVTTEKQER.S2
*rpal_wt_anaer_light_2_pellet_1a.415.415.246.14160.5915721336.931337.48190.065.2%1R.SVSGTVYADGKPR.L2
*rpal_wt_anaer_light_2_pellet_2a.2236.2236.251.5990.6486272505.942505.811168.050.0%3R.VDAEFGSSMIYVTNEDKPGFIGK.F2
*rpal_wt_anaer_light_2_pellet_full.1161.1161.135.27690.436623921.5922.0691201.078.6%7K.FASLLGDAK.V1
*rpal_wt_anaer_light_2_crude_1a.958.958.242.51770.386931921.99922.0691155.066.7%5K.FASLLGDAK.V2
*rpal_wt_anaer_light_2_crude_2a.1524.1524.125.11040.2884341104.961105.28170.056.2%1K.VNIATFNLGR.H1
*rpal_wt_anaer_light_2_cleared_1.1870.1870.255.55260.5266581105.871105.281207.073.7%4K.VNIATFNLGR.H2
*rpal_wt_anaer_light_2_pellet_1a.2650.2650.376.4350.5296232434.522434.711120.058.3%1R.HTEGGDAIALVTIDGPAPTEVLEK.V3
*rpal_wt_anaer_light_2_pellet_2a.2359.2359.264.24440.6407242434.682434.711206.047.7%12R.HTEGGDAIALVTIDGPAPTEVLEK.V2
*rpal_wt_anaer_light_2_pellet_2.694.694.129.36610.31755882.61883.0791163.076.9%7K.VQALPQVK.Q1
*rpal_wt_anaer_light_2_pellet_1a.714.714.232.00470.45883.15883.0791149.066.7%2K.VQALPQVK.Q2
Similarities: RPA2553(1:61)

URPA091871876.0%7585689.1RPA0918 possible 50S ribosomal protein L31 1020328:1020555 reverse MW:8567
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_cleared_4.1896.1896.265.26750.7327262967.352968.341150.052.3%4-.MKTEIHPDYHTITVVMTDGTEYQTR.S2
*rpal_wt_anaer_light_2_pellet_2a.1893.1893.353.62550.4154552968.552968.34161.044.9%1-.MKTEIHPDYHTITVVMTDGTEYQTR.S3
*rpal_wt_anaer_light_2_crude_5.814.814.132.18320.4599541917.141917.131137.056.0%2R.STWGKEGDKLNLDIDPK.S1
*rpal_wt_anaer_light_2_crude_4.820.820.126.23450.2595781356.61357.51201.064.7%1K.EGDKLNLDIDPK.S1
*rpal_wt_anaer_light_2_pellet_5.776.776.126.49030.2929071652.971653.81136.050.0%2K.SHPAWTGGTQQVLDR.G1
*rpal_wt_anaer_light_2_crude_1a.880.880.359.28360.5227311653.771653.8187.064.4%3K.SHPAWTGGTQQVLDR.G3
*rpal_wt_anaer_light_2_cleared_2.1184.1184.257.22440.6946811654.641653.8190.070.4%5K.SHPAWTGGTQQVLDR.G2

URPA22004311375.9%498523957.1guaB inosine monophosphate dehydrogenase 2475578:2477074 forward MW:52395
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_pellet_2a.3879.3879.231.97330.4432673730.533731.241156.025.0%2M.ASVSASPQFIEALTFDDVLLKPGLSDVLPSEVDIR.S2
*rpal_wt_anaer_light_2_pellet_full.3769.3769.359.15890.341443730.853731.241193.051.2%2M.ASVSASPQFIEALTFDDVLLKPGLSDVLPSEVDIR.S3
*rpal_wt_anaer_light_2_crude_full.3495.3495.268.33660.6378122096.912097.48174.068.6%12R.AIPLNIPIIASAMDTVTEAR.M2
*rpal_wt_anaer_light_2_pellet_2.1846.1846.232.64030.5243061595.731596.96117.044.8%1R.MAIAMAQAGGLGVIHR.N2
*rpal_wt_anaer_light_2_pellet_1.1974.1974.356.37560.5119871597.851596.961217.049.1%1R.MAIAMAQAGGLGVIHR.N3
*rpal_wt_anaer_light_2_pellet_1.1255.1255.262.76950.5860471331.791332.421170.081.8%1R.NFDPEGQAAQVR.Q2
*rpal_wt_anaer_light_2_pellet_5.1103.1103.147.11490.6262481933.011934.26198.063.0%2K.KFESGMVVNPLTISPDAK.L1
*rpal_wt_anaer_light_2_pellet_1a.2170.2170.281.49010.7567041933.531934.261244.075.0%5K.KFESGMVVNPLTISPDAK.L2
*rpal_wt_anaer_light_2_crude_1a.1852.1852.357.22840.4804121934.641934.261221.041.3%3K.KFESGMVVNPLTISPDAK.L3
*rpal_wt_anaer_light_2_pellet_3.2282.2282.241.76150.6243381805.681806.091240.051.6%1K.FESGMVVNPLTISPDAK.L2
*rpal_wt_anaer_light_2_pellet_5.1237.1237.125.10430.280351805.991806.09135.050.0%1K.FESGMVVNPLTISPDAK.L1
*rpal_wt_anaer_light_2_pellet_4.3139.3139.235.20020.498292871.22871.291160.033.3%1K.LADALALMNQYGFSGIPVVTGAQGHGPGK.L2
*rpal_wt_anaer_light_2_pellet_full.2933.2933.380.98280.5301512872.672871.291243.063.2%4K.LADALALMNQYGFSGIPVVTGAQGHGPGK.L3
*rpal_wt_anaer_light_2_pellet_2a.3395.3395.351.83380.3293223738.23738.351249.044.6%1K.LADALALMNQYGFSGIPVVTGAQGHGPGKLVGILTNR.D3
*rpal_wt_anaer_light_2_pellet_2a.2379.2379.242.4980.5078312487.342487.84170.043.6%3R.FATDPAQKVSELMTHENLVTVR.E2
*rpal_wt_anaer_light_2_pellet_full.2280.2280.351.16440.4233312489.352487.84127.050.0%3R.FATDPAQKVSELMTHENLVTVR.E3
*rpal_wt_anaer_light_2_pellet_full.1350.1350.249.09970.4698341628.741628.891204.060.0%3K.VSELMTHENLVTVR.E2
