DTASelect v1.9
/auto/gtl/ms/gtl_rpal/gtl_rpal_proteome/global_analysis/dbd_tryptic_1/wt_anaer_light_1
/auto/GAT/db/gtl/Rpal/rpal_3_plus_contams.fasta
DBDigger 1.05 in SQT format.

Jump to the summary table.

sequest.params modifications:
trueUse criteria
25.0Minimum +1 XCorr
30.0Minimum +2 XCorr
45.0Minimum +3 XCorr
0.08Minimum DeltCN
1Minimum charge state
3Maximum charge state
0.0Minimum ion proportion
1000Maximum Sp rank
-1.0Minimum Sp score
IncludeModified peptide inclusion
AnyTryptic status requirement
trueMultiple, ambiguous IDs allowed
IgnorePeptide validation handling
XCorrPurge duplicate peptides by protein
falseInclude only loci with unique peptide
falseRemove subset proteins
IgnoreLocus validation handling
0Minimum modified peptides per locus
10Minimum redundancy for low coverage loci
2Minimum peptides per locus

Locus Key:

Validation StatusLocusSequence CountSpectrum CountSequence CoverageLengthMolWtpIDescriptive Name

Similarity Key:

Locus# of identical peptides# of differing peptides

URPA01926023598.4%322339965.8mdh malate dehydrogenase 214807:215775 reverse MW:33996
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_pellet_2.3259.3259.357.1730.4940372391.132389.851174.049.4%1M.ARDKIALIGSGQIGGTLAHLVGLK.E3
*rpal_wt_anaer_light_1_crude_5.1906.1906.130.24380.3131981918.171919.321208.044.8%1K.IALIGSGQIGGTLAHLVGLK.E1
*rpal_wt_anaer_light_1_crude_full.3358.3358.261.1470.7003221919.411919.321157.055.6%6K.IALIGSGQIGGTLAHLVGLK.E2
*rpal_wt_anaer_light_1_pellet_1.4053.4053.351.28480.481491919.431919.321114.048.4%2K.IALIGSGQIGGTLAHLVGLK.E3
*rpal_wt_anaer_light_1_pellet_full.4467.4467.367.42950.5580263786.913787.44192.053.3%3K.IALIGSGQIGGTLAHLVGLKELGDVVLFDIAEGVPQGK.A3
*rpal_wt_anaer_light_1_pellet_1a.3490.3490.245.23920.151091886.591887.141160.053.1%1K.ELGDVVLFDIAEGVPQGK.A2
*rpal_wt_anaer_light_1_pellet_full.3075.3075.136.47560.453781886.751887.14174.063.0%1K.ELGDVVLFDIAEGVPQGK.A1
*rpal_wt_anaer_light_1_pellet_1a.3491.3491.353.69010.4737071887.821887.141176.054.4%1K.ELGDVVLFDIAEGVPQGK.A3
*rpal_wt_anaer_light_1_pellet_full.1903.1903.158.94920.7457291650.671651.771158.080.0%10K.ALDIAESSPVDGFDSK.L1
*rpal_wt_anaer_light_1_cleared_1a.1858.1858.284.3650.6255181651.081651.771253.082.1%9K.ALDIAESSPVDGFDSK.L2
*rpal_wt_anaer_light_1_pellet_5.1440.1440.239.92010.4854723084.83085.311197.034.6%1K.ALDIAESSPVDGFDSKLTGANSYEAIEGAR.V2
*rpal_wt_anaer_light_1_pellet_3.2629.2629.371.70670.53473086.673085.31152.056.5%3K.ALDIAESSPVDGFDSKLTGANSYEAIEGAR.V3
*rpal_wt_anaer_light_1_pellet_4.1502.1502.133.27180.5009591451.811452.56180.061.9%1K.LTGANSYEAIEGAR.V1
*rpal_wt_anaer_light_1_pellet_1.1765.1765.348.82640.3391691453.741452.5617.057.5%1K.LTGANSYEAIEGAR.V3
*rpal_wt_anaer_light_1_pellet_2.1581.1581.263.46620.6344341454.961452.561254.073.1%8K.LTGANSYEAIEGAR.V2
*rpal_wt_anaer_light_1_pellet_1.1726.1726.259.52260.4931591011.181011.251253.073.7%8R.VVIVTAGVPR.K2
*rpal_wt_anaer_light_1_pellet_3.2246.2246.347.60390.3120632681.042680.231247.044.9%1R.VVIVTAGVPRKPGMSRDDLLSINLK.V3
*rpal_wt_anaer_light_1_pellet_2a.1966.1966.139.37950.3996271030.981031.191172.085.7%3R.DDLLSINLK.V1
*rpal_wt_anaer_light_1_pellet_1.2640.2640.242.53580.4028471031.381031.191242.064.7%1R.DDLLSINLK.V2
*rpal_wt_anaer_light_1_pellet_3.756.756.129.20660.3215991159.651160.42196.061.1%3K.VMEQVGAGIKK.Y1
*rpal_wt_anaer_light_1_pellet_1.785.785.246.06040.4822821161.411160.421168.075.0%4K.VMEQVGAGIKK.Y2
*rpal_wt_anaer_light_1_pellet_2a.4274.4274.252.86660.630262707.12709.251123.044.2%1K.KYAPDAFVICITNPLDAMVWALQK.A2
*rpal_wt_anaer_light_1_pellet_1a.4898.4898.360.98190.5047122708.782709.25156.055.9%1K.KYAPDAFVICITNPLDAMVWALQK.A3
*rpal_wt_anaer_light_1_pellet_2.5249.5249.368.73970.5080752580.192581.071243.055.9%3K.YAPDAFVICITNPLDAMVWALQK.A3
*rpal_wt_anaer_light_1_pellet_full.4698.4698.273.15770.7211652581.122581.071216.058.5%4K.YAPDAFVICITNPLDAMVWALQK.A2
*rpal_wt_anaer_light_1_cleared_3.1640.1640.264.11840.7119361927.731928.311184.060.0%4K.ASGLPAKKVVGMAGVLDSAR.F2
*rpal_wt_anaer_light_1_cleared_1a.1667.1667.347.13540.3786351930.311928.311200.050.0%1K.ASGLPAKKVVGMAGVLDSAR.F3
*rpal_wt_anaer_light_1_cleared_1a.1309.1309.251.58040.4926331303.451303.571244.062.5%2K.KVVGMAGVLDSAR.F2
*rpal_wt_anaer_light_1_pellet_2a.1532.1532.133.7770.4040231174.971175.39180.057.9%2K.VVGMAGVLDSAR.F1
*rpal_wt_anaer_light_1_pellet_1a.1961.1961.269.02770.5591571175.951175.391254.082.6%8K.VVGMAGVLDSAR.F2
*rpal_wt_anaer_light_1_pellet_full.4773.4773.358.76730.4487333370.563371.831241.049.4%7R.YFLADEFNVSVEDVTAFVLGGHGDTMVPLVK.Y3
*rpal_wt_anaer_light_1_pellet_full.2702.2702.252.92360.6942381473.591473.751154.061.5%15K.YSTVAGIPLPDLVK.M2
*rpal_wt_anaer_light_1_pellet_4.2779.2779.147.58860.5902571475.831473.751188.072.7%16K.YSTVAGIPLPDLVK.M1
*rpal_wt_anaer_light_1_pellet_full.560.560.241.02390.297939937.65937.0671240.073.3%2K.MGWTSQAR.L2
*rpal_wt_anaer_light_1_crude_2.692.692.125.95930.238292859.58859.9551152.072.7%1R.LDEIVDR.T1
*rpal_wt_anaer_light_1_pellet_full.609.609.244.96120.35818861.23859.9551252.084.6%4R.LDEIVDR.T2
*rpal_wt_anaer_light_1_cleared_3.1890.1890.134.31540.5173191127.711128.31116.068.8%8R.NGGAEIVNLLK.T1
*rpal_wt_anaer_light_1_pellet_full.2020.2020.269.87670.5814031128.541128.311250.090.0%6R.NGGAEIVNLLK.T2
*rpal_wt_anaer_light_1_cleared_3.3873.3873.263.24570.6694452136.62137.421146.059.5%9K.TGSAFYAPASSAIAMAESYLK.D2
*rpal_wt_anaer_light_1_pellet_1a.4094.4094.376.00570.5370412137.022137.421231.050.0%3K.TGSAFYAPASSAIAMAESYLK.D3
*rpal_wt_anaer_light_1_cleared_full.3248.3248.254.58090.6089162379.922380.681155.050.0%11K.TGSAFYAPASSAIAMAESYLKDK.K2
*rpal_wt_anaer_light_1_pellet_1a.3878.3878.345.23380.2341192381.772380.681170.037.7%1K.TGSAFYAPASSAIAMAESYLKDK.K3
*rpal_wt_anaer_light_1_crude_4.3296.3296.236.02290.4249462508.492508.851128.035.7%2K.TGSAFYAPASSAIAMAESYLKDKK.R2
*rpal_wt_anaer_light_1_pellet_2.3323.3323.346.630.3129962665.012665.041225.037.3%1K.TGSAFYAPASSAIAMAESYLKDKKR.V3
*rpal_wt_anaer_light_1_pellet_2a.2803.2803.249.77780.561572665.442665.041169.043.2%5K.TGSAFYAPASSAIAMAESYLKDKKR.V2
*rpal_wt_anaer_light_1_crude_5.1073.1073.141.00570.5651991552.81553.81212.061.9%1R.VVPVAAHLNGEYGVK.D1
*rpal_wt_anaer_light_1_crude_1a.1644.1644.259.87320.7443681554.21553.8186.072.0%2R.VVPVAAHLNGEYGVK.D2
*rpal_wt_anaer_light_1_pellet_4.2248.2248.153.35350.6237141390.731392.661233.085.7%5K.DMYVGVPVVIGDK.G1
*rpal_wt_anaer_light_1_pellet_5.1250.1250.130.40620.5005721832.871834.151134.053.8%1K.DMYVGVPVVIGDKGVER.I1
*rpal_wt_anaer_light_1_crude_3.2121.2121.250.19110.6105431835.551834.151163.058.1%7K.DMYVGVPVVIGDKGVER.I2
*rpal_wt_anaer_light_1_crude_3.1434.1434.129.29380.348985971.74972.17116.078.6%1R.IVEIELAGK.D1
*rpal_wt_anaer_light_1_pellet_1.2005.2005.359.16420.5084111834.011834.081142.060.0%2R.IVEIELAGKDKEAFDR.S3
*rpal_wt_anaer_light_1_pellet_3.1645.1645.267.02410.6502381834.111834.081248.075.9%2R.IVEIELAGKDKEAFDR.S2
*rpal_wt_anaer_light_1_crude_full.1920.1920.134.77160.5410131274.551275.51149.068.4%2R.SVAAVQGLVEACK.K1
*rpal_wt_anaer_light_1_pellet_1a.2386.2386.267.65430.7529161275.341275.511199.079.2%4R.SVAAVQGLVEACK.K2
*rpal_wt_anaer_light_1_pellet_2a.1596.1596.136.37220.5136071402.861403.691130.071.4%4R.SVAAVQGLVEACKK.I1
*rpal_wt_anaer_light_1_pellet_full.1747.1747.259.18080.6556011403.521403.691196.072.0%7R.SVAAVQGLVEACKK.I2
*rpal_wt_anaer_light_1_crude_3.1087.1087.128.74820.284286982.89983.21147.064.3%1K.KIAPDLLGR.-1
*rpal_wt_anaer_light_1_cleared_1a.1173.1173.127.51940.416859854.58855.0261138.075.0%5K.IAPDLLGR.-1
*rpal_wt_anaer_light_1_cleared_full.1030.1030.237.50590.347404855.1855.026182.073.3%5K.IAPDLLGR.-2

URPA2604257593.5%155169265.9RPA2604 peptidyl prolyl cis-trans isomerase 2961628:2962095 forward MW:16926
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_cleared_3.2089.2089.260.43170.6231981846.321846.051246.066.7%2M.ADNDNILILETTQGTVK.I2
*rpal_wt_anaer_light_1_cleared_2a.925.925.125.48580.3488771618.891619.89117.050.0%1K.IEMRPDLAPNHVAR.I1
*rpal_wt_anaer_light_1_crude_2.1241.1241.239.66080.5016061619.751619.891104.050.0%7K.IEMRPDLAPNHVAR.I2
*rpal_wt_anaer_light_1_cleared_1.1188.1188.370.50510.5643021620.521619.891246.064.4%5K.IEMRPDLAPNHVAR.I3
*rpal_wt_anaer_light_1_cleared_full.412.412.136.96410.261838757.87757.9521104.0100.0%1R.IKELVR.E1
*rpal_wt_anaer_light_1_crude_full.1662.1662.131.0470.3602091339.621340.481170.058.8%2R.EGFYDGIVFHR.V1
*rpal_wt_anaer_light_1_cleared_1a.1711.1711.239.82110.5415851340.431340.481120.063.2%5R.EGFYDGIVFHR.V2
*rpal_wt_anaer_light_1_cleared_full.1556.1556.263.87140.6634172114.52114.43161.059.0%4R.VIEGFMAQTGCPQGTGMGGSGK.K2
*rpal_wt_anaer_light_1_cleared_3.1484.1484.249.34040.6400562242.642242.61224.045.2%3R.VIEGFMAQTGCPQGTGMGGSGKK.L2
*rpal_wt_anaer_light_1_cleared_2.1527.1527.352.28040.1990732245.182242.61189.047.1%3R.VIEGFMAQTGCPQGTGMGGSGKK.L3
*rpal_wt_anaer_light_1_cleared_1a.867.867.235.01860.4410571411.951411.61156.050.0%1K.LKAEFNAEPHVR.G2
*rpal_wt_anaer_light_1_cleared_1a.858.858.360.68360.5419721412.61411.61211.072.2%3K.LKAEFNAEPHVR.G3
*rpal_wt_anaer_light_1_crude_1a.1004.1004.245.45430.5922431170.141170.271196.068.4%5K.AEFNAEPHVR.G2
*rpal_wt_anaer_light_1_crude_2.522.522.125.22130.288193691.76691.829164.081.8%1R.GVASMAR.A1
*rpal_wt_anaer_light_1_cleared_2a.2387.2387.257.29650.6165732076.852077.19184.060.6%2R.AANPDSGDSQFFICFDDAR.F2
*rpal_wt_anaer_light_1_cleared_2a.1269.1269.145.87950.6163711385.761385.611202.087.5%6R.FLDKQYTVWGK.V1
*rpal_wt_anaer_light_1_cleared_full.1284.1284.261.56350.6688851385.951385.611250.085.0%5R.FLDKQYTVWGK.V2
*rpal_wt_anaer_light_1_cleared_1.1607.1607.357.69450.504411388.11385.611138.073.5%2R.FLDKQYTVWGK.V3
*rpal_wt_anaer_light_1_cleared_3.2992.2992.351.05470.3867362742.82742.211100.058.7%1R.FLDKQYTVWGKVIEGMENVDKIK.R3
*rpal_wt_anaer_light_1_crude_1a.1289.1289.230.50270.08463191131.51134.3180.055.6%1K.VIEGMENVDK.I2
*rpal_wt_anaer_light_1_crude_2a.1048.1048.130.06930.4628711133.771134.31236.062.5%3K.VIEGMENVDK.I1
*rpal_wt_anaer_light_1_crude_4.1180.1180.131.90680.4267651374.721375.631139.055.6%3K.VIEGMENVDKIK.R1
*rpal_wt_anaer_light_1_cleared_1a.1192.1192.259.59230.6040091375.51375.63162.077.3%5K.VIEGMENVDKIK.R2
*rpal_wt_anaer_light_1_cleared_2a.368.368.131.47520.4250711480.921481.741200.065.0%3K.RGEPVKDPDKIVK.A1
*rpal_wt_anaer_light_1_crude_4.613.613.136.19970.3968041324.881325.551184.066.7%1R.GEPVKDPDKIVK.A1

URPA3875105491.8%98100924.4RPA3875 conserved unknown protein 4374071:4374367 forward MW:10092
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_cleared_3.1746.1746.252.99080.6037071893.891894.181195.054.8%6M.AVDGNWKLTMSTPMGER.Q2
*rpal_wt_anaer_light_1_cleared_1a.1776.1776.360.56480.5352881894.181894.18184.067.3%2M.AVDGNWKLTMSTPMGER.Q3
*rpal_wt_anaer_light_1_cleared_1a.1096.1096.234.9520.2146261125.01123.341212.052.6%4K.LTMSTPMGER.Q2
*rpal_wt_anaer_light_1_crude_5.1545.1545.255.38120.6888023159.583158.231191.037.0%2K.ADGSTLTGSQSADGDAGEIFDGTVNGDDVAWK.L2
*rpal_wt_anaer_light_1_cleared_5.1409.1409.138.14620.5628321736.041737.071201.058.3%9K.LSITNPMPLTLSYTGK.V1
*rpal_wt_anaer_light_1_crude_1.2940.2940.348.85340.4476971736.071737.071249.055.6%2K.LSITNPMPLTLSYTGK.V3
*rpal_wt_anaer_light_1_cleared_full.2311.2311.251.43830.6235351737.781737.071167.057.1%10K.LSITNPMPLTLSYTGK.V2
*rpal_wt_anaer_light_1_cleared_4.2855.2855.242.87640.5047112389.012388.681156.038.1%3K.VSGDSISGEMGIGPMGSFPFTGTR.A2
*rpal_wt_anaer_light_1_cleared_full.2648.2648.271.30330.6405782459.422459.761184.061.4%15K.VSGDSISGEMGIGPMGSFPFTGTRA.-2
*rpal_wt_anaer_light_1_cleared_1a.2947.2947.353.25030.4351172460.52459.76149.046.7%1K.VSGDSISGEMGIGPMGSFPFTGTRA.-3