*rpal_wt_anaer_light_2_crude_1.1292.1292.354.70480.4276631629.021628.891223.060.0%1K.VSELMTHENLVTVR.E3
*rpal_wt_anaer_light_2_pellet_2a.1173.1173.130.6340.4482411120.81121.281200.066.7%2K.LLVVDDQYR.C1
*rpal_wt_anaer_light_2_pellet_1a.1411.1411.245.75380.6148231120.971121.281242.081.2%3K.LLVVDDQYR.C2
*rpal_wt_anaer_light_2_pellet_3.377.377.129.06330.167176893.77894.0621180.069.2%1K.AVAHPLASK.D1
*rpal_wt_anaer_light_2_pellet_1a.623.623.253.29710.6686241381.171381.491131.068.0%4R.VAAATTVGEGGYER.T2
*rpal_wt_anaer_light_2_pellet_2a.1514.1514.231.37520.5076022048.242046.2918.038.9%1R.LIEAGVDVVVVDTAHGHSAR.V23
*rpal_wt_anaer_light_2_pellet_2.1817.1817.269.36320.6465321584.821584.821250.070.4%4R.ISNQVQVIAGNIATR.D2
*rpal_wt_anaer_light_2_crude_4.1381.1381.153.83480.6327911430.771431.541201.073.9%5R.DGAQALIDSGADAVK.V1
*rpal_wt_anaer_light_2_pellet_1a.1817.1817.260.8120.3493641432.031431.541245.066.7%2R.DGAQALIDSGADAVK.V2
*rpal_wt_anaer_light_2_pellet_4.2560.2560.267.30190.6755982573.292573.891120.050.0%4R.DGAQALIDSGADAVKVGIGPGSICTTR.I2
*rpal_wt_anaer_light_2_pellet_2.2738.2738.356.54080.4316942573.622573.891245.047.5%2R.DGAQALIDSGADAVKVGIGPGSICTTR.I3
*rpal_wt_anaer_light_2_pellet_1a.1420.1420.237.55030.3755121161.151161.371194.054.5%2K.VGIGPGSICTTR.I2
*rpal_wt_anaer_light_2_crude_full.3554.3554.259.02170.7035062084.922085.541166.056.8%11R.IVAGVGVPQLTAIMDAVQACK.K2
*rpal_wt_anaer_light_2_crude_1a.3932.3932.397.01940.6560212085.632085.541255.067.2%6R.IVAGVGVPQLTAIMDAVQACK.K3
*rpal_wt_anaer_light_2_pellet_4.1000.1000.144.42490.6417191282.851283.511250.075.0%3K.KADVPVIADGGIK.Y1
*rpal_wt_anaer_light_2_pellet_3.1583.1583.238.94860.5718922017.572018.32126.044.4%2K.KADVPVIADGGIKYSGDLAK.A2
*rpal_wt_anaer_light_2_crude_3.1040.1040.125.02330.3186871155.81155.34116.061.1%1K.ADVPVIADGGIK.Y1
*rpal_wt_anaer_light_2_pellet_1a.600.600.244.32320.621778937.22937.1311184.076.5%2R.GMGSVGAMAR.G2
*rpal_wt_anaer_light_2_pellet_5.926.926.126.10150.2756321886.091886.071224.047.8%1R.GSADRYFQQDIKDTLK.L1
*rpal_wt_anaer_light_2_pellet_3.1558.1558.243.12690.5729651887.311886.07137.051.9%1R.GSADRYFQQDIKDTLK.L2
*rpal_wt_anaer_light_2_pellet_4.1169.1169.138.44380.5153211398.691399.591225.064.7%1R.YFQQDIKDTLK.L1
*rpal_wt_anaer_light_2_pellet_3.2818.2818.351.03630.4271162886.152885.34157.047.5%3K.LVPEGIEGQVPYKGPVGNVVHQLAGGLR.A3
*rpal_wt_anaer_light_2_pellet_2a.2651.2651.240.04720.5281472886.382885.341160.037.5%1K.LVPEGIEGQVPYKGPVGNVVHQLAGGLR.A2
*rpal_wt_anaer_light_2_pellet_2.468.468.132.17830.524543867.56868.044162.064.3%1R.AAMGYVGAK.D1
*rpal_wt_anaer_light_2_pellet_4.411.411.136.02150.5558431293.91294.41176.076.5%1R.ESHVHDVTITR.E1
*rpal_wt_anaer_light_2_pellet_1a.1031.1031.126.28780.149727919.34919.9671204.061.5%2R.ESPNYPGGV.-1

URPA16663413175.5%449493385.6hemN1 putative coproporphyrinogen oxidase III 1850616:1851965 reverse MW:49338
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_cleared_3.424.424.138.54440.503762982.73983.111224.084.6%2M.SSALDKYAK.S1
*rpal_wt_anaer_light_2_pellet_4.967.967.126.99530.3782441382.951383.551181.055.6%1R.YTSYPTAPHFAK.D1
*rpal_wt_anaer_light_2_pellet_2a.3426.3426.231.35870.3421572531.452532.921133.035.9%2R.GWLAQLDTDEPVSLYLHVPFCK.Q2
*rpal_wt_anaer_light_2_pellet_1a.3741.3741.349.36340.3486942533.262532.921217.043.5%1R.GWLAQLDTDEPVSLYLHVPFCK.Q3
*rpal_wt_anaer_light_2_pellet_2a.5019.5019.254.53370.6728573228.63228.651110.038.5%3K.YDPVADYVEHLIDEIDLVADALPGTMPVR.H2
*rpal_wt_anaer_light_2_pellet_2a.3556.3556.242.06360.5737242659.992661.11160.041.3%6R.HLHFGGGTPTVIDPQDLGALMTLLR.E2
*rpal_wt_anaer_light_2_crude_full.3282.3282.389.02340.5296332662.162661.11254.061.0%7R.HLHFGGGTPTVIDPQDLGALMTLLR.E3
*rpal_wt_anaer_light_2_pellet_3.2871.2871.243.74310.5671681850.21850.041145.053.3%1R.FEFLPDAEIAIESDPR.T2
*rpal_wt_anaer_light_2_cleared_2a.415.415.126.0220.347929980.85980.127116.064.3%2R.TLTEDMAAK.I1