URPA3501166891.3%92101838.6RPA3501 conserved unknown protein 3951527:3951805 forward MW:10182
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_pellet_2.619.619.129.97540.232861810.61810.9721193.076.9%3R.SIVVAGHK.T1
*rpal_wt_anaer_light_1_pellet_2a.3211.3211.378.11140.5416323065.793063.51118.062.7%4R.SIVVAGHKTSVSLEEAFWNGMKEISSVR.D3
*rpal_wt_anaer_light_1_pellet_5.1578.1578.135.40270.6230341599.731599.8146.060.0%2K.TSVSLEEAFWNGMK.E1
*rpal_wt_anaer_light_1_pellet_2.3070.3070.236.07120.5990541602.391599.81172.048.0%1K.TSVSLEEAFWNGMK.E2
*rpal_wt_anaer_light_1_crude_full.3650.3650.256.78830.6964182271.672271.561248.051.4%9K.TSVSLEEAFWNGMKEISSVR.D2
*rpal_wt_anaer_light_1_pellet_full.3642.3642.372.85620.6200022271.962271.561183.063.8%8K.TSVSLEEAFWNGMKEISSVR.D3
*rpal_wt_anaer_light_1_pellet_5.1752.1752.126.81880.451061678.941679.851137.052.4%1R.DMTLSELVGEIDSNR.Q1
*rpal_wt_anaer_light_1_pellet_full.3103.3103.255.88840.5928141679.811679.851229.064.0%5R.DMTLSELVGEIDSNR.Q2
*rpal_wt_anaer_light_1_pellet_1.3777.3777.362.05710.530371681.511679.851235.059.1%1R.DMTLSELVGEIDSNR.Q3
*rpal_wt_anaer_light_1_pellet_1a.3433.3433.386.21810.576242734.622735.011255.062.3%5R.DMTLSELVGEIDSNRQQGNLSSAIR.L3
*rpal_wt_anaer_light_1_cleared_1a.2826.2826.252.71880.4872361074.171073.281248.086.7%10R.LFVLDYFR.S2
*rpal_wt_anaer_light_1_pellet_2.892.892.255.31390.6231471615.461615.791149.064.3%1R.SRALQAQQQAVADTK.T2
*rpal_wt_anaer_light_1_pellet_full.593.593.143.07150.5613941371.641372.521212.073.7%4R.ALQAQQQAVADTK.T1
*rpal_wt_anaer_light_1_pellet_1.859.859.277.8080.7574631372.431372.521250.087.0%3R.ALQAQQQAVADTK.T2
*rpal_wt_anaer_light_1_pellet_2a.1211.1211.260.09030.6129742198.712199.381220.057.9%8R.ALQAQQQAVADTKTESSLTAH.-2
*rpal_wt_anaer_light_1_pellet_full.1347.1347.353.74460.3949332201.62199.381129.054.0%3R.ALQAQQQAVADTKTESSLTAH.-3

URPA2165207890.4%104111648.4groES2 chaperonin GroES2, cpn10 2439028:2439342 reverse MW:11164
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_crude_1a.1088.1088.241.87860.3628421186.131186.381152.070.6%6-.MNFRPLHDR.V2
rpal_wt_anaer_light_1_pellet_1a.430.430.128.98580.0937838600.94600.7831104.088.9%1R.VVVKR.I11
*rpal_wt_anaer_light_1_pellet_2a.1206.1206.144.22240.56531156.791157.351151.082.4%9K.TAGGIIIPDTAK.E1
*rpal_wt_anaer_light_1_crude_1a.1589.1589.245.24890.4526081156.981157.351187.063.6%7K.TAGGIIIPDTAK.E2
*rpal_wt_anaer_light_1_crude_2.850.850.241.6650.530981580.221581.7710.056.7%2K.EKPSQGEIVAVGPGGR.D2
*rpal_wt_anaer_light_1_crude_3.758.758.238.56630.5207162082.12082.2814.037.8%3K.EKPSQGEIVAVGPGGRDEAGK.L2
*rpal_wt_anaer_light_1_cleared_2.782.782.347.16490.3937462084.642082.281148.046.8%2K.EKPSQGEIVAVGPGGRDEAGK.L3
*rpal_wt_anaer_light_1_cleared_2a.1772.1772.234.51770.4022812874.372875.310.036.7%2K.EKPSQGEIVAVGPGGRDEAGKLIPIDLK.V2
*rpal_wt_anaer_light_1_cleared_full.1766.1766.355.10060.3640522877.032875.31152.044.2%4K.EKPSQGEIVAVGPGGRDEAGKLIPIDLK.V3
*rpal_wt_anaer_light_1_crude_1.2072.2072.233.17440.3075141313.771312.551116.054.5%1R.DEAGKLIPIDLK.V2
rpal_wt_anaer_light_1_cleared_1.919.919.244.04350.225241992.99991.1791236.070.6%1K.VGDRVLFGK.W22
*rpal_wt_anaer_light_1_cleared_3.1485.1485.244.83480.6389971779.921779.051136.057.1%1K.VGDRVLFGKWSGTEVK.I2
rpal_wt_anaer_light_1_pellet_1a.689.689.128.540.395673563.51563.7181231.087.5%7R.VLFGK.W11
*rpal_wt_anaer_light_1_cleared_4.1356.1356.130.69310.3650461350.831351.59152.061.1%2R.VLFGKWSGTEVK.I1
*rpal_wt_anaer_light_1_crude_full.1433.1433.133.63570.1815041159.651160.461229.073.3%5K.IDGKELLIMK.E1
*rpal_wt_anaer_light_1_crude_1.1711.1711.242.24710.4748521160.01160.4614.072.2%2K.IDGKELLIMK.E2
*rpal_wt_anaer_light_1_cleared_4.3128.3128.258.87170.6832312576.862577.081109.050.0%2K.IDGKELLIMKESDIMGVITDVGAK.K2
*rpal_wt_anaer_light_1_crude_full.1122.1122.138.16520.290752746.55746.9891211.090.0%3K.ELLIMK.E1
*rpal_wt_anaer_light_1_pellet_full.2303.2303.154.5490.6195481434.581435.641167.081.0%10K.ESDIMGVITDVGAK.K1
*rpal_wt_anaer_light_1_crude_full.2215.2215.272.06430.738511435.231435.641248.076.9%8K.ESDIMGVITDVGAK.K2
Similarities: RPA1141(3:17)

URPA32527764989.6%396433375.8tufA, EF-Tu elongation factor Tu 3659926:3661116 reverse MW:43337
URPA32837764989.6%396433375.8tuf, EF-Tu elongation factor Tu 3702061:3703251 reverse MW:43337
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
rpal_wt_anaer_light_1_cleared_5.579.579.138.55020.5664041814.011815.071192.057.7%3R.TKPHCNIGTIGHVDHGK.T1
rpal_wt_anaer_light_1_crude_1.605.605.345.89540.226671815.171815.071133.054.9%2R.TKPHCNIGTIGHVDHGK.T3
rpal_wt_anaer_light_1_cleared_3.625.625.252.18750.6337941816.581815.07126.060.0%3R.TKPHCNIGTIGHVDHGK.T2
rpal_wt_anaer_light_1_crude_full.1259.1259.240.54870.4221122700.932702.111192.039.1%3R.TKPHCNIGTIGHVDHGKTSLTAAITK.V2
rpal_wt_anaer_light_1_crude_full.1260.1260.348.25370.3700812701.272702.11145.048.0%4R.TKPHCNIGTIGHVDHGKTSLTAAITK.V3
rpal_wt_anaer_light_1_crude_full.857.857.135.40080.508209905.59906.068111.078.6%10K.TSLTAAITK.V1
rpal_wt_anaer_light_1_crude_full.844.844.252.29220.653491906.28906.0681154.088.2%12K.TSLTAAITK.V2
rpal_wt_anaer_light_1_crude_2a.1669.1669.250.19350.57362455.082455.68136.053.7%7K.VLAETGGATFTAYDQIDKAPEEK.A2
rpal_wt_anaer_light_1_pellet_2.2097.2097.357.5180.4332562455.092455.681216.048.6%2K.VLAETGGATFTAYDQIDKAPEEK.A3
rpal_wt_anaer_light_1_pellet_2a.1291.1291.150.5050.6252171818.861819.97164.082.6%9R.GITISTAHVEYETQNR.H1
rpal_wt_anaer_light_1_crude_full.1317.1317.267.99660.7231711819.71819.971237.069.0%10R.GITISTAHVEYETQNR.H2
rpal_wt_anaer_light_1_pellet_full.1425.1425.387.3370.6519971820.351819.971114.079.2%7R.GITISTAHVEYETQNR.H3
rpal_wt_anaer_light_1_cleared_3.1491.1491.353.22480.3917973513.283513.831160.050.6%2R.GITISTAHVEYETQNRHYAHVDCPGHADYVK.N3
rpal_wt_anaer_light_1_pellet_2a.715.715.157.27570.6818271711.721712.891173.083.3%6R.HYAHVDCPGHADYVK.N1
rpal_wt_anaer_light_1_cleared_full.637.637.261.93130.7138461712.651712.89150.067.9%7R.HYAHVDCPGHADYVK.N2
rpal_wt_anaer_light_1_cleared_1.824.824.388.93360.6313231714.11712.891250.080.0%5R.HYAHVDCPGHADYVK.N3
rpal_wt_anaer_light_1_cleared_full.4686.4686.259.38690.6615362715.712717.161250.050.0%52K.NMITGAAQMDGAILVVSAADGPMPQTR.E2
rpal_wt_anaer_light_1_cleared_full.4890.4890.354.79890.3896962718.522717.161232.048.7%3K.NMITGAAQMDGAILVVSAADGPMPQTR.E3
rpal_wt_anaer_light_1_crude_full.513.513.138.99040.459513851.66852.0251213.0100.0%10R.EHILLAR.Q1
rpal_wt_anaer_light_1_pellet_full.569.569.239.05340.554264852.59852.025127.076.9%9R.EHILLAR.Q2
rpal_wt_anaer_light_1_crude_full.2848.2848.139.5810.5223241383.781384.71148.073.7%13R.QVGVPALVVFLNK.C1
rpal_wt_anaer_light_1_pellet_1.3563.3563.365.57950.5947321384.521384.711253.067.6%1R.QVGVPALVVFLNK.C3
rpal_wt_anaer_light_1_pellet_2.3263.3263.245.92050.5845691384.711384.71169.070.8%20R.QVGVPALVVFLNK.C2
rpal_wt_anaer_light_1_cleared_3.5050.5050.347.93210.2186973503.133502.151108.038.5%1R.QVGVPALVVFLNKCDMVDDPELLELVEMEVR.E3
rpal_wt_anaer_light_1_pellet_full.3573.3573.284.38050.7242722135.82136.471251.071.9%3K.CDMVDDPELLELVEMEVR.E2
rpal_wt_anaer_light_1_crude_1.475.475.130.92980.19133587.43589.711217.087.5%9R.ELLSK.Y1
rpal_wt_anaer_light_1_cleared_2a.2234.2234.134.4720.5652441948.931950.241152.056.0%4R.ELLSKYDFPGDDIPIVK.G1
rpal_wt_anaer_light_1_crude_3.2609.2609.271.77010.6670231950.41950.241205.073.3%14R.ELLSKYDFPGDDIPIVK.G2
rpal_wt_anaer_light_1_pellet_1a.2835.2835.352.5760.4491361951.891950.241151.053.7%4R.ELLSKYDFPGDDIPIVK.G3
rpal_wt_anaer_light_1_cleared_2a.2764.2764.232.88470.4920013176.933178.56176.026.9%1R.ELLSKYDFPGDDIPIVKGSALAALENSDAK.L2
rpal_wt_anaer_light_1_cleared_full.2728.2728.363.94720.4880313178.063178.561253.048.1%6R.ELLSKYDFPGDDIPIVKGSALAALENSDAK.L3
rpal_wt_anaer_light_1_pellet_2a.2076.2076.143.92880.5905211378.791379.551191.068.4%27K.YDFPGDDIPIVK.G1
rpal_wt_anaer_light_1_pellet_1.2765.2765.257.84280.5547121380.491379.551143.081.8%31K.YDFPGDDIPIVK.G2
rpal_wt_anaer_light_1_cleared_4.2922.2922.258.65030.6414372607.12607.88172.053.3%6K.YDFPGDDIPIVKGSALAALENSDAK.L2
rpal_wt_anaer_light_1_cleared_full.2688.2688.346.43730.1609072608.972607.881162.042.1%2K.YDFPGDDIPIVKGSALAALENSDAK.L3
rpal_wt_anaer_light_1_crude_full.1232.1232.153.48270.6722731246.571247.351117.078.9%18K.GSALAALENSDAK.L1
rpal_wt_anaer_light_1_cleared_full.1105.1105.272.50340.6794341247.331247.351255.082.6%11K.GSALAALENSDAK.L2
rpal_wt_anaer_light_1_pellet_full.3152.3152.269.98170.7337632496.932496.851188.054.8%12K.GSALAALENSDAKLGHDAILELMR.Q2
rpal_wt_anaer_light_1_cleared_full.2908.2908.370.07830.528382497.292496.851214.055.6%10K.GSALAALENSDAKLGHDAILELMR.Q3
rpal_wt_anaer_light_1_pellet_4.2074.2074.153.11650.4125591267.981268.521179.088.2%21K.LGHDAILELMR.Q1
rpal_wt_anaer_light_1_cleared_1.2036.2036.265.82350.6379141268.471268.521124.089.5%18K.LGHDAILELMR.Q2
rpal_wt_anaer_light_1_crude_full.1812.1812.358.41580.3419541268.941268.521180.068.8%12K.LGHDAILELMR.Q3
rpal_wt_anaer_light_1_pellet_full.3472.3472.365.38840.5186823445.283445.921174.052.6%12R.QVDAYIPQPERPIDQPFLMPVEDVFSISGR.G3
rpal_wt_anaer_light_1_cleared_5.1868.1868.235.8660.4941873448.723445.9214.028.8%3R.QVDAYIPQPERPIDQPFLMPVEDVFSISGR.G2
rpal_wt_anaer_light_1_pellet_3.2267.2267.248.88760.6549662084.02084.42117.051.5%3R.GILKVGDEIEIVGIRDTQK.T2
rpal_wt_anaer_light_1_pellet_2a.1728.1728.139.10.3911691199.81200.381188.070.6%13K.VGDEIEIVGIR.D1
rpal_wt_anaer_light_1_crude_1a.2163.2163.268.62240.5769971199.831200.381255.090.0%6K.VGDEIEIVGIR.D2
rpal_wt_anaer_light_1_pellet_5.1062.1062.144.92850.4798781671.831672.88124.069.6%6K.VGDEIEIVGIRDTQK.T1
rpal_wt_anaer_light_1_crude_1a.1838.1838.267.57790.6675971672.611672.881231.070.4%12K.VGDEIEIVGIRDTQK.T2
rpal_wt_anaer_light_1_pellet_full.1589.1589.355.8080.3912591675.521672.881249.054.2%4K.VGDEIEIVGIRDTQK.T3
rpal_wt_anaer_light_1_pellet_3.2520.2520.354.20480.3312662799.272799.21252.055.7%1K.VGDEIEIVGIRDTQKTTCTGVEMFR.K3
rpal_wt_anaer_light_1_cleared_1a.2181.2181.377.93540.5094042926.952927.371107.061.4%5K.VGDEIEIVGIRDTQKTTCTGVEMFRK.L3
rpal_wt_anaer_light_1_cleared_1.1106.1106.346.48190.3676031746.061746.021232.055.3%1R.DTQKTTCTGVEMFRK.L3
rpal_wt_anaer_light_1_pellet_1.1854.1854.243.58970.4353671144.781145.341144.068.4%3K.TTCTGVEMFR.K2
rpal_wt_anaer_light_1_crude_1.1110.1110.242.02830.5708841273.241273.521156.060.0%3K.TTCTGVEMFRK.L2
rpal_wt_anaer_light_1_pellet_2a.1928.1928.136.35050.5346941781.951783.04197.061.5%5R.KLLDQGQAGDNIGALLR.G1
rpal_wt_anaer_light_1_cleared_full.1796.1796.287.95760.7230921782.51783.041254.083.9%15R.KLLDQGQAGDNIGALLR.G2
rpal_wt_anaer_light_1_pellet_1.2605.2605.371.73630.5252751783.211783.041200.064.3%8R.KLLDQGQAGDNIGALLR.G3
rpal_wt_anaer_light_1_cleared_full.1705.1705.345.99040.3436332071.22069.371104.040.3%1R.KLLDQGQAGDNIGALLRGTK.R3
rpal_wt_anaer_light_1_pellet_5.1380.1380.133.29770.4298861654.021654.86196.058.3%7K.LLDQGQAGDNIGALLR.G1
rpal_wt_anaer_light_1_cleared_1a.2288.2288.371.09850.537931655.461654.861223.058.9%6K.LLDQGQAGDNIGALLR.G3
rpal_wt_anaer_light_1_cleared_full.2048.2048.279.27630.7048581655.591654.861233.075.9%20K.LLDQGQAGDNIGALLR.G2
rpal_wt_anaer_light_1_cleared_full.1893.1893.256.50890.6834661940.381941.2167.061.8%3K.LLDQGQAGDNIGALLRGTK.R2
rpal_wt_anaer_light_1_cleared_full.1894.1894.345.1230.3223681940.51941.21179.046.6%1K.LLDQGQAGDNIGALLRGTK.R3
rpal_wt_anaer_light_1_crude_1a.675.675.230.87220.3238971092.131090.18126.047.1%1R.GTKREDVER.G2
rpal_wt_anaer_light_1_cleared_4.631.631.231.54850.3715422650.542651.0712.032.6%1R.GTKREDVERGQVLCKPGSVKPHTK.F2
rpal_wt_anaer_light_1_cleared_3.692.692.231.06710.39952208.02208.5514.038.9%2R.EDVERGQVLCKPGSVKPHTK.F2
rpal_wt_anaer_light_1_cleared_2a.369.369.146.98820.5820311578.831579.91182.069.6%8R.GQVLCKPGSVKPHTK.F1
rpal_wt_anaer_light_1_crude_2.590.590.253.67780.6327871582.041579.911172.063.0%7R.GQVLCKPGSVKPHTK.F2
rpal_wt_anaer_light_1_pellet_full.1437.1437.139.60450.457191183.611184.421240.080.0%17K.FKAEAYILTK.E1
rpal_wt_anaer_light_1_pellet_1.1844.1844.258.11030.590721184.681184.421165.083.3%4K.FKAEAYILTK.E2
rpal_wt_anaer_light_1_crude_2.1503.1503.230.61690.1906721712.471712.9410.040.0%1K.FKAEAYILTKEEGGR.H2
rpal_wt_anaer_light_1_pellet_1a.1080.1080.236.2870.521234909.41909.0711201.073.3%2K.AEAYILTK.E2
rpal_wt_anaer_light_1_crude_3.817.817.134.51470.445158910.81909.0711156.083.3%5K.AEAYILTK.E1
rpal_wt_anaer_light_1_cleared_full.3529.3529.376.86770.5203634105.884105.81195.053.4%39R.TTDVTGVVHLPEGTEMVMPGDNIAMEVHLIVPIAMEEK.L3
rpal_wt_anaer_light_1_cleared_1a.461.461.129.00550.127203506.73506.626186.0100.0%4R.FAIR.E1
rpal_wt_anaer_light_1_cleared_1.3408.3408.245.11220.5374291101.261100.31250.059.1%10R.TVGAGVVAAIIE.-2

URPA40504117786.8%265299856.4RPA4050 unknown protein 4582156:4582953 forward MW:29985
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_crude_2.1795.1795.133.87540.146236875.58876.1051164.083.3%4R.EMLEILK.K1
*rpal_wt_anaer_light_1_pellet_1a.2008.2008.239.35680.0911787876.63876.1051148.071.4%4R.EMLEILK.K2
*rpal_wt_anaer_light_1_crude_3.1238.1238.134.21750.2862391005.691004.281176.083.3%5R.EMLEILKK.L1
*rpal_wt_anaer_light_1_crude_4.698.698.129.540.3470751249.881250.44124.064.7%1K.LRQEYGAVSVK.A1
*rpal_wt_anaer_light_1_pellet_full.654.654.256.01880.5249561250.41250.441243.080.0%5K.LRQEYGAVSVK.A2
*rpal_wt_anaer_light_1_pellet_1a.796.796.364.09680.2253671251.821250.441183.067.6%2K.LRQEYGAVSVK.A3
*rpal_wt_anaer_light_1_pellet_2a.1387.1387.129.45270.3563881736.771737.86167.052.4%1K.AEFEAEGTRTDELLR.L1
*rpal_wt_anaer_light_1_pellet_2.1762.1762.237.16920.367351739.791737.861192.044.4%7K.AEFEAEGTRTDELLR.L2
*rpal_wt_anaer_light_1_pellet_2.1246.1246.130.03980.0833561701.8700.8571178.090.0%2R.LIDLAR.R1
*rpal_wt_anaer_light_1_pellet_4.2047.2047.126.03110.3296861489.741490.72120.042.9%2K.IGGCEAVRDLIESK.Q1
*rpal_wt_anaer_light_1_crude_2.2093.2093.253.57150.5917011491.041490.721233.060.0%8K.IGGCEAVRDLIESK.Q2
*rpal_wt_anaer_light_1_pellet_1a.2271.2271.346.88870.4214231491.381490.721203.050.0%1K.IGGCEAVRDLIESK.Q3
*rpal_wt_anaer_light_1_pellet_full.412.412.139.30450.532015704.53704.7991158.090.0%5R.DLIESK.Q1
*rpal_wt_anaer_light_1_pellet_full.2950.2950.249.7650.6274632171.942172.551204.051.5%5K.QFGTEYIIAPMVETPYALK.K2
*rpal_wt_anaer_light_1_crude_full.2567.2567.246.14340.4641942299.962300.721164.047.2%5K.QFGTEYIIAPMVETPYALKK.F2
*rpal_wt_anaer_light_1_crude_full.2568.2568.350.56820.3456982300.22300.721117.045.9%4K.QFGTEYIIAPMVETPYALKK.F3
*rpal_wt_anaer_light_1_crude_1.442.442.130.24810.265279607.39607.7281235.087.5%4K.FIEAK.N1
*rpal_wt_anaer_light_1_pellet_full.3779.3779.361.71740.5082783812.363812.251187.048.1%1K.NKVYTQEQKEDTSFLFNLETITAFNNIDDMIK.V3
*rpal_wt_anaer_light_1_pellet_5.2035.2035.234.29360.5834033812.73812.25140.029.6%1K.NKVYTQEQKEDTSFLFNLETITAFNNIDDMIK.V2
*rpal_wt_anaer_light_1_pellet_4.4348.4348.230.72560.4303152692.032693.01146.034.1%1K.EDTSFLFNLETITAFNNIDDMIK.V2
*rpal_wt_anaer_light_1_cleared_2a.1378.1378.146.49820.617511496.871497.71167.069.6%10K.VGIGHDGVQGVVFGR.V1
*rpal_wt_anaer_light_1_pellet_1a.1964.1964.276.06960.7225121497.231497.71215.077.8%9K.VGIGHDGVQGVVFGR.V2
*rpal_wt_anaer_light_1_pellet_1.2154.2154.373.59690.5209611498.121497.71254.067.4%7K.VGIGHDGVQGVVFGR.V3
*rpal_wt_anaer_light_1_pellet_2a.452.452.126.91890.3853431188.831189.231168.061.1%1R.VDFAGSHGQDR.S1
*rpal_wt_anaer_light_1_pellet_1.605.605.256.14720.6132721189.371189.231108.076.2%4R.VDFAGSHGQDR.S2
*rpal_wt_anaer_light_1_crude_full.1817.1817.141.80740.6050751509.671510.681178.071.4%11R.SVIDSADVTNYVVK.T1
*rpal_wt_anaer_light_1_crude_full.1822.1822.283.08850.7148671510.521510.681216.088.0%10R.SVIDSADVTNYVVK.T2
*rpal_wt_anaer_light_1_pellet_1.2416.2416.362.81950.3553931512.061510.681241.061.4%1R.SVIDSADVTNYVVK.T3
*rpal_wt_anaer_light_1_pellet_4.2757.2757.241.79550.4948832498.292496.931218.040.5%1K.CKANNLELVVGGAVGIDSLPELKR.I2
*rpal_wt_anaer_light_1_crude_3.643.643.127.62810.362616896.88897.066185.069.2%4R.IASVHLTR.F1
*rpal_wt_anaer_light_1_pellet_full.549.549.244.09470.442765897.45897.0661100.073.3%4R.IASVHLTR.F2
*rpal_wt_anaer_light_1_pellet_2a.1276.1276.145.06240.3830781387.881388.611164.075.0%8R.KVIFGADALSNPR.M1
*rpal_wt_anaer_light_1_pellet_2.1636.1636.287.79580.6281051389.311388.611244.091.7%10R.KVIFGADALSNPR.M2
*rpal_wt_anaer_light_1_cleared_1.1421.1421.353.34890.3080161389.591388.611185.055.0%5R.KVIFGADALSNPR.M3
*rpal_wt_anaer_light_1_pellet_1.2130.2130.256.53420.5586281259.911260.441126.077.3%3K.VIFGADALSNPR.M2
*rpal_wt_anaer_light_1_crude_full.2892.2892.135.05540.5437991440.591441.67144.070.6%7R.NTVYFELQWLK.N1
*rpal_wt_anaer_light_1_pellet_1a.3301.3301.260.00240.6496761441.691441.671173.080.0%4R.NTVYFELQWLK.N2
*rpal_wt_anaer_light_1_cleared_3.959.959.255.7320.6261811885.591885.99137.064.3%1K.NKRDYYGEIQGEDAAR.I2
*rpal_wt_anaer_light_1_pellet_2a.1186.1186.130.19210.5437081486.591487.521134.057.1%2R.DYYGEIQGEDAAR.I1
*rpal_wt_anaer_light_1_pellet_1a.1553.1553.263.63480.6534541487.091487.521111.075.0%4R.DYYGEIQGEDAAR.I2
*rpal_wt_anaer_light_1_cleared_1.627.627.242.9370.275257906.35905.1061241.076.9%3R.IEMLDKR.W2

URPA091851086.7%7585689.1RPA0918 possible 50S ribosomal protein L31 1020328:1020555 reverse MW:8567
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_cleared_4.1888.1888.248.6440.5832742966.862968.34178.045.5%1-.MKTEIHPDYHTITVVMTDGTEYQTR.S2
*rpal_wt_anaer_light_1_cleared_full.1383.1383.246.94770.4761511916.481917.13174.056.7%2R.STWGKEGDKLNLDIDPK.S2
*rpal_wt_anaer_light_1_cleared_full.1055.1055.258.1810.6503051653.421653.8182.066.7%5K.SHPAWTGGTQQVLDR.G2
*rpal_wt_anaer_light_1_cleared_1.1327.1327.346.73310.3694771656.121653.817.053.3%1K.SHPAWTGGTQQVLDR.G3
*rpal_wt_anaer_light_1_cleared_3.781.781.126.06750.43209941.8942.1031201.075.0%1K.FSGFLKKD.-1

URPA4268289584.5%161173965.6RPA4268 peroxiredoxin-like protein 4816864:4817349 forward MW:17396
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_cleared_1a.1351.1351.241.71930.5008691616.721616.861192.056.0%4M.TIKVGDRLPDAQFR.V2
*rpal_wt_anaer_light_1_crude_full.1048.1048.237.05370.3978631274.651274.421199.052.6%4K.VGDRLPDAQFR.V2
*rpal_wt_anaer_light_1_cleared_1.1199.1199.357.48080.54681276.161274.421173.070.6%3K.VGDRLPDAQFR.V3
*rpal_wt_anaer_light_1_cleared_2a.532.532.134.18490.3774561105.781106.291197.075.0%7R.VMTEDGVQVK.T1
*rpal_wt_anaer_light_1_pellet_1a.905.905.237.68870.4840631107.531106.29188.072.2%3R.VMTEDGVQVK.T2
*rpal_wt_anaer_light_1_crude_2.759.759.129.21580.3165839.55839.92116.081.8%1K.TTDDIFK.G1
*rpal_wt_anaer_light_1_cleared_2a.420.420.143.95640.5698651024.751025.151233.078.6%2K.TTDDIFKGK.K1
*rpal_wt_anaer_light_1_cleared_3.511.511.144.64770.6137851152.661153.321199.086.7%2K.TTDDIFKGKK.V1
*rpal_wt_anaer_light_1_crude_2.1753.1753.244.81680.5241651763.21764.11176.051.6%2K.KVALFAVPGAYTGTCHK.M2
*rpal_wt_anaer_light_1_crude_1.1820.1820.352.93540.5138361764.261764.11240.051.9%1K.KVALFAVPGAYTGTCHK.M3
*rpal_wt_anaer_light_1_cleared_full.1586.1586.242.4620.2293321635.711635.931140.059.3%3K.VALFAVPGAYTGTCHK.M2
*rpal_wt_anaer_light_1_pellet_1.2401.2401.346.18730.3798881637.751635.931179.052.2%2K.VALFAVPGAYTGTCHK.M3
*rpal_wt_anaer_light_1_cleared_5.1088.1088.132.46340.3287091637.991635.931192.058.3%3K.VALFAVPGAYTGTCHK.M1
*rpal_wt_anaer_light_1_crude_2a.2445.2445.145.98640.6590141635.761637.021169.068.2%4K.MHLPSIFLNAYAMK.D1
*rpal_wt_anaer_light_1_crude_full.2645.2645.231.7570.4144251636.551637.021174.038.5%3K.MHLPSIFLNAYAMK.D2
*rpal_wt_anaer_light_1_crude_1.3106.3106.356.92090.4759521636.641637.021229.053.5%2K.MHLPSIFLNAYAMK.D3
*rpal_wt_anaer_light_1_cleared_1a.2378.2378.347.38010.3762281880.711880.281195.053.3%2K.MHLPSIFLNAYAMKDK.G3
*rpal_wt_anaer_light_1_crude_3.1903.1903.254.41910.6365892228.822228.341154.052.8%3R.DTDQRNEAIFLGDGNADFTK.A2
*rpal_wt_anaer_light_1_cleared_2.1807.1807.347.43330.3592622229.932228.341229.048.3%1R.DTDQRNEAIFLGDGNADFTK.A3
*rpal_wt_anaer_light_1_cleared_2a.1669.1669.137.13440.6006691611.641612.74145.060.9%2R.NEAIFLGDGNADFTK.A1
*rpal_wt_anaer_light_1_cleared_2.1927.1927.262.87980.6376181613.921612.741166.071.4%1R.NEAIFLGDGNADFTK.A2
*rpal_wt_anaer_light_1_crude_full.2047.2047.132.07550.5834451598.721599.831152.054.2%2K.AIGMEMDGSGFGLGTR.S1
*rpal_wt_anaer_light_1_cleared_1a.2106.2106.278.99590.7827751599.11599.831253.082.8%10K.AIGMEMDGSGFGLGTR.S2
*rpal_wt_anaer_light_1_cleared_full.1200.1200.259.72250.7124131226.01226.441236.080.0%6R.YSMVVEDGVVK.T2
*rpal_wt_anaer_light_1_cleared_4.1248.1248.149.0010.5842921228.91226.441242.083.3%10R.YSMVVEDGVVK.T1
*rpal_wt_anaer_light_1_crude_1.1000.1000.239.9810.505061081.781083.231102.061.1%2K.TLNLEPNPGK.V2
*rpal_wt_anaer_light_1_cleared_2a.793.793.131.13920.5294551082.81083.231134.075.0%2K.TLNLEPNPGK.V1
*rpal_wt_anaer_light_1_cleared_2a.2686.2686.249.16030.673082353.022352.651128.050.0%8K.TLNLEPNPGKVEVSGGDTLLGQL.-2