*rpal_wt_anaer_light_2_cleared_3.1106.1106.128.00830.301436892.9893.0311160.069.2%1K.IGELGFTR.A1
*rpal_wt_anaer_light_2_crude_1a.741.741.246.26330.47186893.25893.0311251.073.3%2K.IGELGFTR.A2
*rpal_wt_anaer_light_2_crude_1.1351.1351.248.77990.6673671225.31225.341197.073.7%1R.ASFGVQEFDPK.V2
*rpal_wt_anaer_light_2_cleared_full.803.803.126.77990.227816737.34737.9411180.077.8%3R.AMQLFK.S1
*rpal_wt_anaer_light_2_crude_1a.3191.3191.354.7840.4623962298.82298.61221.047.5%4R.INFDLIYGLPYQTAEDLRR.T3
*rpal_wt_anaer_light_2_cleared_2.725.725.237.60050.4679091436.811435.66188.047.6%2R.TVEQCVEMKPDR.V2
*rpal_wt_anaer_light_2_crude_full.2061.2061.254.09770.6425911558.481558.871220.066.7%4R.VALFGYAHVPWVAK.N2
*rpal_wt_anaer_light_2_pellet_5.1329.1329.141.88870.577541559.181558.871155.066.7%3R.VALFGYAHVPWVAK.N1
*rpal_wt_anaer_light_2_cleared_1.2591.2591.361.44710.6056841559.951558.871233.054.8%2R.VALFGYAHVPWVAK.N3
*rpal_wt_anaer_light_2_crude_2.1337.1337.242.49140.5837511526.131525.81133.058.3%1R.MIPDESLPKPELR.A2
*rpal_wt_anaer_light_2_pellet_2a.1332.1332.130.7740.4691791302.731303.461113.063.2%6R.ATQAETAAEALVK.G1
*rpal_wt_anaer_light_2_pellet_1a.1590.1590.271.45370.6407491302.941303.461230.087.0%7R.ATQAETAAEALVK.G2
*rpal_wt_anaer_light_2_cleared_2a.2222.2222.155.73980.5914141808.951810.11206.066.7%6R.IGIDHFALPGDSLAIAAK.T1
*rpal_wt_anaer_light_2_crude_1a.2308.2308.378.99090.4891851809.791810.11204.056.9%9R.IGIDHFALPGDSLAIAAK.T3
*rpal_wt_anaer_light_2_crude_3.2223.2223.263.52770.660941811.11810.11217.065.6%10R.IGIDHFALPGDSLAIAAK.T2
*rpal_wt_anaer_light_2_crude_1a.3152.3152.358.3620.4237642341.182342.57154.050.7%3R.NFQGYTSDAAQTLIGLGATSIGR.T3
*rpal_wt_anaer_light_2_crude_full.2787.2787.284.83350.7329642341.332342.571186.068.3%9R.NFQGYTSDAAQTLIGLGATSIGR.T2
*rpal_wt_anaer_light_2_cleared_4.3402.3402.349.01490.3384264178.644177.541220.042.0%1R.NFQGYTSDAAQTLIGLGATSIGRTPSGYVQNISETGAWSR.A3
*rpal_wt_anaer_light_2_crude_3.1444.1444.271.32730.6588451854.481853.991220.070.0%3R.TPSGYVQNISETGAWSR.A2
*rpal_wt_anaer_light_2_cleared_2a.424.424.140.51560.4550251111.171111.331154.082.4%4R.AVEAGKIPVAR.G1
*rpal_wt_anaer_light_2_cleared_1.552.552.241.67010.338251113.981111.331140.057.1%3R.AVEAGKIPVAR.G2
*rpal_wt_anaer_light_2_pellet_4.406.406.131.85130.4753491252.851253.361104.064.7%4R.GHALTQQDNLR.A1
*rpal_wt_anaer_light_2_crude_full.2370.2370.254.33310.6397222385.962386.561170.051.4%10K.AFGCGEDWYAPEQDSLAELQR.D2
*rpal_wt_anaer_light_2_cleared_1.1307.1307.230.12880.278849986.18986.1571188.052.9%1K.LTLTPEGVR.L2
*rpal_wt_anaer_light_2_crude_full.1780.1780.263.67010.6779481269.611270.471202.085.0%7R.VVASVFDTYLR.N2

URPA32538942975.1%690756015.4fusA, EF-G elongation factor G 3661155:3663227 reverse MW:75601
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_cleared_2a.1211.1211.347.39560.3053742946.242948.291166.038.8%2R.VHAIEDYRNFGIMAHIDAGKTTTTER.I3
*rpal_wt_anaer_light_2_crude_1.1157.1157.354.7190.4438771964.511964.211222.057.4%1R.NFGIMAHIDAGKTTTTER.I3
*rpal_wt_anaer_light_2_pellet_2a.1324.1324.259.39060.6909881964.551964.211174.060.6%5R.NFGIMAHIDAGKTTTTER.I2
*rpal_wt_anaer_light_2_cleared_1a.1151.1151.131.58260.48338841.52842.0261100.090.0%6R.ILFYTGK.S1
*rpal_wt_anaer_light_2_cleared_4.571.571.125.91180.2547761194.041194.42174.062.5%1R.ILFYTGKSHK.I1
*rpal_wt_anaer_light_2_pellet_4.1297.1297.252.52440.6411952672.132671.931168.046.3%1K.SHKIGEVHEGAATMDWMTQEQER.G2
*rpal_wt_anaer_light_2_cleared_3.1689.1689.267.95210.7353312318.62319.5419.062.9%5K.IGEVHEGAATMDWMTQEQER.G2
*rpal_wt_anaer_light_2_crude_2.1496.1496.357.9470.4726852319.722319.541229.053.3%1K.IGEVHEGAATMDWMTQEQER.G3
*rpal_wt_anaer_light_2_cleared_4.2764.2764.237.04730.5370732972.282973.341212.031.9%1R.SLRVLDGAVCVLDSNQGVEPQTETVWR.Q2
*rpal_wt_anaer_light_2_crude_full.2227.2227.260.69050.6721222616.982616.911228.053.5%7R.VLDGAVCVLDSNQGVEPQTETVWR.Q2
*rpal_wt_anaer_light_2_cleared_3.908.908.129.07420.2590061160.731160.34148.068.8%2K.MDKTGADFFK.C1
*rpal_wt_anaer_light_2_cleared_2.3340.3340.346.50490.3815172103.272103.431202.041.9%1K.MDKTGADFFKCLQDIVDR.L3
*rpal_wt_anaer_light_2_pellet_2.837.837.125.43050.212741785.53785.875151.072.7%1K.TGADFFK.C1
*rpal_wt_anaer_light_2_crude_2a.1832.1832.261.1280.691761997.091997.351205.057.6%5R.LGAKPVAIQLPIGSENNFK.G2
*rpal_wt_anaer_light_2_crude_1a.1961.1961.365.3120.483551997.261997.351243.059.3%5R.LGAKPVAIQLPIGSENNFK.G3
*rpal_wt_anaer_light_2_pellet_4.2972.2972.247.90780.6173072749.972750.261129.044.4%3R.LGAKPVAIQLPIGSENNFKGVIDLVR.M2
*rpal_wt_anaer_light_2_pellet_1a.3196.3196.388.22110.5930552750.552750.261181.060.0%10R.LGAKPVAIQLPIGSENNFKGVIDLVR.M3
*rpal_wt_anaer_light_2_crude_4.987.987.129.47250.4097921288.691289.43140.061.1%3K.AVVWNDESLGAK.F1
*rpal_wt_anaer_light_2_cleared_1a.1304.1304.239.77430.4310921289.851289.431192.061.9%2K.AVVWNDESLGAK.F2
*rpal_wt_anaer_light_2_crude_2a.2252.2252.153.01220.604211688.821689.861200.077.3%8K.FEDAEIPAELLDQAK.E1
*rpal_wt_anaer_light_2_crude_full.2109.2109.279.27480.726851689.051689.861178.085.2%8K.FEDAEIPAELLDQAK.E2
*rpal_wt_anaer_light_2_crude_3.2409.2409.253.71180.6450152138.92138.341168.054.5%6K.FEDAEIPAELLDQAKEYR.E2
*rpal_wt_anaer_light_2_cleared_2.2693.2693.358.62940.5425212139.172138.341227.042.6%6K.FEDAEIPAELLDQAKEYR.E3
*rpal_wt_anaer_light_2_cleared_2.2432.2432.347.07320.3860142395.642395.631204.047.5%2K.FEDAEIPAELLDQAKEYREK.M3
*rpal_wt_anaer_light_2_cleared_3.2389.2389.246.04670.5892192395.92395.631208.044.4%5K.FEDAEIPAELLDQAKEYREK.M2
*rpal_wt_anaer_light_2_crude_5.1299.1299.151.45130.6601971873.131873.27196.069.2%4R.KAVLTGAFYPVLCGSAFK.N1
*rpal_wt_anaer_light_2_crude_full.2306.2306.278.24480.7151381873.541873.271245.075.8%9R.KAVLTGAFYPVLCGSAFK.N2
*rpal_wt_anaer_light_2_cleared_1.2874.2874.367.0550.5538231874.721873.271252.046.9%6R.KAVLTGAFYPVLCGSAFK.N3
*rpal_wt_anaer_light_2_crude_full.2686.2686.260.95290.605971744.11745.091234.061.3%8K.AVLTGAFYPVLCGSAFK.N2
*rpal_wt_anaer_light_2_crude_1.3104.3104.365.20780.402781745.111745.091253.049.1%1K.AVLTGAFYPVLCGSAFK.N3
*rpal_wt_anaer_light_2_crude_5.1497.1497.135.35120.4553111746.081745.091193.056.0%3K.AVLTGAFYPVLCGSAFK.N1
*rpal_wt_anaer_light_2_crude_2a.3741.3741.264.40470.5957252664.262663.131198.047.5%5K.NKGVQPLLDAVVDYLPSPLDVPAIK.G2
*rpal_wt_anaer_light_2_cleared_full.3218.3218.365.56590.5051673834.393834.361223.048.3%8K.NKGVQPLLDAVVDYLPSPLDVPAIKGTDDKGNEVVR.K3
*rpal_wt_anaer_light_2_crude_1a.4202.4202.365.69160.4920312420.352420.851231.048.6%1K.GVQPLLDAVVDYLPSPLDVPAIK.G3
*rpal_wt_anaer_light_2_crude_2a.4061.4061.268.91540.7553132420.962420.851173.060.0%4K.GVQPLLDAVVDYLPSPLDVPAIK.G2
*rpal_wt_anaer_light_2_cleared_3.3772.3772.350.56020.3194353591.933592.091174.044.8%1K.GVQPLLDAVVDYLPSPLDVPAIKGTDDKGNEVVR.K3
*rpal_wt_anaer_light_2_cleared_2a.1628.1628.149.61370.5129511575.031575.851143.071.4%4R.KADDKEPLSLLAFK.I1
*rpal_wt_anaer_light_2_crude_1a.1682.1682.247.2670.4447711575.311575.851146.064.0%5R.KADDKEPLSLLAFK.I2
*rpal_wt_anaer_light_2_pellet_1.2048.2048.367.26830.4897061576.511575.851246.065.9%5R.KADDKEPLSLLAFK.I3
*rpal_wt_anaer_light_2_crude_4.1830.1830.135.57480.4378071447.01447.671248.060.0%2K.ADDKEPLSLLAFK.I1
*rpal_wt_anaer_light_2_cleared_full.2547.2547.281.33040.7479371615.431615.911231.084.6%9K.IMDDPFVGTITFCR.I2
*rpal_wt_anaer_light_2_cleared_5.1549.1549.128.28260.285951616.911615.911146.052.4%1K.IMDDPFVGTITFCR.I1
*rpal_wt_anaer_light_2_cleared_2.1982.1982.244.73880.5789991723.821723.971100.050.0%2R.IYSGVLLSGTGVVNSTR.E2
*rpal_wt_anaer_light_2_crude_3.2435.2435.352.54140.3387792959.372958.48126.050.7%2R.MLLMHANNREDIKEAYAGDIVALAGLK.E3
*rpal_wt_anaer_light_2_cleared_2a.2280.2280.360.06940.436823315.013314.86145.048.8%1R.MLLMHANNREDIKEAYAGDIVALAGLKEAR.T3
*rpal_wt_anaer_light_2_crude_1a.2392.2392.250.42550.6769091391.461391.611200.064.0%1K.EAYAGDIVALAGLK.E2
*rpal_wt_anaer_light_2_crude_4.2252.2252.138.39810.4999211391.991391.611144.066.7%1K.EAYAGDIVALAGLK.E1
*rpal_wt_anaer_light_2_cleared_1a.2131.2131.243.4410.6024791747.591747.99136.053.3%1K.EAYAGDIVALAGLKEAR.T2