URPA20476836684.1%334364739.0dctP1 TrapT family, dctP subunit, C4-dicarboxylate periplasmic binding protein 2305049:2306053 forward MW:36473
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_cleared_1.754.754.247.22790.5813451197.071197.381187.065.0%12K.FSHVVAPNTPK.G2
*rpal_wt_anaer_light_1_cleared_1a.568.568.362.74730.5310891199.091197.381204.074.3%6K.FSHVVAPNTPK.G3
*rpal_wt_anaer_light_1_cleared_2a.509.509.151.83130.5422211199.781197.381222.088.2%25K.FSHVVAPNTPK.G1
*rpal_wt_anaer_light_1_cleared_2a.1339.1339.236.17030.5368942618.142617.04160.037.5%3K.FSHVVAPNTPKGMAADKFKELAEK.Y2
*rpal_wt_anaer_light_1_crude_2.555.555.128.23960.373252866.5868.0441208.076.9%1K.GMAADKFK.E1
*rpal_wt_anaer_light_1_cleared_2a.983.983.145.52160.5237731437.731438.691214.073.7%6K.GMAADKFKELAEK.Y1
*rpal_wt_anaer_light_1_cleared_1a.1151.1151.262.19940.6544241438.651438.691161.078.3%7K.GMAADKFKELAEK.Y2
*rpal_wt_anaer_light_1_crude_3.1877.1877.264.87910.6787292003.092003.2810.064.5%5K.GMAADKFKELAEKYTDGK.V2
*rpal_wt_anaer_light_1_cleared_1a.1759.1759.347.67210.4106222004.92003.281143.050.0%1K.GMAADKFKELAEKYTDGK.V3
*rpal_wt_anaer_light_1_cleared_2a.1590.1590.230.87710.305652230.652230.5910.038.2%1K.GMAADKFKELAEKYTDGKVK.V2
*rpal_wt_anaer_light_1_pellet_4.2157.2157.240.22520.5316642593.372593.9811.042.1%4K.VKVEVYPNSQLFKDKEELDALK.L2
*rpal_wt_anaer_light_1_cleared_full.1788.1788.348.31240.3385762593.382593.981236.053.8%1K.VKVEVYPNSQLFKDKEELDALK.L3
*rpal_wt_anaer_light_1_cleared_full.2719.2719.367.10970.5273563889.593890.58185.057.3%9K.VKVEVYPNSQLFKDKEELDALKLGAVQMLAPSISK.F3
*rpal_wt_anaer_light_1_crude_2a.1876.1876.242.06640.5345862365.372366.6716.044.1%2K.VEVYPNSQLFKDKEELDALK.L2
*rpal_wt_anaer_light_1_cleared_2a.2880.2880.360.62660.4999293663.13663.271118.049.4%5K.VEVYPNSQLFKDKEELDALKLGAVQMLAPSISK.F3
*rpal_wt_anaer_light_1_cleared_full.2395.2395.274.34060.634222357.042357.771185.062.5%6K.DKEELDALKLGAVQMLAPSISK.F2
*rpal_wt_anaer_light_1_crude_2.2913.2913.345.19370.313172357.062357.7710.042.9%1K.DKEELDALKLGAVQMLAPSISK.F3
*rpal_wt_anaer_light_1_crude_full.1747.1747.147.96190.5351561314.661315.621242.078.9%7K.LGAVQMLAPSISK.F1
*rpal_wt_anaer_light_1_cleared_full.1598.1598.257.71460.463431315.931315.621254.065.2%10K.LGAVQMLAPSISK.F2
*rpal_wt_anaer_light_1_cleared_full.4043.4043.366.47930.4727292778.822779.251245.056.2%11K.FGPAGVKEFEVFDLPYILPDIAALR.K3
*rpal_wt_anaer_light_1_crude_full.4202.4202.283.4470.7409072779.192779.251198.056.1%16K.FGPAGVKEFEVFDLPYILPDIAALR.K2
*rpal_wt_anaer_light_1_cleared_4.3956.3956.269.25470.5990012907.72907.431212.051.2%13K.FGPAGVKEFEVFDLPYILPDIAALRK.V2
*rpal_wt_anaer_light_1_crude_full.3842.3842.376.52290.4488062908.732907.431166.064.2%15K.FGPAGVKEFEVFDLPYILPDIAALRK.V3
*rpal_wt_anaer_light_1_crude_2a.3834.3834.260.74470.6732982121.692122.471238.065.6%8K.EFEVFDLPYILPDIAALR.K2
*rpal_wt_anaer_light_1_cleared_1a.4518.4518.370.02690.4666982122.812122.471251.063.6%2K.EFEVFDLPYILPDIAALR.K3
*rpal_wt_anaer_light_1_cleared_full.3728.3728.357.55970.5077162251.262250.641220.053.3%3K.EFEVFDLPYILPDIAALRK.V3
*rpal_wt_anaer_light_1_cleared_2a.3755.3755.241.53030.4705292252.352250.641172.044.1%4K.EFEVFDLPYILPDIAALRK.V2
*rpal_wt_anaer_light_1_cleared_3.419.419.132.44480.453583970.74971.1461120.066.7%2R.KVTNGPVGAK.L1
*rpal_wt_anaer_light_1_cleared_1.427.427.235.37390.350767974.12971.1461165.057.9%1R.KVTNGPVGAK.L2
*rpal_wt_anaer_light_1_crude_1a.729.729.129.09970.316831575.48575.6831240.087.5%7K.LLDSK.G1
*rpal_wt_anaer_light_1_cleared_full.2059.2059.152.28350.6901091459.561460.65161.078.9%9K.GMTGLAYWDNGFK.I1
*rpal_wt_anaer_light_1_cleared_full.2064.2064.248.1830.5635951461.541460.651226.065.2%6K.GMTGLAYWDNGFK.I2
*rpal_wt_anaer_light_1_cleared_3.2351.2351.232.34940.3506492232.92233.621149.039.4%1K.GMTGLAYWDNGFKIMSANKK.L2
*rpal_wt_anaer_light_1_cleared_3.737.737.148.97390.5070841076.661077.271249.093.3%6K.KLIAPEDYK.G1
*rpal_wt_anaer_light_1_crude_1.730.730.239.36230.6157011077.211077.271245.062.5%2K.KLIAPEDYK.G2
*rpal_wt_anaer_light_1_cleared_full.804.804.131.66270.326848948.52949.0921193.076.9%10K.LIAPEDYK.G1
*rpal_wt_anaer_light_1_cleared_1a.837.837.231.52940.364828949.23949.0921214.057.1%3K.LIAPEDYK.G2
*rpal_wt_anaer_light_1_cleared_2.512.512.125.13240.358183865.57866.008119.072.7%1K.FRIQSSK.V1
*rpal_wt_anaer_light_1_cleared_1.515.515.239.40610.384598867.14866.0081227.064.3%1K.FRIQSSK.V2
*rpal_wt_anaer_light_1_crude_full.690.690.245.49220.457465849.19848.9781205.084.6%8K.VLDAQFR.A2
*rpal_wt_anaer_light_1_cleared_full.3918.3918.371.36720.5380813970.93970.451129.054.4%8R.ALGAIPQVLAFSEVYQALQTGVVDGQENTPSNMYTQK.M3
*rpal_wt_anaer_light_1_cleared_full.306.306.137.2610.418972771.56771.9151252.090.0%1K.MHEVQK.Y1
*rpal_wt_anaer_light_1_cleared_full.1841.1841.125.37030.4173541303.611304.45148.061.1%1K.QFWDGIPADVR.A1
*rpal_wt_anaer_light_1_crude_full.1997.1997.252.67440.5939091305.091304.451130.075.0%7K.QFWDGIPADVR.A2
*2rpal_wt_anaer_light_1_cleared_full.296.296.125.86170.110089574.53574.6551112.087.5%2R.AQLDK.A11
*rpal_wt_anaer_light_1_cleared_3.1893.1893.356.05550.4001233485.033485.881192.052.6%2R.AQLDKAMKEATEFGNSQSQKENAEALEEMKK.S3
*rpal_wt_anaer_light_1_crude_full.1302.1302.361.21020.4731112930.172930.24156.052.7%6K.AMKEATEFGNSQSQKENAEALEEMKK.S3
*rpal_wt_anaer_light_1_crude_full.1310.1310.247.70230.5749562930.852930.2410.045.7%3K.AMKEATEFGNSQSQKENAEALEEMKK.S2
*rpal_wt_anaer_light_1_cleared_4.1155.1155.242.69080.5770612599.162599.791128.043.9%3K.EATEFGNSQSQKENAEALEEMKK.S2
*rpal_wt_anaer_light_1_cleared_full.1106.1106.349.57190.3747972599.712599.791194.053.0%1K.EATEFGNSQSQKENAEALEEMKK.S3
*rpal_wt_anaer_light_1_cleared_full.1623.1623.370.17370.5317582003.192003.331226.057.4%5K.SGKTEIITLTPEQNLAMR.K3
*rpal_wt_anaer_light_1_pellet_2a.1771.1771.262.49690.4961642004.592003.331248.062.5%6K.SGKTEIITLTPEQNLAMR.K2
*rpal_wt_anaer_light_1_crude_1a.1879.1879.370.190.5271182131.762131.51213.057.1%7K.SGKTEIITLTPEQNLAMRK.A3
*rpal_wt_anaer_light_1_cleared_full.1354.1354.261.39970.5347242132.152131.51230.058.8%8K.SGKTEIITLTPEQNLAMRK.A2
*rpal_wt_anaer_light_1_cleared_5.1238.1238.126.21550.3310681730.01731.0219.047.8%2K.TEIITLTPEQNLAMR.K1
*rpal_wt_anaer_light_1_cleared_full.1926.1926.247.0370.4750151731.111731.021197.059.3%3K.TEIITLTPEQNLAMR.K2
*rpal_wt_anaer_light_1_crude_4.849.849.147.08350.5751571378.851379.58192.075.0%5R.KAMAPVYDDVGGR.V1
*rpal_wt_anaer_light_1_pellet_1.1376.1376.373.45560.514781379.681379.581251.071.8%2R.KAMAPVYDDVGGR.V3
*rpal_wt_anaer_light_1_crude_1a.1273.1273.254.94830.6582421380.511379.581155.066.7%9R.KAMAPVYDDVGGR.V2
*rpal_wt_anaer_light_1_cleared_1a.1024.1024.345.98070.4170511664.891663.941164.043.1%1R.KAMAPVYDDVGGRVGK.A3
*rpal_wt_anaer_light_1_cleared_2a.968.968.137.95040.4727251250.751251.411220.072.2%7K.AMAPVYDDVGGR.V1
*rpal_wt_anaer_light_1_cleared_1a.1131.1131.265.290.5819111251.041251.41143.081.8%8K.AMAPVYDDVGGR.V2
*rpal_wt_anaer_light_1_cleared_1a.1197.1197.248.35310.6187941534.81535.76161.057.7%1K.AMAPVYDDVGGRVGK.A2
*rpal_wt_anaer_light_1_cleared_1a.1994.1994.127.93240.408608962.55963.1621208.075.0%4K.ALIEEFIK.E1
*rpal_wt_anaer_light_1_crude_1.2319.2319.249.34430.514155963.31963.1621209.086.7%5K.ALIEEFIK.E2
*rpal_wt_anaer_light_1_cleared_5.1196.1196.154.31540.6529921676.131676.911166.078.3%3K.ALIEEFIKESGGGPTK.-1
*rpal_wt_anaer_light_1_pellet_full.2075.2075.267.19490.6327381676.641676.911236.072.4%8K.ALIEEFIKESGGGPTK.-2
*rpal_wt_anaer_light_1_cleared_1.2181.2181.373.16550.5936251678.021676.911214.065.4%7K.ALIEEFIKESGGGPTK.-3
Similarities: RPA4510(1:67)

URPA2336122784.1%107109076.0RPA2336 unknown protein 2648496:2648819 reverse MW:10907
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_membrane_1a.3172.3172.237.14150.6004171608.351610.01218.048.3%3R.FASGILVGVVGVHLLK.Q2
*rpal_wt_anaer_light_1_membrane_1.3426.3426.358.93790.4480511610.751610.01157.058.3%3R.FASGILVGVVGVHLLK.Q3
*rpal_wt_anaer_light_1_membrane_2a.501.501.135.70830.5318681175.751176.36148.075.0%1K.APEAVKSFAQK.A1
*rpal_wt_anaer_light_1_membrane_full.2307.2307.258.96620.6106242332.982333.56180.053.7%3R.SGLDKAGEDLREATVSGLSAVEK.S2
*rpal_wt_anaer_light_1_membrane_full.2314.2314.378.86730.5834812333.462333.561205.056.8%3R.SGLDKAGEDLREATVSGLSAVEK.S3
*rpal_wt_anaer_light_1_membrane_full.1734.1734.270.03510.6819981832.321833.011110.066.7%4K.AGEDLREATVSGLSAVEK.S2
*rpal_wt_anaer_light_1_membrane_full.1736.1736.348.99660.3127321834.491833.011129.057.7%1K.AGEDLREATVSGLSAVEK.S3
*rpal_wt_anaer_light_1_membrane_full.1096.1096.127.56390.4629031190.611191.321133.052.6%2R.EATVSGLSAVEK.S1
*rpal_wt_anaer_light_1_membrane_1a.1211.1211.254.25980.6594921191.511191.321208.077.3%2R.EATVSGLSAVEK.S2
*rpal_wt_anaer_light_1_membrane_2a.1326.1326.367.92970.6115593980.673981.11188.053.1%2R.SKLSNTTDSSEAATDDAPNVATTETAPAPSADQTATNEKA.-3
*rpal_wt_anaer_light_1_membrane_2a.1390.1390.238.67720.5410093765.013765.851178.026.9%2K.LSNTTDSSEAATDDAPNVATTETAPAPSADQTATNEKA.-2
*rpal_wt_anaer_light_1_membrane_2a.1389.1389.356.61820.4802913765.383765.851121.044.4%1K.LSNTTDSSEAATDDAPNVATTETAPAPSADQTATNEKA.-3