*rpal_wt_anaer_light_2_crude_2a.1567.1567.147.74930.6250561685.861686.921166.072.0%10R.TGDTLCDPANPVILEK.M1
*rpal_wt_anaer_light_2_cleared_2.1805.1805.280.33740.6676331687.371686.921220.082.8%12R.TGDTLCDPANPVILEK.M2
*rpal_wt_anaer_light_2_cleared_2a.3479.3479.356.93530.4407793409.583410.971183.045.6%1R.TGDTLCDPANPVILEKMEFPEPVIEIAIEPK.S3
*rpal_wt_anaer_light_2_pellet_full.2784.2784.271.30830.7050031742.751743.07196.081.5%15K.MEFPEPVIEIAIEPK.S2
*rpal_wt_anaer_light_2_cleared_5.1654.1654.137.06770.430351745.141743.071212.059.1%10K.MEFPEPVIEIAIEPK.S1
*rpal_wt_anaer_light_2_pellet_4.550.550.145.63140.5011531457.921458.71234.073.7%1K.SKADQEKLGVALAK.L1
*rpal_wt_anaer_light_2_cleared_2.609.609.250.33510.5322111459.331458.713.062.5%1K.SKADQEKLGVALAK.L2
*rpal_wt_anaer_light_2_pellet_1a.650.650.125.64740.154651671.46671.8591131.081.8%1K.LGVALAK.L1
*rpal_wt_anaer_light_2_cleared_1.759.759.245.00980.4179421006.041006.11249.076.5%8K.LAAEDPSFR.V2
*rpal_wt_anaer_light_2_cleared_4.2168.2168.230.75720.4929022380.212378.6419.030.8%1K.LAAEDPSFRVSTDLESGQTILK.G2
*rpal_wt_anaer_light_2_crude_full.1089.1089.138.53850.5226411390.71391.561202.063.2%10R.VSTDLESGQTILK.G1
*rpal_wt_anaer_light_2_pellet_1.1576.1576.265.78450.6555661391.491391.561208.078.3%14R.VSTDLESGQTILK.G2
*rpal_wt_anaer_light_2_crude_3.1088.1088.127.33630.3577041112.71113.321234.072.7%2K.GMGELHLDIK.V1
*rpal_wt_anaer_light_2_crude_1.1230.1230.230.72610.2873231113.441113.32171.057.1%1K.GMGELHLDIK.V2
*rpal_wt_anaer_light_2_pellet_full.1559.1559.273.78280.7013611750.581751.01218.080.0%8R.TYKVDANIGAPQVAFR.E2
*rpal_wt_anaer_light_2_cleared_1.1769.1769.370.54590.4905421750.871751.01250.067.4%7R.TYKVDANIGAPQVAFR.E3
*rpal_wt_anaer_light_2_crude_1.1454.1454.234.20290.4621571357.811358.541164.045.8%1K.VDANIGAPQVAFR.E2
*rpal_wt_anaer_light_2_cleared_1.1579.1579.352.36290.4628981657.21656.961179.050.0%2K.IVGGAVPKEYIPGVEK.G3
*rpal_wt_anaer_light_2_cleared_2.1498.1498.238.43570.5177221657.881656.961162.051.7%1K.IVGGAVPKEYIPGVEK.G2
*rpal_wt_anaer_light_2_pellet_3.790.790.129.91480.396603934.83935.0651193.071.4%4K.EYIPGVEK.G1
*rpal_wt_anaer_light_2_cleared_full.3464.3464.254.81610.6284432875.192876.321120.040.0%3K.EYIPGVEKGIESVLSSGVVAGFPVVDVK.V2
*rpal_wt_anaer_light_2_crude_1a.3138.3138.381.82770.5971111960.111960.281218.056.5%5K.GIESVLSSGVVAGFPVVDVK.V3
*rpal_wt_anaer_light_2_pellet_full.2944.2944.276.24560.6842721960.881960.281239.069.4%21K.GIESVLSSGVVAGFPVVDVK.V2
*rpal_wt_anaer_light_2_cleared_5.1715.1715.153.76970.5755861961.911960.281163.067.7%11K.GIESVLSSGVVAGFPVVDVK.V1
*rpal_wt_anaer_light_2_cleared_1a.342.342.129.16420.351386733.59731.8681142.081.8%2K.VTLVDGK.Y1
*rpal_wt_anaer_light_2_cleared_4.2094.2094.244.85270.5742782494.792494.761201.035.0%1K.VTLVDGKYHDVDSSALAFEIASR.A2
*rpal_wt_anaer_light_2_pellet_3.1839.1839.256.5170.5813171780.161781.9210.053.3%2K.YHDVDSSALAFEIASR.A2
*rpal_wt_anaer_light_2_cleared_1a.1301.1301.237.98750.3590291213.651215.54130.060.0%1K.GKSVLLEPIMK.V2
*rpal_wt_anaer_light_2_crude_4.964.964.137.12990.4102571215.911215.541172.064.7%4K.GKSVLLEPIMK.V1
*rpal_wt_anaer_light_2_crude_full.1309.1309.140.33420.4816781029.61030.321186.085.7%7K.SVLLEPIMK.V1
*rpal_wt_anaer_light_2_crude_full.1314.1314.248.53430.4155431030.121030.321231.076.5%9K.SVLLEPIMK.V2
*rpal_wt_anaer_light_2_cleared_full.3114.3114.254.66720.6522693161.663162.631210.037.3%2K.SVLLEPIMKVEVVTPEDYTGSVIGDLNSR.R2
*rpal_wt_anaer_light_2_cleared_full.3112.3112.387.40340.6048693162.023162.631206.057.7%4K.SVLLEPIMKVEVVTPEDYTGSVIGDLNSR.R3
*rpal_wt_anaer_light_2_cleared_full.2308.2308.279.47570.7335662150.862151.341162.077.8%15K.VEVVTPEDYTGSVIGDLNSR.R2
*rpal_wt_anaer_light_2_cleared_1a.2513.2513.346.02950.3902132154.292151.34197.041.0%1K.VEVVTPEDYTGSVIGDLNSR.R3
*rpal_wt_anaer_light_2_crude_full.3994.3994.281.9420.7083172552.882554.031169.067.5%11R.GNANVINAMVPLMNMFGYVNNLR.S2
*rpal_wt_anaer_light_2_crude_full.3995.3995.392.20150.6412382553.962554.031243.067.6%11R.GNANVINAMVPLMNMFGYVNNLR.S3
*rpal_wt_anaer_light_2_cleared_full.1973.1973.376.65640.5534712569.092569.811207.059.4%3R.ANFTMQFDHYAEAPANVSAEVQK.K3
*rpal_wt_anaer_light_2_pellet_4.2092.2092.262.69550.618522569.912569.811205.050.0%4R.ANFTMQFDHYAEAPANVSAEVQK.K2
*rpal_wt_anaer_light_2_cleared_2.2061.2061.379.0390.6146942696.612697.991236.058.8%12R.ANFTMQFDHYAEAPANVSAEVQKK.F3
*rpal_wt_anaer_light_2_cleared_4.1951.1951.267.69940.6815912697.082697.991244.054.8%9R.ANFTMQFDHYAEAPANVSAEVQKK.F2

URPA17893314375.1%385408848.5RPA1789 putative branched-chain amino acid transport system substrate-binding protein 2004817:2005974 forward MW:40884
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_crude_full.601.601.134.76020.457607891.49892.043117.091.7%4R.NALEFVAK.E1
*rpal_wt_anaer_light_2_crude_1.680.680.243.63530.571017892.32892.0431184.080.0%3R.NALEFVAK.E2
*rpal_wt_anaer_light_2_cleared_full.1507.1507.259.44110.6087142618.042618.911178.055.8%9K.EIGGHPLKVIVLDDGGDPTAATTNAR.R2
*rpal_wt_anaer_light_2_cleared_full.1512.1512.367.40150.4489962618.072618.911198.054.2%6K.EIGGHPLKVIVLDDGGDPTAATTNAR.R3
*rpal_wt_anaer_light_2_crude_2a.1144.1144.125.1410.3448871786.941786.941196.042.9%1K.VIVLDDGGDPTAATTNAR.R1
*rpal_wt_anaer_light_2_crude_3.1081.1081.284.65450.727711787.821786.941191.078.1%7K.VIVLDDGGDPTAATTNAR.R2
*rpal_wt_anaer_light_2_crude_full.2864.2864.359.42210.4304533963.873964.5812.047.8%6K.ADVIMGSSVTPPTVAVSNVANEAQVPHIALAPLPITPER.A3
*rpal_wt_anaer_light_2_pellet_5.1254.1254.148.83830.5609571754.191755.2199.066.7%4R.AKWSVAMPQPIPIMGK.V1
*rpal_wt_anaer_light_2_crude_full.1930.1930.258.74650.6215891754.681755.21183.064.3%7R.AKWSVAMPQPIPIMGK.V2
*rpal_wt_anaer_light_2_cleared_full.2099.2099.358.95240.4156341755.731755.21231.055.3%6R.AKWSVAMPQPIPIMGK.V3
*rpal_wt_anaer_light_2_crude_5.1280.1280.137.72060.4967261555.131555.951216.063.6%5K.WSVAMPQPIPIMGK.V1
*rpal_wt_anaer_light_2_cleared_full.2390.2390.249.99950.5815641555.931555.951151.064.0%7K.WSVAMPQPIPIMGK.V2
*rpal_wt_anaer_light_2_cleared_3.441.441.127.30110.173682920.97920.121216.063.6%1K.VLYEHMK.K1
*rpal_wt_anaer_light_2_cleared_4.2705.2705.245.23770.5547982443.882442.691104.043.2%2K.TVGYIGYSDSYGDLWFNDLKK.Q2
*rpal_wt_anaer_light_2_cleared_2a.1220.1220.134.3180.3627021488.961489.72124.059.1%5R.FARPDTSVAGQVLK.L1
*rpal_wt_anaer_light_2_cleared_2.1361.1361.262.70090.6090981489.681489.721254.073.1%10R.FARPDTSVAGQVLK.L2
*rpal_wt_anaer_light_2_cleared_1a.1343.1343.357.48890.3445221490.731489.721240.061.4%6R.FARPDTSVAGQVLK.L3
*rpal_wt_anaer_light_2_crude_full.2439.2439.283.26350.726312478.022478.851178.056.5%14K.LVAANPDAILVGASGTAAALPQTSLR.E2
*rpal_wt_anaer_light_2_crude_2.2755.2755.366.17350.4408112478.452478.851214.058.4%7K.LVAANPDAILVGASGTAAALPQTSLR.E3
*rpal_wt_anaer_light_2_cleared_3.1872.1872.266.3180.6823162130.032129.45192.064.7%3R.GYKGLIYQTHGAASMDFIR.I2
*rpal_wt_anaer_light_2_cleared_3.1922.1922.234.55970.09527571780.511781.0416.048.3%2K.GLIYQTHGAASMDFIR.I2
*rpal_wt_anaer_light_2_cleared_4.2132.2132.251.38960.6710522507.912506.771234.048.8%2K.SAEGVLMASGPVMDPEGQDDSALTK.K2
*rpal_wt_anaer_light_2_cleared_full.2174.2174.352.63630.3346093922.853922.381154.045.2%4K.SAEGVLMASGPVMDPEGQDDSALTKKPGLELNTAYEAK.Y3
*rpal_wt_anaer_light_2_cleared_4.982.982.125.76690.458131433.911434.631205.052.6%1K.KPGLELNTAYEAK.Y1
*rpal_wt_anaer_light_2_cleared_4.1253.1253.143.94310.5436421355.81356.481212.066.7%7R.SQFAAHSFDAFK.V1
*rpal_wt_anaer_light_2_crude_full.1017.1017.258.18130.6769481356.091356.481159.072.7%5R.SQFAAHSFDAFK.V2
*rpal_wt_anaer_light_2_cleared_3.2055.2055.254.75720.6037731854.381854.081184.058.6%1R.SQFAAHSFDAFKVLER.V2
*rpal_wt_anaer_light_2_cleared_1a.1154.1154.346.40130.3943661842.641842.19176.049.0%1R.VVPVALKTAKPGTQEFR.E3
*rpal_wt_anaer_light_2_crude_2a.1815.1815.253.20590.6538622388.22388.591140.051.3%2K.ALVSEKDIAASQGVYSFTETDR.Y2
*rpal_wt_anaer_light_2_cleared_3.2288.2288.346.89290.2937163108.473108.35116.042.7%1K.ALVSEKDIAASQGVYSFTETDRYGLDDR.S3