URPA09445329583.3%335359567.6cbbG glyceraldehyde-3-phosphate dehydrogenase(GAPDH) 1043108:1044115 reverse MW:35956
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_cleared_full.859.859.244.02520.490471834.68833.9661232.073.3%9R.VAINGFGR.I2
rpal_wt_anaer_light_1_pellet_full.337.337.126.38760.140649501.65501.607144.0100.0%1R.NVLR.A111
*rpal_wt_anaer_light_1_membrane_1.770.770.230.41250.207717926.79924.045141.053.3%1R.AIYESGRK.D2
*rpal_wt_anaer_light_1_pellet_full.2528.2528.245.55110.5467143193.223194.621196.038.5%5R.AIYESGRKDIEVVAINDLGPVETNAHLLR.F2
*rpal_wt_anaer_light_1_pellet_full.2509.2509.376.05850.5227633194.463194.621206.055.0%11R.AIYESGRKDIEVVAINDLGPVETNAHLLR.F3
*rpal_wt_anaer_light_1_pellet_full.2452.2452.269.41410.639862416.232417.771229.057.5%8R.KDIEVVAINDLGPVETNAHLLR.F2
*rpal_wt_anaer_light_1_pellet_full.2447.2447.390.32430.5613132418.02417.771253.059.4%5R.KDIEVVAINDLGPVETNAHLLR.F3
*rpal_wt_anaer_light_1_pellet_full.2744.2744.264.19380.6654972288.752289.591244.055.3%8K.DIEVVAINDLGPVETNAHLLR.F2
*rpal_wt_anaer_light_1_crude_2.3065.3065.358.78440.5333922289.352289.591254.050.8%6K.DIEVVAINDLGPVETNAHLLR.F3
*rpal_wt_anaer_light_1_crude_full.1490.1490.247.47230.6219751566.341565.7717.062.5%8R.FDSVHGRFPFEVK.V2
*rpal_wt_anaer_light_1_pellet_2.2364.2364.348.63390.3807652565.592565.811108.048.5%1R.FDSVHGRFPFEVKVDGDTIDAGR.G3
*rpal_wt_anaer_light_1_pellet_full.1890.1890.368.65950.4654082751.02751.03147.055.2%2R.FDSVHGRFPFEVKVDGDTIDAGRGK.I3
*rpal_wt_anaer_light_1_pellet_1.627.627.249.70410.6040111019.381019.06161.073.7%1K.VDGDTIDAGR.G2
*rpal_wt_anaer_light_1_pellet_2a.776.776.146.57220.5729451159.821160.361228.082.4%12R.DKAATLLTAGAK.R1
*rpal_wt_anaer_light_1_pellet_1.1113.1113.256.04530.6428691159.951160.361225.077.3%10R.DKAATLLTAGAK.R2
*rpal_wt_anaer_light_1_cleared_2a.503.503.133.07290.4867941315.831316.541153.060.0%8R.DKAATLLTAGAKR.V1
*rpal_wt_anaer_light_1_cleared_1.759.759.264.74440.5217721316.531316.541223.075.0%9R.DKAATLLTAGAKR.V2
*rpal_wt_anaer_light_1_pellet_full.644.644.371.16840.5482881317.11316.541204.073.2%4R.DKAATLLTAGAKR.V3
*rpal_wt_anaer_light_1_crude_3.688.688.134.10950.401938916.82917.0941160.080.0%5K.AATLLTAGAK.R1
*rpal_wt_anaer_light_1_pellet_full.664.664.236.80670.302757917.01917.094172.063.2%2K.AATLLTAGAK.R2
*rpal_wt_anaer_light_1_pellet_1a.646.646.241.81590.510871073.541073.281212.065.0%3K.AATLLTAGAKR.V2
*rpal_wt_anaer_light_1_pellet_4.1995.1995.238.91980.4610072700.742701.01124.041.3%2K.RVLVSAPSDGADATIVYGVNHETLSK.D2
*rpal_wt_anaer_light_1_pellet_3.2000.2000.374.58540.5746692704.012701.011226.059.2%1K.RVLVSAPSDGADATIVYGVNHETLSK.D3
*rpal_wt_anaer_light_1_pellet_2a.1908.1908.251.31860.6388792543.952544.821214.047.7%2R.VLVSAPSDGADATIVYGVNHETLSK.D2
*rpal_wt_anaer_light_1_pellet_3.1600.1600.277.85510.7272482048.812048.371223.072.2%1K.DHMVVSNGSCTTNCLAPVAK.V2
*rpal_wt_anaer_light_1_pellet_4.3091.3091.345.6680.3119083956.963956.45196.043.5%1K.VLNDTVGIETGFMTTIHAYTGDQPTLDTMHKDLYR.G3
*rpal_wt_anaer_light_1_cleared_1a.1316.1316.258.71380.577611408.461408.681211.070.4%10R.AAAMSMIPTSTGAAK.A2
*rpal_wt_anaer_light_1_crude_2a.1329.1329.143.33810.4872571410.71408.681148.063.6%15R.AAAMSMIPTSTGAAK.A1
*rpal_wt_anaer_light_1_pellet_full.2412.2412.139.91290.4849761052.771053.331247.073.3%9K.AIGLVLPELK.G1
*rpal_wt_anaer_light_1_cleared_full.2109.2109.253.33420.4586831054.851053.331254.077.8%16K.AIGLVLPELK.G2
*rpal_wt_anaer_light_1_crude_full.1790.1790.131.34040.4260571237.671238.561178.055.6%1K.AIGLVLPELKGK.L1
*rpal_wt_anaer_light_1_pellet_1a.777.777.244.22070.287634931.17929.1081244.070.6%2K.GKLDGVAIR.V2
*rpal_wt_anaer_light_1_pellet_full.2367.2367.260.15050.6548942178.12178.5818.056.8%13K.GKLDGVAIRVPTPNVSVVDLK.I2
*rpal_wt_anaer_light_1_pellet_full.2344.2344.370.70280.4916892178.52178.581244.060.6%12K.GKLDGVAIRVPTPNVSVVDLK.I3
*rpal_wt_anaer_light_1_pellet_1a.2910.2910.251.14460.6079721993.721993.36139.057.6%7K.LDGVAIRVPTPNVSVVDLK.I2
*rpal_wt_anaer_light_1_pellet_2a.1657.1657.140.06250.6358461267.791268.51151.073.7%3R.VPTPNVSVVDLK.I1
*rpal_wt_anaer_light_1_pellet_1.2287.2287.258.11690.6672961270.441268.51193.077.3%6R.VPTPNVSVVDLK.I2
*2rpal_wt_anaer_light_1_pellet_1a.416.416.126.05760.203019574.49572.77185.087.5%1K.IIAKK.A11
*rpal_wt_anaer_light_1_pellet_2.801.801.251.91130.5626461632.471631.87172.056.0%4K.KATTKEEINEAIKR.A2
*rpal_wt_anaer_light_1_pellet_5.630.630.144.23850.4598531633.971631.871170.076.2%6K.KATTKEEINEAIKR.A1
*rpal_wt_anaer_light_1_crude_5.796.796.134.35120.5465951503.011503.7180.068.4%3K.ATTKEEINEAIKR.A1
*rpal_wt_anaer_light_1_pellet_2.1092.1092.257.93650.6185821503.391503.71232.078.3%8K.ATTKEEINEAIKR.A2
*rpal_wt_anaer_light_1_pellet_1.1158.1158.351.94650.4278591504.211503.7133.056.4%4K.ATTKEEINEAIKR.A3
*rpal_wt_anaer_light_1_pellet_3.692.692.125.02760.3669711101.681102.231169.057.1%1K.EEINEAIKR.A1
*rpal_wt_anaer_light_1_crude_1.542.542.233.58220.4004231102.521102.23150.058.8%2K.EEINEAIKR.A2
*rpal_wt_anaer_light_1_pellet_3.2317.2317.350.47770.3014563346.533345.63123.054.2%1K.GILGYTNAPNVSIDFNHDPHSSTFHMDQTK.V3
*rpal_wt_anaer_light_1_pellet_full.2437.2437.258.66070.7175431791.611791.941251.064.0%8R.VMSWYDNEWGFSNR.M2
*rpal_wt_anaer_light_1_pellet_1.3030.3030.354.10170.4527841791.781791.941233.050.0%1R.VMSWYDNEWGFSNR.M3
*rpal_wt_anaer_light_1_pellet_5.1446.1446.125.9230.3331211794.011791.941135.052.4%1R.VMSWYDNEWGFSNR.M1
*rpal_wt_anaer_light_1_cleared_full.626.626.254.61480.531955978.53977.171213.073.7%12R.MADTAVAIGK.L2
*rpal_wt_anaer_light_1_cleared_3.724.724.140.12510.535301978.64977.171174.075.0%12R.MADTAVAIGK.L1
*rpal_wt_anaer_light_1_pellet_4.2463.2463.140.6180.3392341203.021203.491176.072.2%8R.MADTAVAIGKLI.-1
*rpal_wt_anaer_light_1_pellet_1a.2743.2743.251.03580.5220141203.161203.491113.071.4%3R.MADTAVAIGKLI.-2
Similarities: RPA0221(1:52)
RPA1697(1:52)
RPA1544(1:52)

URPA3822134083.2%107119404.9RPA3822 conserved unknown protein 4317533:4317856 forward MW:11940
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_membrane_3.1224.1224.235.59630.4356771810.541811.05120.044.4%1R.KFALDEEQKFKAEAR.R2
*rpal_wt_anaer_light_1_membrane_2.2241.2241.247.78340.5798561443.691442.75174.063.6%3R.RDKLLGLWIAEK.L2
*rpal_wt_anaer_light_1_crude_4.2220.2220.139.68930.5675991285.91286.561185.075.0%2R.DKLLGLWIAEK.L1
*rpal_wt_anaer_light_1_cleared_1.2587.2587.237.46920.4895781044.481043.291173.075.0%1K.LLGLWIAEK.L2
*rpal_wt_anaer_light_1_cleared_2a.1122.1122.139.64150.4959021207.771208.361225.071.4%8K.LGLSGDAAAAYAK.E1
*rpal_wt_anaer_light_1_membrane_full.1328.1328.275.34960.7098411208.621208.361195.091.3%7K.LGLSGDAAAAYAK.E2
*rpal_wt_anaer_light_1_membrane_3.2512.2512.266.22060.6788431844.391844.971239.067.7%4K.EVVIADLEEAGDDDVVR.K2
*rpal_wt_anaer_light_1_cleared_1a.1497.1497.357.89640.3543852158.252158.51215.054.2%2R.KVTKDLTDKGITLPETELR.A3
*rpal_wt_anaer_light_1_cleared_3.1472.1472.270.57070.6152532158.282158.51245.061.8%2R.KVTKDLTDKGITLPETELR.A2
*rpal_wt_anaer_light_1_membrane_2a.1876.1876.132.67130.3641541700.851701.921162.060.9%1K.DLTDKGITLPETELR.A1
*rpal_wt_anaer_light_1_cleared_full.1686.1686.258.41710.5842521702.811701.921227.070.4%7K.DLTDKGITLPETELR.A2
*rpal_wt_anaer_light_1_membrane_1.2352.2352.346.84620.3712721704.531701.921226.047.8%1K.DLTDKGITLPETELR.A3
*rpal_wt_anaer_light_1_membrane_2.2313.2313.230.7820.4947011517.461514.7410.043.5%1K.MAEFYAQAVQEVK.A2