*rpal_wt_anaer_light_2_cleared_3.592.592.126.61820.295463986.84987.229180.071.4%2R.ILLTVKDGK.Y1
*rpal_wt_anaer_light_2_cleared_5.989.989.125.93550.4142551607.111608.041184.052.4%1R.ILLTVKDGKYVMVK.-1
*rpal_wt_anaer_light_2_cleared_3.419.419.136.62030.414098939.73940.1511213.083.3%1K.DGKYVMVK.-1

URPA14283712075.1%257278138.2RPA1428 possible lipoprotein 1582970:1583743 forward MW:27813
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_cleared_2a.1516.1516.146.05140.3813541604.851605.881225.068.2%4R.VGVTAGPHAEILDVVK.K1
*rpal_wt_anaer_light_2_crude_2.1515.1515.260.96580.6636461606.81605.881225.065.5%6R.VGVTAGPHAEILDVVK.K2
*rpal_wt_anaer_light_2_cleared_full.1499.1499.348.28060.3379581606.91605.881248.052.0%1R.VGVTAGPHAEILDVVK.K3
*rpal_wt_anaer_light_2_crude_5.764.764.145.29470.4996741733.131734.051240.062.5%3R.VGVTAGPHAEILDVVKK.V1
*rpal_wt_anaer_light_2_cleared_2.1431.1431.260.78780.5734571735.551734.051210.063.3%6R.VGVTAGPHAEILDVVKK.V2
*rpal_wt_anaer_light_2_crude_full.2080.2080.256.44960.6410622432.112432.781153.059.0%7R.GLDVKPVEFTDYVVPNQALAQK.E2
*rpal_wt_anaer_light_2_crude_2.2309.2309.359.89650.413542433.082432.781247.054.5%1R.GLDVKPVEFTDYVVPNQALAQK.E3
*rpal_wt_anaer_light_2_crude_full.2449.2449.354.86890.3327044120.134119.6216.050.6%5R.GLDVKPVEFTDYVVPNQALAQKELEANSFQHEPYLK.A3
*rpal_wt_anaer_light_2_cleared_2a.2551.2551.349.10430.3658444616.294617.22149.047.6%1R.GLDVKPVEFTDYVVPNQALAQKELEANSFQHEPYLKAQVAK.T3
*rpal_wt_anaer_light_2_crude_2.1118.1118.239.48530.5034461706.461705.86176.052.0%2K.ELEANSFQHEPYLK.A2
*rpal_wt_anaer_light_2_cleared_full.1138.1138.136.92940.32021533.71534.751172.069.6%6K.VANTIASPQGVYSVK.V1
*rpal_wt_anaer_light_2_cleared_2.1307.1307.242.78120.3815931534.451534.751184.059.3%2K.VANTIASPQGVYSVK.V2
*rpal_wt_anaer_light_2_crude_1.1072.1072.346.99920.4399051535.741534.751122.055.6%1K.VANTIASPQGVYSVK.V3
*rpal_wt_anaer_light_2_cleared_2.553.553.125.59950.145284857.68858.07188.066.7%1K.VKALADLK.Q1
*rpal_wt_anaer_light_2_cleared_4.1467.1467.237.43220.5053112382.652381.7121.038.1%1K.VKALADLKQGATVAIANDPSNGAR.G2
*2rpal_wt_anaer_light_2_cleared_1a.370.370.128.5710.168454630.52630.7631216.080.0%1K.ALADLK.Q1
*rpal_wt_anaer_light_2_cleared_3.1419.1419.265.45230.6549122154.222154.391176.063.2%2K.ALADLKQGATVAIANDPSNGAR.G2
*rpal_wt_anaer_light_2_cleared_2.1471.1471.353.68960.4070082155.722154.391252.046.0%1K.ALADLKQGATVAIANDPSNGAR.G3
*rpal_wt_anaer_light_2_cleared_2.616.616.239.19910.3983611542.491542.651106.041.4%1K.QGATVAIANDPSNGAR.G2
*rpal_wt_anaer_light_2_cleared_full.2179.2179.144.57220.4912731275.721276.611218.073.7%9R.GLQILALHGLIK.L1
*rpal_wt_anaer_light_2_cleared_1a.2373.2373.265.13740.6374451276.811276.611241.085.7%6R.GLQILALHGLIK.L2
*rpal_wt_anaer_light_2_crude_1.2334.2334.350.29490.4884371277.241276.611166.060.0%3R.GLQILALHGLIK.L3
*rpal_wt_anaer_light_2_crude_full.1547.1547.365.32410.4802241898.971899.151255.057.1%5K.LKDGVGATATVADIIDNPK.K3
*rpal_wt_anaer_light_2_crude_5.956.956.142.59620.338421899.121899.151208.058.6%1K.LKDGVGATATVADIIDNPK.K1
*rpal_wt_anaer_light_2_crude_3.1642.1642.294.12730.7299471900.241899.15195.082.4%5K.LKDGVGATATVADIIDNPK.K2
*rpal_wt_anaer_light_2_crude_3.1358.1358.265.20560.6324062028.552027.33157.057.1%3K.LKDGVGATATVADIIDNPKK.L2
*rpal_wt_anaer_light_2_cleared_2a.1591.1591.267.1860.6680362269.052268.661102.060.0%3K.LKDGVGATATVADIIDNPKKLK.F2
*rpal_wt_anaer_light_2_cleared_2.1756.1756.362.60560.50842269.52268.661214.049.3%3K.LKDGVGATATVADIIDNPKKLK.F3
*rpal_wt_anaer_light_2_crude_full.1446.1446.137.4740.4789161259.661259.451163.077.8%6K.FVELDAAQLPR.S1
*rpal_wt_anaer_light_2_cleared_1a.1758.1758.271.41210.6732351260.761259.451255.080.0%5K.FVELDAAQLPR.S2
*rpal_wt_anaer_light_2_crude_2.2498.2498.261.84490.6102771595.971596.831228.069.2%5R.ENVEGPWVNIIAVR.E2
*rpal_wt_anaer_light_2_cleared_4.405.405.132.63290.4114311275.691274.421180.073.3%1R.EEDKDKPWVK.Q1
*rpal_wt_anaer_light_2_crude_4.576.576.126.49810.4243781386.831386.55133.061.1%1K.QLIDAYHSDPVK.Q1