URPA2164120101381.0%547577955.5groEL2 chaperonin GroEL2, cpn60 2437219:2438862 reverse MW:57796
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_pellet_1.2586.2586.356.6450.3467651402.021400.731226.050.0%1R.MLRGVDILANAVK.V3
*rpal_wt_anaer_light_1_pellet_2.2323.2323.246.91010.2950371403.021400.731192.062.5%2R.MLRGVDILANAVK.V2
*rpal_wt_anaer_light_1_pellet_1a.1860.1860.135.22340.337222999.531000.18142.073.3%9R.GVDILANAVK.V1
*rpal_wt_anaer_light_1_crude_1.1747.1747.249.5360.5048651001.471000.181221.073.7%7R.GVDILANAVK.V2
*rpal_wt_anaer_light_1_pellet_1a.2930.2930.244.75190.5746841596.051595.921240.051.7%4R.GVDILANAVKVTLGPK.G2
*rpal_wt_anaer_light_1_pellet_1.3161.3161.355.41730.4906731597.121595.921234.057.1%1R.GVDILANAVKVTLGPK.G3
rpal_wt_anaer_light_1_crude_1.463.463.128.71220.227025616.4614.7631233.080.0%2K.VTLGPK.G11
*rpal_wt_anaer_light_1_cleared_1.521.521.134.10540.159594687.48687.8151183.090.0%4R.NVVLDK.S1
*rpal_wt_anaer_light_1_pellet_1a.1500.1500.253.33510.6221061303.251303.51227.072.7%2R.NVVLDKSFGAPR.I2
*rpal_wt_anaer_light_1_pellet_1.1656.1656.346.84440.3871921304.131303.51181.056.4%1R.NVVLDKSFGAPR.I3
rpal_wt_anaer_light_1_crude_1a.779.779.136.0950.294235634.46634.713119.0100.0%5K.SFGAPR.I11
rpal_wt_anaer_light_1_pellet_full.422.422.132.02860.3770221031.641032.231240.062.5%6R.ITKDGVTVAK.D11
rpal_wt_anaer_light_1_pellet_full.424.424.243.76170.5651931033.571032.231152.063.2%4R.ITKDGVTVAK.D22
*rpal_wt_anaer_light_1_pellet_3.2329.2329.393.29080.6288843025.133025.471228.066.7%6R.ITKDGVTVAKDIELDDKFENMGAQMVR.E3
*rpal_wt_anaer_light_1_pellet_2a.2088.2088.263.7510.6868933025.243025.471200.050.0%2R.ITKDGVTVAKDIELDDKFENMGAQMVR.E2
rpal_wt_anaer_light_1_crude_1a.713.713.125.70990.335069689.47689.7871130.072.7%1K.DGVTVAK.D11
*rpal_wt_anaer_light_1_pellet_1a.2774.2774.386.26470.6254152682.72683.041127.065.2%9K.DGVTVAKDIELDDKFENMGAQMVR.E3
*rpal_wt_anaer_light_1_pellet_2a.2262.2262.265.66790.6656462683.162683.041162.052.4%5K.DGVTVAKDIELDDKFENMGAQMVR.E2
*rpal_wt_anaer_light_1_crude_full.2205.2205.269.19810.7270232011.982012.271232.076.7%6K.DIELDDKFENMGAQMVR.E2
*rpal_wt_anaer_light_1_pellet_1a.2623.2623.371.96010.6058692013.32012.271190.056.6%2K.DIELDDKFENMGAQMVR.E3
*rpal_wt_anaer_light_1_pellet_5.1406.1406.125.93960.3881861988.921990.181164.045.2%1K.SADAAGDGTTTATVLAQAIVR.E1
*rpal_wt_anaer_light_1_pellet_2a.2247.2247.275.65330.7285791989.811990.181236.072.2%19K.SADAAGDGTTTATVLAQAIVR.E2
*rpal_wt_anaer_light_1_pellet_1a.2725.2725.359.26740.3507541990.471990.181245.043.9%4K.SADAAGDGTTTATVLAQAIVR.E3
rpal_wt_anaer_light_1_pellet_1a.1848.1848.265.49090.680831217.751218.481175.077.3%9K.AVAAGMNPMDLK.R22
rpal_wt_anaer_light_1_cleared_4.1360.1360.146.25680.4356641220.91218.481255.066.7%12K.AVAAGMNPMDLK.R11
rpal_wt_anaer_light_1_crude_full.1198.1198.135.35880.448161373.661374.671106.068.4%7K.AVAAGMNPMDLKR.G11
rpal_wt_anaer_light_1_crude_1.1425.1425.345.07340.4263161374.81374.671190.051.3%1K.AVAAGMNPMDLKR.G33
rpal_wt_anaer_light_1_pellet_full.1333.1333.269.78570.6859591375.571374.671172.082.6%7K.AVAAGMNPMDLKR.G22
*rpal_wt_anaer_light_1_crude_2.3870.3870.248.75310.5931271669.441668.981238.051.7%7K.RGIDLAVEAVVADLVK.N2
*rpal_wt_anaer_light_1_cleared_1.3818.3818.383.22650.6300271669.921668.981223.060.4%6K.RGIDLAVEAVVADLVK.N3
*rpal_wt_anaer_light_1_pellet_full.3867.3867.284.86920.6806631512.721512.791249.085.2%135R.GIDLAVEAVVADLVK.N2
*rpal_wt_anaer_light_1_pellet_1.4644.4644.3110.0320.63341513.241512.791254.080.0%27R.GIDLAVEAVVADLVK.N3
*rpal_wt_anaer_light_1_crude_5.2264.2264.152.23560.5314521515.171512.791254.069.6%35R.GIDLAVEAVVADLVK.N1
*rpal_wt_anaer_light_1_pellet_2a.1569.1569.252.95060.5940052417.982418.621182.050.0%3K.KVTSNDEIAQVGTISANGDAEIGK.F2
*rpal_wt_anaer_light_1_pellet_full.3279.3279.370.43830.5063213194.513195.58194.058.1%3K.KVTSNDEIAQVGTISANGDAEIGKFLADAMK.K3
*rpal_wt_anaer_light_1_pellet_full.3097.3097.360.93340.2854943323.533323.751131.051.1%4K.KVTSNDEIAQVGTISANGDAEIGKFLADAMKK.V3
*rpal_wt_anaer_light_1_crude_full.763.763.136.48240.597502795.54795.9771244.083.3%6K.FLADAMK.K1
*rpal_wt_anaer_light_1_crude_3.668.668.136.46890.455912923.84924.1521190.071.4%7K.FLADAMKK.V1
*rpal_wt_anaer_light_1_pellet_full.584.584.241.4160.516129924.56924.1521156.075.0%4K.FLADAMKK.V2
*rpal_wt_anaer_light_1_pellet_1.1406.1406.354.93420.4081971472.461473.67156.064.3%2K.KVGNEGVITVEEAK.S3
*rpal_wt_anaer_light_1_pellet_4.1263.1263.148.18330.5655421472.91473.671113.071.4%4K.KVGNEGVITVEEAK.S1
*rpal_wt_anaer_light_1_pellet_1a.1240.1240.271.53740.7131181473.251473.671255.084.6%7K.KVGNEGVITVEEAK.S2
*rpal_wt_anaer_light_1_pellet_full.1219.1219.143.74890.6628971344.651345.491166.075.0%13K.VGNEGVITVEEAK.S1
*rpal_wt_anaer_light_1_pellet_full.1217.1217.255.38870.6720521345.461345.491196.078.3%11K.VGNEGVITVEEAK.S2
*rpal_wt_anaer_light_1_pellet_3.3104.3104.261.01310.2023271868.851869.061253.062.1%21K.SLETELDVVEGMQFDR.G2
*rpal_wt_anaer_light_1_pellet_1.3658.3658.363.06350.1544141868.851869.061236.064.0%2K.SLETELDVVEGMQFDR.G3
*rpal_wt_anaer_light_1_crude_full.1708.1708.150.43340.652691474.731475.641211.075.0%9R.GYISPYFVTNADK.M1
*rpal_wt_anaer_light_1_pellet_full.1845.1845.272.44110.7580251477.01475.641219.083.3%7R.GYISPYFVTNADK.M2
*rpal_wt_anaer_light_1_pellet_full.1905.1905.262.64930.6511531762.611763.03153.066.7%8R.GYISPYFVTNADKMR.V2
*rpal_wt_anaer_light_1_pellet_3.2706.2706.236.62310.4902231857.391857.141168.050.0%1K.MRVEFDDAYILINEK.K2
*rpal_wt_anaer_light_1_pellet_full.2468.2468.145.49520.664291568.71569.75195.075.0%6R.VEFDDAYILINEK.K1
*rpal_wt_anaer_light_1_pellet_2.2777.2777.266.53970.6712911571.61569.751255.075.0%13R.VEFDDAYILINEK.K2
*rpal_wt_anaer_light_1_crude_1a.2426.2426.247.24180.6133891697.41697.931236.056.0%6R.VEFDDAYILINEKK.L2
*rpal_wt_anaer_light_1_pellet_1.2690.2690.346.59380.4523761698.551697.931180.055.8%1R.VEFDDAYILINEKK.L3
*rpal_wt_anaer_light_1_pellet_5.1301.1301.130.6650.3543031699.061697.93121.063.6%2R.VEFDDAYILINEKK.L1
*rpal_wt_anaer_light_1_pellet_1a.581.581.129.11770.128609845.47843.0581220.069.2%1R.GGLKVAAVK.A1
*rpal_wt_anaer_light_1_pellet_2.1593.1593.244.15580.5914831546.061543.81184.051.7%1R.GGLKVAAVKAPGFGDR.R2
*rpal_wt_anaer_light_1_pellet_1.1368.1368.250.02420.5964531188.411188.371236.065.2%5K.VAAVKAPGFGDR.R2
*rpal_wt_anaer_light_1_pellet_4.3109.3109.251.74240.5031812544.672543.01112.045.2%2R.RKAMLQDIAILTGGQAISEDLGIK.M2
*rpal_wt_anaer_light_1_pellet_full.3288.3288.279.22730.6896572386.32386.821189.065.0%12R.KAMLQDIAILTGGQAISEDLGIK.M2
*rpal_wt_anaer_light_1_pellet_full.3284.3284.354.96520.3991622386.32386.821129.040.3%1R.KAMLQDIAILTGGQAISEDLGIK.M3
*rpal_wt_anaer_light_1_pellet_full.4204.4204.348.96960.392163660.543660.361160.047.7%1R.KAMLQDIAILTGGQAISEDLGIKMENVTLQMLGR.A3
*rpal_wt_anaer_light_1_pellet_full.3667.3667.381.80560.56882258.742258.641186.056.5%14K.AMLQDIAILTGGQAISEDLGIK.M3
*rpal_wt_anaer_light_1_crude_full.3694.3694.275.12340.5396962258.962258.641250.063.2%52K.AMLQDIAILTGGQAISEDLGIK.M2
*rpal_wt_anaer_light_1_pellet_5.2376.2376.241.07050.5847753530.693532.181129.032.8%1K.AMLQDIAILTGGQAISEDLGIKMENVTLQMLGR.A2
*rpal_wt_anaer_light_1_pellet_full.4502.4502.371.98880.5477483531.423532.18153.052.9%3K.AMLQDIAILTGGQAISEDLGIKMENVTLQMLGR.A3
*rpal_wt_anaer_light_1_pellet_full.1963.1963.275.03820.6512981292.221292.571254.090.0%10K.MENVTLQMLGR.A2
*rpal_wt_anaer_light_1_cleared_2a.1672.1672.131.44860.4328811293.691292.571162.062.5%7K.MENVTLQMLGR.A1
*rpal_wt_anaer_light_1_pellet_3.928.928.276.940.7260772017.852018.391104.075.8%2R.AKKVMIDKENTTIVNGAGK.K2
*rpal_wt_anaer_light_1_pellet_full.1050.1050.250.56910.5242211818.861819.131149.060.0%2K.KVMIDKENTTIVNGAGK.K2
*rpal_wt_anaer_light_1_pellet_1a.1220.1220.347.64870.3072951818.91819.131213.044.4%1K.KVMIDKENTTIVNGAGK.K3
*rpal_wt_anaer_light_1_pellet_full.725.725.259.590.5533041946.271947.31148.062.5%2K.KVMIDKENTTIVNGAGKK.A2
*rpal_wt_anaer_light_1_pellet_2.1386.1386.261.84290.4534511690.711690.961210.067.9%5K.VMIDKENTTIVNGAGK.K2
*rpal_wt_anaer_light_1_pellet_2a.1068.1068.127.17520.3509161690.81690.96126.052.2%1K.VMIDKENTTIVNGAGK.K1
*rpal_wt_anaer_light_1_pellet_1.1539.1539.358.14380.4735041691.271690.961233.065.3%1K.VMIDKENTTIVNGAGK.K3
*rpal_wt_anaer_light_1_crude_1.856.856.356.85520.2640041819.441819.131188.054.0%1K.VMIDKENTTIVNGAGKK.A3
*rpal_wt_anaer_light_1_pellet_3.1142.1142.255.47790.5767721820.591819.131107.061.3%2K.VMIDKENTTIVNGAGKK.A2
*rpal_wt_anaer_light_1_pellet_2.1535.1535.353.56710.463762474.832474.8419.050.7%1K.VMIDKENTTIVNGAGKKADIEAR.V3
*rpal_wt_anaer_light_1_cleared_4.1102.1102.240.01810.5778742475.262474.841104.042.5%1K.VMIDKENTTIVNGAGKKADIEAR.V2
*rpal_wt_anaer_light_1_pellet_2.575.575.132.95380.385264802.59802.9071180.090.9%2K.KADIEAR.V1
*rpal_wt_anaer_light_1_crude_1.392.392.231.86330.248439802.59802.9071201.057.1%1K.KADIEAR.V2
*rpal_wt_anaer_light_1_pellet_1a.434.434.127.50460.0915011558.45558.6991212.087.5%3R.VAQIK.A1
*rpal_wt_anaer_light_1_pellet_2.1011.1011.266.3270.7370441428.591428.451254.081.0%1K.AQIEETTSDYDR.E2
*rpal_wt_anaer_light_1_pellet_2a.627.627.131.52960.4455341684.751685.741130.057.1%2K.AQIEETTSDYDREK.L1
*rpal_wt_anaer_light_1_pellet_1a.739.739.259.79840.6372731685.061685.741173.072.0%6K.AQIEETTSDYDREK.L2
*rpal_wt_anaer_light_1_pellet_1a.740.740.347.9570.3438411686.681685.741196.050.0%1K.AQIEETTSDYDREK.L3
*rpal_wt_anaer_light_1_pellet_2a.1017.1017.235.85190.3573232212.292212.341132.046.9%2K.AQIEETTSDYDREKLQER.L2
*rpal_wt_anaer_light_1_pellet_1a.1325.1325.354.570.4959672213.372212.34192.054.7%1K.AQIEETTSDYDREKLQER.L3
rpal_wt_anaer_light_1_crude_2.1146.1146.127.17790.170631855.68856.0571114.060.0%1K.LAGGVAVIR.V11
rpal_wt_anaer_light_1_pellet_full.1102.1102.257.72780.46845857.73856.0571240.088.2%17K.LAGGVAVIR.V22
rpal_wt_anaer_light_1_pellet_full.463.463.129.78120.436275988.62989.114176.066.7%5R.VGGATEVEVK.E11
rpal_wt_anaer_light_1_crude_1.532.532.256.830.32962988.98989.1141224.084.2%3R.VGGATEVEVK.E22
*rpal_wt_anaer_light_1_pellet_4.702.702.137.37760.4157941273.861274.42185.072.2%2R.VGGATEVEVKER.K1
*rpal_wt_anaer_light_1_pellet_1.675.675.244.96540.468561273.981274.421110.061.9%2R.VGGATEVEVKER.K2
*rpal_wt_anaer_light_1_pellet_4.651.651.125.21810.3488211414.831415.571139.055.6%1R.KDRVDDAMHATR.A1
*rpal_wt_anaer_light_1_pellet_1.596.596.371.18740.530911416.11415.571255.074.3%2R.KDRVDDAMHATR.A3
*rpal_wt_anaer_light_1_pellet_1a.507.507.245.58550.5496841416.311415.571197.063.6%1R.KDRVDDAMHATR.A2
*rpal_wt_anaer_light_1_crude_2a.653.653.127.27470.3254041015.681016.121205.057.1%1R.VDDAMHATR.A1
*rpal_wt_anaer_light_1_pellet_1a.456.456.257.30830.608981016.061016.121216.082.4%2R.VDDAMHATR.A2
*rpal_wt_anaer_light_1_pellet_2a.2093.2093.139.53120.4220011607.931608.881168.066.7%12R.AAVEEGIVPGGGVALLR.A1
*rpal_wt_anaer_light_1_pellet_full.2257.2257.274.28980.4985031608.481608.881204.076.7%17R.AAVEEGIVPGGGVALLR.A2
*rpal_wt_anaer_light_1_pellet_full.2240.2240.371.81330.4881461608.721608.881245.061.5%2R.AAVEEGIVPGGGVALLR.A3
*rpal_wt_anaer_light_1_pellet_full.414.414.140.19520.490108973.61974.1461226.085.7%5R.ASEQLKGLK.T1
*rpal_wt_anaer_light_1_pellet_1a.539.539.245.80690.406775974.27974.146189.076.5%5R.ASEQLKGLK.T2
*rpal_wt_anaer_light_1_pellet_1a.572.572.232.75420.212571931.82930.096166.060.0%1K.TGVEIVRR.A2
*rpal_wt_anaer_light_1_pellet_1a.2608.2608.360.87820.5124022609.952610.841211.052.2%1K.VLEKEQYAFGFDSQSGEYGDLVK.K3
*rpal_wt_anaer_light_1_pellet_2a.2111.2111.256.94940.6658492611.062610.841227.047.5%5K.VLEKEQYAFGFDSQSGEYGDLVK.K2
*rpal_wt_anaer_light_1_pellet_3.2115.2115.367.97970.5703732738.552739.011117.060.0%4K.VLEKEQYAFGFDSQSGEYGDLVKK.G3
*rpal_wt_anaer_light_1_pellet_2a.1866.1866.262.53940.599082739.292739.011202.050.0%3K.VLEKEQYAFGFDSQSGEYGDLVKK.G2
*rpal_wt_anaer_light_1_pellet_full.408.408.138.05690.43626871.66872.0531226.083.3%2K.KGIIDPTK.V1
*rpal_wt_anaer_light_1_pellet_1.625.625.238.45450.261096872.15872.0531224.068.8%2K.KGIIDPTK.V2
*rpal_wt_anaer_light_1_pellet_1.1501.1501.350.64210.3716371227.091226.511224.062.9%3K.KGIIDPTKVVR.T3
*rpal_wt_anaer_light_1_pellet_1a.1340.1340.236.27570.282151227.911226.511205.055.0%1K.KGIIDPTKVVR.T2
*rpal_wt_anaer_light_1_pellet_full.512.512.130.04340.268185743.68743.8791174.081.8%5K.GIIDPTK.V1
*rpal_wt_anaer_light_1_pellet_2a.4632.4632.286.21080.7396672541.32542.011207.060.5%118R.TAIQNAASVAALLITTEAMIAELPK.K2
*rpal_wt_anaer_light_1_crude_full.4838.4838.379.45390.6083742542.852542.011171.058.9%133R.TAIQNAASVAALLITTEAMIAELPK.K3
*rpal_wt_anaer_light_1_pellet_2.4895.4895.356.68250.4190272672.042670.191231.048.7%7R.TAIQNAASVAALLITTEAMIAELPKK.G3
*rpal_wt_anaer_light_1_pellet_4.4630.4630.359.84890.4822934231.154232.961109.043.1%10R.TAIQNAASVAALLITTEAMIAELPKKGGAGAGGMPPGGGMGGMDF.-3
*rpal_wt_anaer_light_1_pellet_5.1192.1192.126.08970.4712661708.731709.971164.043.3%1K.KGGAGAGGMPPGGGMGGMDF.-1
*rpal_wt_anaer_light_1_pellet_2.2159.2159.243.89830.6167891709.41709.971192.047.2%2K.KGGAGAGGMPPGGGMGGMDF.-2
Similarities: RPA1140(14:106)

URPA201292080.6%108112506.5RPA2012 conserved unknown protein 2265975:2266301 forward MW:11249
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_cleared_4.1098.1098.137.24380.5599481484.741485.631228.066.7%3M.AGQVEDLTPQEVAK.G1
*rpal_wt_anaer_light_1_cleared_2.1228.1228.257.00820.6316351485.641485.631243.064.0%5M.AGQVEDLTPQEVAK.G2
*rpal_wt_anaer_light_1_cleared_2a.3128.3128.349.61820.360083445.053446.921233.046.8%1R.YLLVDVREPNEVAVEAYPDAVVVPLSTFDPK.A3
*rpal_wt_anaer_light_1_cleared_4.2946.2946.242.98210.5951692586.192587.891221.042.5%1R.EPNEVAVEAYPDAVVVPLSTFDPK.A2
*rpal_wt_anaer_light_1_cleared_full.1445.1445.359.9580.4982251573.851573.861157.066.0%1K.AIPDPAGKEVVFACR.S3
*rpal_wt_anaer_light_1_cleared_1a.1637.1637.238.29890.5336081574.231573.86114.051.9%2K.AIPDPAGKEVVFACR.S2
*rpal_wt_anaer_light_1_crude_1a.2111.2111.241.25540.5603991711.521708.941200.055.2%2R.SVTASMAAQAAGLPYNR.H2
*rpal_wt_anaer_light_1_crude_2a.1473.1473.139.18710.2187861051.791052.261213.070.6%3R.HLAGGILGWK.A1
*rpal_wt_anaer_light_1_cleared_1.1636.1636.243.45630.5553991052.391052.261156.072.2%2R.HLAGGILGWK.A2

URPA1428278680.5%257278138.2RPA1428 possible lipoprotein 1582970:1583743 forward MW:27813
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_crude_5.1233.1233.144.13590.5352851604.981605.881201.063.6%2R.VGVTAGPHAEILDVVK.K1
*rpal_wt_anaer_light_1_crude_1a.2048.2048.262.94830.608511605.021605.881224.069.0%5R.VGVTAGPHAEILDVVK.K2
*rpal_wt_anaer_light_1_cleared_5.944.944.138.85170.4613411733.041734.051180.062.5%1R.VGVTAGPHAEILDVVKK.V1
*rpal_wt_anaer_light_1_cleared_full.1271.1271.263.26330.5907071733.611734.051209.067.7%4R.VGVTAGPHAEILDVVKK.V2
*rpal_wt_anaer_light_1_cleared_2.2518.2518.347.83180.2854362433.62432.781184.053.8%1R.GLDVKPVEFTDYVVPNQALAQK.E3
*rpal_wt_anaer_light_1_crude_4.2507.2507.242.07540.5476192434.742432.781149.044.7%2R.GLDVKPVEFTDYVVPNQALAQK.E2
*rpal_wt_anaer_light_1_crude_full.2752.2752.358.3040.4746664118.034119.62139.050.0%3R.GLDVKPVEFTDYVVPNQALAQKELEANSFQHEPYLK.A3
*rpal_wt_anaer_light_1_cleared_2.1362.1362.250.85640.5144011534.081534.751212.059.3%4K.VANTIASPQGVYSVK.V2
*rpal_wt_anaer_light_1_cleared_5.886.886.132.61430.4416841537.031534.751209.056.5%3K.VANTIASPQGVYSVK.V1
*rpal_wt_anaer_light_1_cleared_2.668.668.129.16560.278273857.61858.071216.069.2%1K.VKALADLK.Q1
*rpal_wt_anaer_light_1_cleared_2a.1304.1304.251.69170.6342742154.62154.391241.055.3%1K.ALADLKQGATVAIANDPSNGAR.G2
*rpal_wt_anaer_light_1_cleared_1.2602.2602.270.83110.6431571274.781276.611244.085.7%7R.GLQILALHGLIK.L2
*rpal_wt_anaer_light_1_cleared_2a.2166.2166.142.15870.3957121275.811276.611213.072.2%8R.GLQILALHGLIK.L1
*rpal_wt_anaer_light_1_crude_1.2777.2777.357.71160.5263661277.351276.611147.065.8%3R.GLQILALHGLIK.L3
*rpal_wt_anaer_light_1_crude_5.1300.1300.126.3350.3985271898.061899.151197.031.0%1K.LKDGVGATATVADIIDNPK.K1
*rpal_wt_anaer_light_1_cleared_3.1901.1901.287.43140.6860291899.361899.151233.079.4%3K.LKDGVGATATVADIIDNPK.K2
*rpal_wt_anaer_light_1_cleared_3.1638.1638.242.95290.5653382027.322027.3314.048.6%3K.LKDGVGATATVADIIDNPKK.L2
*rpal_wt_anaer_light_1_cleared_2a.1548.1548.267.79030.621132268.722268.661110.060.0%4K.LKDGVGATATVADIIDNPKKLK.F2
*rpal_wt_anaer_light_1_cleared_1a.1779.1779.349.97840.4053532268.792268.661116.044.9%3K.LKDGVGATATVADIIDNPKKLK.F3
*rpal_wt_anaer_light_1_crude_full.1762.1762.141.92750.5352311258.781259.451199.077.8%7K.FVELDAAQLPR.S1
*rpal_wt_anaer_light_1_cleared_1.1968.1968.272.84750.6272131258.991259.451223.085.0%6K.FVELDAAQLPR.S2
*rpal_wt_anaer_light_1_crude_5.1566.1566.230.07680.3003543088.653088.41128.025.5%1R.SLQDVDLVSINNNYAVQAGLDPSKDALAR.E2
*rpal_wt_anaer_light_1_crude_1a.3023.3023.241.58710.5019061597.051596.831176.057.7%4R.ENVEGPWVNIIAVR.E2
*rpal_wt_anaer_light_1_cleared_4.1012.1012.127.8570.4244681385.821386.55141.055.6%1K.QLIDAYHSDPVK.Q1
*rpal_wt_anaer_light_1_cleared_full.1648.1648.241.0480.6214582147.382147.4132.053.1%5K.QLIDAYHSDPVKQFVETR.F2
*rpal_wt_anaer_light_1_crude_full.1917.1917.126.88760.4188591082.531083.271144.076.9%1R.FKGTYIPAW.-1
*rpal_wt_anaer_light_1_cleared_1a.1982.1982.238.54340.4727991083.471083.271217.066.7%2R.FKGTYIPAW.-2