*rpal_wt_anaer_light_2_cleared_3.1784.1784.238.91130.6209432146.752147.4132.043.8%5K.QLIDAYHSDPVKQFVETR.F2
*rpal_wt_anaer_light_2_crude_2.1626.1626.349.09310.4590522147.882147.41104.053.8%2K.QLIDAYHSDPVKQFVETR.F3
*rpal_wt_anaer_light_2_crude_3.1656.1656.126.1650.351421082.721083.271146.069.2%1R.FKGTYIPAW.-1
*rpal_wt_anaer_light_2_crude_1.1811.1811.240.32190.3407111083.241083.271215.066.7%4R.FKGTYIPAW.-2

URPA0610164574.9%255275745.6RPA0610 putative glyoxalase II 678565:679332 forward MW:27574
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_cleared_4.3759.3759.346.5480.393694355.14353.94127.048.4%2R.IVPCLTDNFGYLVHDPATGATASIDAPEAAPLIAALDKEGWK.L3
*rpal_wt_anaer_light_2_crude_3.1091.1091.239.63180.5440152263.352263.5610.042.1%1K.LTDILVTHHHGDHVGGIAELK.K2
*rpal_wt_anaer_light_2_cleared_3.329.329.133.45070.5315851059.651060.161120.068.8%1R.VHAPHDANAK.I1
*rpal_wt_anaer_light_2_crude_2.2040.2040.359.56480.4559072330.632330.521187.050.8%3R.VLETPGHTLDHLSYVFDDDR.A3
*rpal_wt_anaer_light_2_crude_3.1963.1963.258.68310.621592330.742330.521146.055.6%3R.VLETPGHTLDHLSYVFDDDR.A2
*rpal_wt_anaer_light_2_crude_2a.3166.3166.128.33080.3816661830.581832.191168.054.5%3R.VFEGTYPMMWESLLK.L1
*rpal_wt_anaer_light_2_crude_1a.3304.3304.261.31990.7032381831.391832.191154.074.1%6R.VFEGTYPMMWESLLK.L2
*rpal_wt_anaer_light_2_cleared_3.1763.1763.233.7260.4897112272.212272.5411.040.0%1R.ALPDDFKLYCGHEYTASNVK.F2
*rpal_wt_anaer_light_2_cleared_2.638.638.234.94590.1422311484.631485.6614.050.0%1K.LYCGHEYTASNVK.F2
*rpal_wt_anaer_light_2_cleared_2a.1828.1828.136.86620.4109861585.91586.791194.065.2%2K.FALGIEPDNAALQAR.A1
*rpal_wt_anaer_light_2_crude_1a.1907.1907.265.56210.5112681585.941586.791228.077.8%7K.FALGIEPDNAALQAR.A2
*rpal_wt_anaer_light_2_cleared_2a.1218.1218.250.01050.572162481.442481.851220.046.3%4R.AKQVESLRAEGKPTIPVTLGEEK.Q2
*rpal_wt_anaer_light_2_cleared_full.1189.1189.347.63430.2238142483.162481.85173.047.0%1R.AKQVESLRAEGKPTIPVTLGEEK.Q3
*rpal_wt_anaer_light_2_cleared_5.873.873.138.22650.5098691569.31569.81204.063.6%2R.AEGKPTIPVTLGEEK.Q1
*rpal_wt_anaer_light_2_crude_1a.960.960.233.81450.5186151570.421569.81168.051.9%3R.AEGKPTIPVTLGEEK.Q2
*rpal_wt_anaer_light_2_crude_full.2745.2745.240.80190.5945732382.022383.73172.035.6%5R.ADVPSVAAAVGMPGAPAAEVFGEIR.E2

URPA061682874.5%106111885.5RPA0616 Uncharacterized BCR 684542:684862 forward MW:11188
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_pellet_3.1184.1184.125.33560.08621461041.761044.35132.064.3%1-.MADFLGMMK.Q1
*rpal_wt_anaer_light_2_crude_3.1374.1374.131.14550.397226912.53913.1481174.061.5%1M.ADFLGMMK.Q1
*rpal_wt_anaer_light_2_cleared_4.2790.2790.255.5530.556912407.662404.81193.048.8%1K.MKAMQAELDQIEVEGLSGGGLVK.V2
*rpal_wt_anaer_light_2_crude_full.2481.2481.277.07610.5964472145.062145.441253.060.5%5K.AMQAELDQIEVEGLSGGGLVK.V2
*rpal_wt_anaer_light_2_cleared_full.1579.1579.128.69130.3722451042.571043.251170.060.0%5R.GISIDPSLIK.A1
*rpal_wt_anaer_light_2_cleared_full.1583.1583.237.0930.4182411044.051043.251209.061.1%3R.GISIDPSLIK.A2
*rpal_wt_anaer_light_2_crude_full.2091.2091.360.73570.4194242189.692189.35198.055.0%4K.ADEREVLEDLLAAAHGDAHR.K3
*rpal_wt_anaer_light_2_crude_full.2821.2821.156.45520.6875031551.711552.881197.069.2%8K.MQALTGGLGLPPGLGLG.-1

URPA45103714274.3%315328899.2RPA4510 conserved unknown protein 5091256:5092203 reverse MW:32889
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_2_cleared_3.507.507.136.19230.4355681118.61119.311138.068.8%1K.IYGEKIPNGK.A1
*rpal_wt_anaer_light_2_cleared_1.542.542.235.33610.531641119.411119.3118.066.7%1K.IYGEKIPNGK.A2
*rpal_wt_anaer_light_2_cleared_5.1103.1103.241.34560.4599963269.823269.73111.034.0%1K.IYGEKIPNGKAQVQATKASVENLNLLQQGR.G2
*rpal_wt_anaer_light_2_cleared_4.1625.1625.241.44530.5390382678.312679.0510.039.5%1K.IPNGKAQVQATKASVENLNLLQQGR.G2
*rpal_wt_anaer_light_2_cleared_full.1399.1399.391.66070.6255492170.52169.451239.067.2%8K.AQVQATKASVENLNLLQQGR.G3
*rpal_wt