URPA1495143380.4%97108365.4RPA1495 unknown protein 1658072:1658365 forward MW:10836
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_membrane_5.534.534.140.9860.5032351694.861695.921113.062.5%3M.SEEYKGHSGHPLILK.Q1
*rpal_wt_anaer_light_1_membrane_2.804.804.253.28270.6231421695.811695.92181.063.0%3M.SEEYKGHSGHPLILK.Q2
*rpal_wt_anaer_light_1_membrane_full.530.530.364.76830.5849051695.981695.921250.056.2%3M.SEEYKGHSGHPLILK.Q3
*rpal_wt_anaer_light_1_membrane_3.1737.1737.347.80980.3871653488.213488.92189.044.4%3M.SEEYKGHSGHPLILKQEGEYKGYSGEPLILK.Q3
*rpal_wt_anaer_light_1_membrane_full.1504.1504.243.71320.5455561812.121812.03136.053.6%2K.QEGEYKGYSGEPLILK.Q2
*rpal_wt_anaer_light_1_membrane_2a.2032.2032.129.95420.5285071539.741540.76168.050.0%1K.GEYQSFSGTPLILK.Q1
*rpal_wt_anaer_light_1_membrane_2.2458.2458.247.54250.5857791541.271540.761222.056.0%1K.GEYQSFSGTPLILK.Q2
*rpal_wt_anaer_light_1_membrane_4.1813.1813.237.82680.6000112486.312486.7410.043.6%1K.QEGEYRGFSGAPLILKQDGEYK.S2
*rpal_wt_anaer_light_1_membrane_2.2128.2128.348.79390.3760862487.152486.74148.044.1%1K.QEGEYRGFSGAPLILKQDGEYK.S3
*rpal_wt_anaer_light_1_membrane_full.1751.1751.129.88680.2351241002.621003.231208.062.5%2R.GFSGAPLILK.Q1
*rpal_wt_anaer_light_1_membrane_1.2149.2149.238.39570.5837741003.071003.23142.063.2%2R.GFSGAPLILK.Q2
*rpal_wt_anaer_light_1_membrane_full.1682.1682.249.41170.5674931723.841723.971148.058.6%2R.GFSGAPLILKQDGEYK.S2
*rpal_wt_anaer_light_1_membrane_full.3436.3436.125.86130.4064181223.531224.441212.052.9%5K.SFSGYPLLLNI.-1
*rpal_wt_anaer_light_1_membrane_full.3424.3424.262.52120.5612821225.41224.441202.085.0%4K.SFSGYPLLLNI.-2

URPA162061579.2%106115355.8RPA1620 unknown protein 1801160:1801480 reverse MW:11535
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_cleared_full.3269.3269.357.08090.4641252343.892341.671248.051.8%5K.INALLEQETSLRQWLEQIR.A3
*rpal_wt_anaer_light_1_crude_2a.1209.1209.125.23330.2977141058.811059.251177.052.9%1R.GATVIAGLTQK.E1
*rpal_wt_anaer_light_1_crude_4.3736.3736.261.19390.6446082586.852587.031159.050.0%5R.GATVIAGLTQKETEEFLLLSPLVR.A2
*rpal_wt_anaer_light_1_crude_5.950.950.127.10580.4633141519.921520.671152.050.0%2R.AFDSGMTADHAAAVR.A1
*rpal_wt_anaer_light_1_cleared_full.876.876.264.4030.6307351520.81520.671185.067.9%1R.AFDSGMTADHAAAVR.A2
*rpal_wt_anaer_light_1_cleared_4.2642.2642.245.55820.5770292631.022630.881110.039.1%1K.AKLEGALQDNAIESLSGWGEATAAAR.-2

URPA01766832478.6%476507175.2atpD putative H+-transporting ATP synthase beta chain. 194774:196204 reverse MW:50717
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_membrane_1.442.442.235.12270.384168916.42915.983128.064.7%1M.ATPANQTGR.I2
*rpal_wt_anaer_light_1_membrane_3.2531.2531.249.97370.5931842207.982208.4410.048.6%3K.NGDNRLVLEVAQHLGESTVR.T2
*rpal_wt_anaer_light_1_membrane_2.2768.2768.375.49290.5330862208.912208.441254.060.4%9K.NGDNRLVLEVAQHLGESTVR.T3
*rpal_wt_anaer_light_1_membrane_2.2298.2298.263.71560.5827871651.951651.91239.070.4%8R.LVLEVAQHLGESTVR.T2
*rpal_wt_anaer_light_1_membrane_full.1914.1914.363.02480.5724891652.561651.91156.061.2%5R.LVLEVAQHLGESTVR.T3
*rpal_wt_anaer_light_1_membrane_2a.1479.1479.133.40370.4958191306.71307.511134.066.7%3R.TIAMDTTEGLVR.G1
*rpal_wt_anaer_light_1_membrane_1a.1708.1708.271.19420.6952761306.831307.511191.086.4%6R.TIAMDTTEGLVR.G2
*rpal_wt_anaer_light_1_membrane_full.2516.2516.354.61390.4227863370.653371.791177.048.3%4R.TIAMDTTEGLVRGQEVTDTGAPISVPVGAGTLGR.I3
*rpal_wt_anaer_light_1_membrane_full.2518.2518.232.62780.508183372.163371.791192.025.0%1R.TIAMDTTEGLVRGQEVTDTGAPISVPVGAGTLGR.I2
*rpal_wt_anaer_light_1_membrane_1a.2156.2156.365.36840.5184022083.282083.311130.060.0%2R.GQEVTDTGAPISVPVGAGTLGR.I3
*rpal_wt_anaer_light_1_membrane_full.1931.1931.267.23620.6596742083.562083.311226.062.5%11R.GQEVTDTGAPISVPVGAGTLGR.I2
*rpal_wt_anaer_light_1_membrane_3.2096.2096.269.60270.7201342282.052282.621196.060.5%5R.IMNVIGEPVDEQGPIKSEGLR.A2
*rpal_wt_anaer_light_1_membrane_full.1921.1921.357.30430.4597492282.882282.621207.051.6%5R.IMNVIGEPVDEQGPIKSEGLR.A3
*rpal_wt_anaer_light_1_membrane_full.2157.2157.275.86530.7264942585.992586.86193.054.8%10R.AIHQEAPAYTDQSTEAEILVTGIK.V2
*rpal_wt_anaer_light_1_membrane_2.2562.2562.372.0430.5515872586.82586.861230.058.0%4R.AIHQEAPAYTDQSTEAEILVTGIK.V3
*rpal_wt_anaer_light_1_membrane_2a.4321.4321.364.57090.5560833654.613657.16174.052.9%5R.AIHQEAPAYTDQSTEAEILVTGIKVVDLLAPYAK.G3
*rpal_wt_anaer_light_1_membrane_5.2255.2255.237.19550.554643655.443657.161176.026.7%2R.AIHQEAPAYTDQSTEAEILVTGIKVVDLLAPYAK.G2
*rpal_wt_anaer_light_1_membrane_full.1802.1802.137.12720.5736661088.681089.321204.081.2%9K.VVDLLAPYAK.G1
*rpal_wt_anaer_light_1_pellet_1.2351.2351.252.7630.4453711090.691089.321244.077.8%9K.VVDLLAPYAK.G2
*rpal_wt_anaer_light_1_crude_1.1750.1750.239.68760.421908976.38976.1641198.066.7%3K.IGLFGGAGVGK.T2
*rpal_wt_anaer_light_1_membrane_1a.4137.4137.346.42330.3320192439.882440.891236.041.9%2K.IGLFGGAGVGKTVLIQELINNVAR.A3
*rpal_wt_anaer_light_1_membrane_full.3211.3211.141.65780.5875661482.931483.7516.075.0%3K.TVLIQELINNVAR.A1
*rpal_wt_anaer_light_1_membrane_full.3231.3231.277.63850.6327231484.671483.751199.087.0%18K.TVLIQELINNVAR.A2
*rpal_wt_anaer_light_1_membrane_1.3838.3838.388.90260.4961881485.061483.751252.076.9%2K.TVLIQELINNVAR.A3
*rpal_wt_anaer_light_1_membrane_4.1267.1267.143.08910.5793791406.781407.531164.076.2%3R.AHGGYSVFAGVGER.T1
*rpal_wt_anaer_light_1_membrane_1a.1416.1416.261.36530.7440771407.441407.53185.065.4%2R.AHGGYSVFAGVGER.T2
*rpal_wt_anaer_light_1_membrane_2a.1665.1665.262.25360.674692108.372109.261171.062.5%3R.TREGNDLYHEFIESGVNK.K2
*rpal_wt_anaer_light_1_membrane_1a.1911.1911.366.6520.596772109.262109.261255.050.0%2R.TREGNDLYHEFIESGVNK.K3
*rpal_wt_anaer_light_1_membrane_2a.1467.1467.249.16330.4867312237.362237.43181.055.9%2R.TREGNDLYHEFIESGVNKK.G2
*rpal_wt_anaer_light_1_membrane_full.1392.1392.255.91540.6432412809.962810.01180.045.7%3R.TREGNDLYHEFIESGVNKKGGGEGSK.C2
*rpal_wt_anaer_light_1_membrane_full.1386.1386.382.77160.5565772810.212810.011117.069.4%3R.TREGNDLYHEFIESGVNKKGGGEGSK.C3
*rpal_wt_anaer_light_1_membrane_2a.1437.1437.253.89030.6881462551.912552.7213.050.0%2R.EGNDLYHEFIESGVNKKGGGEGSK.C2
*rpal_wt_anaer_light_1_pellet_1.2457.2457.348.71680.4230431400.551400.621248.055.0%1R.VGLTGLTVAEHFR.D3
*rpal_wt_anaer_light_1_pellet_3.4459.4459.365.13780.5246123194.463195.611109.052.8%2R.VGLTGLTVAEHFRDQGQDVLFFVDNIFR.F3
*rpal_wt_anaer_light_1_membrane_full.3957.3957.267.20970.6991121813.61814.011247.070.4%6R.DQGQDVLFFVDNIFR.F2
*rpal_wt_anaer_light_1_pellet_1.4630.4630.362.37770.4157821813.851814.011247.060.4%2R.DQGQDVLFFVDNIFR.F3
*rpal_wt_anaer_light_1_membrane_full.2131.2131.126.57630.5743611435.731436.611133.045.5%2R.FTQAGSEVSALLGR.I1
*rpal_wt_anaer_light_1_membrane_1.2602.2602.354.33580.4896681436.561436.611219.063.0%1R.FTQAGSEVSALLGR.I3
*rpal_wt_anaer_light_1_membrane_2.2537.2537.277.32170.7356491438.411436.611229.080.8%6R.FTQAGSEVSALLGR.I2
*rpal_wt_anaer_light_1_membrane_full.3461.3461.391.08040.6393043636.433637.111116.063.8%8R.FTQAGSEVSALLGRIPSAVGYQPTLATDMGALQER.I3
*rpal_wt_anaer_light_1_membrane_full.2343.2343.270.68520.6766422218.692219.521171.064.9%8R.IPSAVGYQPTLATDMGALQER.I2
*rpal_wt_anaer_light_1_membrane_1a.2625.2625.362.01440.4955252218.962219.521222.047.8%2R.IPSAVGYQPTLATDMGALQER.I3
*rpal_wt_anaer_light_1_membrane_1a.1989.1989.361.96080.5885512021.612020.251252.044.4%2R.AISEKGIYPAVDPLDSTSR.M3
*rpal_wt_anaer_light_1_membrane_2a.1747.1747.262.99040.6741062021.882020.251244.066.7%3R.AISEKGIYPAVDPLDSTSR.M2
*rpal_wt_anaer_light_1_membrane_2.2162.2162.250.25820.6199151492.481491.64153.064.0%12K.GIYPAVDPLDSTSR.M2
*rpal_wt_anaer_light_1_membrane_5.918.918.133.86560.585891777.921778.98148.060.9%1R.MLSASIVGEEHYNTAR.M1
*rpal_wt_anaer_light_1_membrane_1.1743.1743.353.56070.4325631779.541778.981158.053.1%2R.MLSASIVGEEHYNTAR.M3
*rpal_wt_anaer_light_1_membrane_full.1432.1432.248.94490.5836731779.681778.981201.057.1%8R.MLSASIVGEEHYNTAR.M2
*rpal_wt_anaer_light_1_membrane_full.936.936.136.87840.356968987.62988.2391208.084.6%10R.MVQQILQK.Y1
*rpal_wt_anaer_light_1_membrane_full.941.941.254.72930.443499988.22988.2391181.086.7%10R.MVQQILQK.Y2
*rpal_wt_anaer_light_1_membrane_full.3663.3663.375.39730.5407412952.22952.41188.061.8%4K.YKSLQDIIAILGMDELSEEDKLTVAR.A3
*rpal_wt_anaer_light_1_membrane_4.3996.3996.274.93130.5709142953.192952.41171.054.3%2K.YKSLQDIIAILGMDELSEEDKLTVAR.A2
*rpal_wt_anaer_light_1_membrane_full.3893.3893.264.01890.6656382659.962661.051198.052.4%11K.SLQDIIAILGMDELSEEDKLTVAR.A2
*rpal_wt_anaer_light_1_membrane_2.4513.4513.363.29560.5336992660.672661.051213.049.3%19K.SLQDIIAILGMDELSEEDKLTVAR.A3
*rpal_wt_anaer_light_1_pellet_5.1827.1827.127.5070.4677541957.911959.25166.042.3%2R.FLSQPFFVAEVFTGSPGK.F1
*rpal_wt_anaer_light_1_membrane_1a.3660.3660.271.06530.6798131958.661959.251175.071.9%10R.FLSQPFFVAEVFTGSPGK.F2
*rpal_wt_anaer_light_1_membrane_full.3964.3964.245.90570.5720752961.292962.421131.039.1%5R.FLSQPFFVAEVFTGSPGKFVDLADTIK.G2
*rpal_wt_anaer_light_1_membrane_2a.4031.4031.353.64690.4446052962.022962.421194.047.2%5R.FLSQPFFVAEVFTGSPGKFVDLADTIK.G3
*rpal_wt_anaer_light_1_membrane_2a.4132.4132.346.99530.2968083323.483322.831149.045.0%1R.FLSQPFFVAEVFTGSPGKFVDLADTIKGFR.A3
*rpal_wt_anaer_light_1_membrane_full.1707.1707.140.41840.5205551021.611022.191214.085.7%4K.FVDLADTIK.G1
*rpal_wt_anaer_light_1_membrane_1.2108.2108.254.39240.5843461023.341022.191182.082.4%5K.FVDLADTIK.G2
*rpal_wt_anaer_light_1_membrane_1.2803.2803.257.41730.7132541382.571382.61111.068.2%3K.FVDLADTIKGFR.A2
*rpal_wt_anaer_light_1_membrane_full.2301.2301.350.81430.5223471383.491382.61205.052.6%1K.FVDLADTIKGFR.A3
*rpal_wt_anaer_light_1_membrane_full.3801.3801.251.91720.6137213015.03015.43196.041.3%4R.AICEGKYDHLPEAAFYMVGTIEEAVEK.G2
*rpal_wt_anaer_light_1_membrane_3.4223.4223.379.81990.5962393017.043015.431199.062.0%7R.AICEGKYDHLPEAAFYMVGTIEEAVEK.G3
*rpal_wt_anaer_light_1_membrane_2a.3531.3531.365.92560.4915213328.243328.831183.048.6%3R.AICEGKYDHLPEAAFYMVGTIEEAVEKGKK.L3
*rpal_wt_anaer_light_1_membrane_2.4478.4478.353.76340.3666272413.132413.711251.045.2%1K.YDHLPEAAFYMVGTIEEAVEK.G3
*rpal_wt_anaer_light_1_membrane_4.4199.4199.237.70320.4971592413.72413.711134.039.5%1K.YDHLPEAAFYMVGTIEEAVEK.G2

URPA40166028078.6%398434185.7metK methionine S-adenosyltransferase 4544761:4545957 reverse MW:43418
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_pellet_2.1678.1678.360.15130.46742633.72633.941141.047.8%2-.MRASYMFTSESVSEGHPDKVCDR.I3
*rpal_wt_anaer_light_1_pellet_3.1535.1535.249.34570.5728752345.912346.561254.045.9%3R.ASYMFTSESVSEGHPDKVCDR.I2
*rpal_wt_anaer_light_1_crude_full.2717.2717.141.65550.5863281369.681370.551212.076.5%8R.ISDEIVDLFYR.E1
*rpal_wt_anaer_light_1_cleared_full.2536.2536.272.50070.6013871369.811370.551247.085.0%8R.ISDEIVDLFYR.E2
*rpal_wt_anaer_light_1_cleared_2.2582.2582.261.49660.6068471781.561782.01173.065.4%11R.ISDEIVDLFYREGPK.A2
*rpal_wt_anaer_light_1_cleared_full.1530.1530.253.7050.355701998.94999.1581226.087.5%8K.AGIDPWAIR.A2
*rpal_wt_anaer_light_1_pellet_1a.570.570.240.01950.4493881123.611123.27149.063.2%1R.AACETLATTNK.V2
*rpal_wt_anaer_light_1_pellet_full.1490.1490.263.83890.667351948.81949.241191.060.6%7R.AACETLATTNKVVIAGETR.G2
*rpal_wt_anaer_light_1_pellet_1.1915.1915.349.03550.3218631949.861949.241252.037.7%3R.AACETLATTNKVVIAGETR.G3
*rpal_wt_anaer_light_1_pellet_3.2352.2352.350.40580.4174663557.83558.011216.041.9%1R.AACETLATTNKVVIAGETRGPASVTNEQIEQVVR.D3
*rpal_wt_anaer_light_1_pellet_2.2189.2189.348.32680.2564272454.162453.76124.046.9%1K.VVIAGETRGPASVTNEQIEQVVR.D3
*rpal_wt_anaer_light_1_cleared_1a.1586.1586.271.42210.6313371627.611627.81190.080.8%9R.GPASVTNEQIEQVVR.D2
*rpal_wt_anaer_light_1_crude_1.1874.1874.360.24560.2796321628.571627.81237.053.5%1R.GPASVTNEQIEQVVR.D3
*rpal_wt_anaer_light_1_cleared_5.1008.1008.143.73610.4856651630.051627.8156.072.7%8R.GPASVTNEQIEQVVR.D1
*rpal_wt_anaer_light_1_pellet_5.1165.1165.128.90380.3704841936.741937.12129.045.8%1R.DAIKDIGYEQEGFHWK.T1
*rpal_wt_anaer_light_1_crude_full.1722.1722.274.46680.6724311936.911937.121176.079.3%5R.DAIKDIGYEQEGFHWK.T2
*rpal_wt_anaer_light_1_crude_1.2084.2084.365.73080.5409241937.331937.121253.062.5%7R.DAIKDIGYEQEGFHWK.T3
*rpal_wt_anaer_light_1_pellet_full.1262.1262.345.30680.185372865.452865.221214.044.8%2K.EKVLGPDSKSQVTIQYENGKPQYVR.E3
*rpal_wt_anaer_light_1_pellet_full.333.333.134.73370.273075715.52715.8251248.083.3%3K.VLGPDSK.S1
*rpal_wt_anaer_light_1_pellet_1.1639.1639.347.15930.3249311911.161911.13185.046.0%5K.SQVTIQYENGKPQYVR.E3
*rpal_wt_anaer_light_1_cleared_full.1010.1010.262.01990.7009331911.371911.131180.071.4%10K.SQVTIQYENGKPQYVR.E2
*rpal_wt_anaer_light_1_pellet_full.1872.1872.265.61330.6208852218.052218.481103.064.7%9R.EIVVSHQHLIEDLSSNQIR.D2
*rpal_wt_anaer_light_1_pellet_1a.2178.2178.378.84430.5744542219.762218.481223.063.2%4R.EIVVSHQHLIEDLSSNQIR.D3
*rpal_wt_anaer_light_1_cleared_full.2260.2260.233.91550.4614533179.73180.571208.029.8%4R.EIVVSHQHLIEDLSSNQIRDCVEPYVR.Q2
*rpal_wt_anaer_light_1_crude_2a.2231.2231.362.28160.5142393181.953180.571219.045.9%9R.EIVVSHQHLIEDLSSNQIRDCVEPYVR.Q3
*rpal_wt_anaer_light_1_pellet_1.1238.1238.233.27170.337401981.23981.1171232.060.0%3R.DCVEPYVR.Q2
*rpal_wt_anaer_light_1_pellet_3.2990.2990.246.29920.5190022377.922378.6517.047.2%6R.QALPDGWITDNTIWHINPTGK.F2
*rpal_wt_anaer_light_1_cleared_full.2621.2621.351.29880.4624122378.382378.65189.049.2%4R.QALPDGWITDNTIWHINPTGK.F3
*rpal_wt_anaer_light_1_pellet_2a.1616.1616.126.56490.3712081525.711526.651208.045.8%1K.FYIGGPDGDTGLTGR.K1
*rpal_wt_anaer_light_1_crude_1a.2059.2059.267.46390.5697541526.381526.65194.078.6%4K.FYIGGPDGDTGLTGR.K2
*rpal_wt_anaer_light_1_cleared_1a.1426.1426.260.16920.5764081654.511654.821205.060.0%5K.FYIGGPDGDTGLTGRK.I2
*rpal_wt_anaer_light_1_crude_1.1671.1671.346.12290.2800131657.131654.821228.052.1%2K.FYIGGPDGDTGLTGRK.I3
*rpal_wt_anaer_light_1_pellet_4.1445.1445.246.79120.612542445.152445.741113.040.9%3R.KIIVDTYGGAAPHGGGAFSGKDPTK.V2
*rpal_wt_anaer_light_1_cleared_4.1116.1116.260.78960.614652815.142816.151162.052.0%5R.KIIVDTYGGAAPHGGGAFSGKDPTKVDR.S2
*rpal_wt_anaer_light_1_cleared_full.1075.1075.363.08320.4800452815.972816.151207.051.2%4R.KIIVDTYGGAAPHGGGAFSGKDPTKVDR.S3
*rpal_wt_anaer_light_1_cleared_2a.1155.1155.252.23630.5344922686.992687.971162.044.9%4K.IIVDTYGGAAPHGGGAFSGKDPTKVDR.S2
*rpal_wt_anaer_light_1_cleared_2.1343.1343.352.41570.4678462687.322687.971239.043.5%4K.IIVDTYGGAAPHGGGAFSGKDPTKVDR.S3
*rpal_wt_anaer_light_1_pellet_full.668.668.143.99840.596756973.5974.1031105.087.5%12K.NVVASGLADK.C1
*rpal_wt_anaer_light_1_crude_1.680.680.238.67890.528769974.28974.1031210.063.2%7K.NVVASGLADK.C2
*rpal_wt_anaer_light_1_pellet_2a.3417.3417.353.37170.442513717.643718.31116.043.5%4K.NVVASGLADKCTLQLAYAIGVARPLSIYIDTHGTGK.V3
*rpal_wt_anaer_light_1_pellet_full.3757.3757.2100.4260.7378932146.242146.471235.078.8%12K.VSEDKLETIVAEVMDLTPR.G2
*rpal_wt_anaer_light_1_cleared_1a.3928.3928.356.07670.413842146.732146.471212.050.8%7K.VSEDKLETIVAEVMDLTPR.G3
*rpal_wt_anaer_light_1_cleared_1a.1234.1234.237.24780.4548031767.581768.071192.050.0%1R.GIRTHLDLNKPIYAR.T2
*rpal_wt_anaer_light_1_cleared_full.1071.1071.361.28120.383231769.731768.071207.055.6%2R.GIRTHLDLNKPIYAR.T3
*rpal_wt_anaer_light_1_crude_full.1014.1014.263.79760.6790981441.431441.671190.077.3%9R.THLDLNKPIYAR.T2
*rpal_wt_anaer_light_1_cleared_1.1178.1178.355.21670.5629041442.951441.671234.065.7%5R.THLDLNKPIYAR.T3
*rpal_wt_anaer_light_1_crude_4.1046.1046.141.30280.5874981443.861441.671194.077.8%9R.THLDLNKPIYAR.T1
*rpal_wt_anaer_light_1_pellet_1.636.636.232.04770.3344981009.451012.071112.058.8%1R.TSSYGHFGR.T2
*rpal_wt_anaer_light_1_crude_2.1740.1740.350.48650.4510792302.932303.411188.045.2%2R.TSSYGHFGRTPDADGGFSWEK.T3
*rpal_wt_anaer_light_1_cleared_2a.1337.1337.249.71340.6012812303.272303.411232.052.8%1R.TSSYGHFGRTPDADGGFSWEK.T2
*rpal_wt_anaer_light_1_cleared_3.2098.2098.363.210.4988013151.723149.38113.052.7%2R.TSSYGHFGRTPDADGGFSWEKTDLADAMK.R3
*rpal_wt_anaer_light_1_crude_full.1304.1304.131.83870.5549851309.541310.361178.063.2%4R.TPDADGGFSWEK.T1
*rpal_wt_anaer_light_1_crude_1.1549.1549.260.17080.6914151310.521310.361182.081.8%4R.TPDADGGFSWEK.T2
*rpal_wt_anaer_light_1_cleared_3.2214.2214.252.18560.6560792155.912156.3311.050.0%3R.TPDADGGFSWEKTDLADAMK.R2
*rpal_wt_anaer_light_1_cleared_1a.2232.2232.345.98190.3575672156.32156.33148.043.9%2R.TPDADGGFSWEKTDLADAMK.R3
*rpal_wt_anaer_light_1_cleared_3.2005.2005.243.29690.5392532312.042312.5213.045.9%3R.TPDADGGFSWEKTDLADAMKR.A2
*rpal_wt_anaer_light_1_crude_1a.2346.2346.345.79640.3642452313.182312.521200.044.6%1R.TPDADGGFSWEKTDLADAMKR.A3
*rpal_wt_anaer_light_1_pellet_full.780.780.131.65620.448576864.29864.9951178.069.2%5K.TDLADAMK.R1
*rpal_wt_anaer_light_1_pellet_1a.950.950.237.05450.470291865.44864.9951224.073.3%2K.TDLADAMK.R2
*rpal_wt_anaer_light_1_pellet_1.926.926.247.08650.4239241021.481021.181114.076.5%7K.TDLADAMKR.A2

URPA269271978.5%130143684.2rnpO RNA polymerase omega subunit 3063234:3063626 forward MW:14368
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_pellet_full.1844.1844.360.88070.4813532515.762515.851195.057.4%3R.MISSGSPLTIDRDNDKNPVVSLR.E3
*rpal_wt_anaer_light_1_pellet_2.1783.1783.242.59290.5299151462.271459.591156.050.0%1R.EIADQTISPEDLK.E2
*rpal_wt_anaer_light_1_pellet_full.2649.2649.245.37020.5111922523.132523.8135.041.0%5R.EIADQTISPEDLKEELVHSLQK.F2
*rpal_wt_anaer_light_1_pellet_3.797.797.132.41510.5249341082.681083.231162.071.4%1K.EELVHSLQK.F1
*rpal_wt_anaer_light_1_pellet_5.1551.1551.232.41120.4280313464.833462.72120.025.4%1K.FVEVDEPEPDTVPLIGSAGASVDADDTEVAMER.M2
*rpal_wt_anaer_light_1_pellet_3.1352.1352.127.37290.438145992.68993.166157.075.0%2R.MTEEELLK.G1
*rpal_wt_anaer_light_1_crude_2a.2865.2865.256.31440.5739792713.292713.931204.044.2%6R.MTEEELLKGLEGLAPPEEQPEEDE.-2

URPA32538539178.1%690756015.4fusA, EF-G elongation factor G 3661155:3663227 reverse MW:75601
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_crude_1.623.623.230.42510.1977251255.961256.411192.055.6%1M.PRVHAIEDYR.N2
*rpal_wt_anaer_light_1_pellet_1.781.781.349.02940.4011571257.221256.411248.067.9%1M.PRVHAIEDYR.N3
*rpal_wt_anaer_light_1_crude_3.1474.1474.255.29610.605161964.731964.211185.051.5%2R.NFGIMAHIDAGKTTTTER.I2
*rpal_wt_anaer_light_1_cleared_full.1090.1090.135.21450.537915841.42842.0261225.090.0%7R.ILFYTGK.S1
*rpal_wt_anaer_light_1_pellet_3.1915.1915.247.37650.643612318.332319.5412.051.4%1K.IGEVHEGAATMDWMTQEQER.G2
*rpal_wt_anaer_light_1_crude_1a.2410.2410.234.37910.4729851795.691796.041246.035.5%2R.GITITSAATTAFWNGKR.L2
*rpal_wt_anaer_light_1_cleared_2a.2371.2371.251.27340.6303832616.642616.911232.047.6%6R.VLDGAVCVLDSNQGVEPQTETVWR.Q2
*rpal_wt_anaer_light_1_cleared_2.596.596.129.50730.0937327693.0691.849188.090.0%2R.IVFANK.M1
*rpal_wt_anaer_light_1_crude_3.1052.1052.132.01990.4583281160.691160.341102.068.8%1K.MDKTGADFFK.C1
*rpal_wt_anaer_light_1_cleared_1a.3272.3272.346.04720.3733042104.972103.431194.048.4%1K.MDKTGADFFKCLQDIVDR.L3
*rpal_wt_anaer_light_1_cleared_2.947.947.127.08320.32635785.75785.875160.080.0%1K.TGADFFK.C1
*rpal_wt_anaer_light_1_cleared_1.3663.3663.359.75110.4522711729.711728.971223.062.8%1K.TGADFFKCLQDIVDR.L3
*rpal_wt_anaer_light_1_pellet_1.2678.2678.364.74050.487931997.731997.351122.056.4%4R.LGAKPVAIQLPIGSENNFK.G3
*rpal_wt_anaer_light_1_crude_2a.1919.1919.249.17510.5768631998.01997.351195.051.5%5R.LGAKPVAIQLPIGSENNFK.G2
*rpal_wt_anaer_light_1_crude_1a.3319.3319.377.53710.5765252750.222750.261181.057.3%10R.LGAKPVAIQLPIGSENNFKGVIDLVR.M3
*rpal_wt_anaer_light_1_pellet_4.3036.3036.255.08290.6343782750.912750.261168.051.1%4R.LGAKPVAIQLPIGSENNFKGVIDLVR.M2
*rpal_wt_anaer_light_1_crude_1.1617.1617.232.85620.4061521288.721289.431106.052.4%1K.AVVWNDESLGAK.F2
*rpal_wt_anaer_light_1_crude_4.1377.1377.128.60840.4211141288.811289.431109.061.1%1K.AVVWNDESLGAK.F1
*rpal_wt_anaer_light_1_pellet_2a.2349.2349.145.42160.5908091688.711689.861167.077.3%7K.FEDAEIPAELLDQAK.E1
*rpal_wt_anaer_light_1_cleared_1.2710.2710.355.80040.4263051688.91689.861207.045.8%1K.FEDAEIPAELLDQAK.E3
*rpal_wt_anaer_light_1_crude_1a.2843.2843.264.4790.6259061689.841689.861177.070.4%9K.FEDAEIPAELLDQAK.E2
*rpal_wt_anaer_light_1_crude_2a.2370.2370.255.28430.6299582137.592138.341140.060.6%7K.FEDAEIPAELLDQAKEYR.E2
*rpal_wt_anaer_light_1_cleared_2.2711.2711.358.34910.5616062139.882138.341220.050.9%7K.FEDAEIPAELLDQAKEYR.E3
*rpal_wt_anaer_light_1_cleared_2a.2168.2168.248.68270.5981262394.752395.631208.050.0%4K.FEDAEIPAELLDQAKEYREK.M2
*rpal_wt_anaer_light_1_cleared_2.2445.2445.356.25030.4048512395.312395.631150.050.0%3K.FEDAEIPAELLDQAKEYREK.M3
*rpal_wt_anaer_light_1_cleared_5.1474.1474.152.61840.6894761871.951873.271224.080.8%3R.KAVLTGAFYPVLCGSAFK.N1
*rpal_wt_anaer_light_1_cleared_1a.2701.2701.270.42360.7233341872.71873.271247.069.7%8R.KAVLTGAFYPVLCGSAFK.N2
*rpal_wt_anaer_light_1_cleared_1a.2697.2697.365.18160.5711111873.41873.271255.051.7%1R.KAVLTGAFYPVLCGSAFK.N3
*rpal_wt_anaer_light_1_crude_2a.2789.2789.134.69810.5194581744.821745.091176.056.0%1K.AVLTGAFYPVLCGSAFK.N1
*rpal_wt_anaer_light_1_pellet_2.3431.3431.259.48340.6956131745.591745.091232.064.5%8K.AVLTGAFYPVLCGSAFK.N2
*rpal_wt_anaer_light_1_pellet_1.3723.3723.369.61110.5831641747.281745.091254.059.6%1K.AVLTGAFYPVLCGSAFK.N3
*rpal_wt_anaer_light_1_crude_full.3803.3803.267.92440.6170922661.962663.131230.050.0%4K.NKGVQPLLDAVVDYLPSPLDVPAIK.G2
*rpal_wt_anaer_light_1_cleared_4.3471.3471.351.86640.3542543835.03834.361105.043.7%2K.NKGVQPLLDAVVDYLPSPLDVPAIKGTDDKGNEVVR.K3
*rpal_wt_anaer_light_1_crude_2a.3654.3654.265.82030.6569012419.982420.851207.055.0%3K.GVQPLLDAVVDYLPSPLDVPAIK.G2
*rpal_wt_anaer_light_1_cleared_2a.1597.1597.146.41170.6033331574.841575.851166.061.9%1R.KADDKEPLSLLAFK.I1
*rpal_wt_anaer_light_1_crude_1a.2191.2191.253.68290.5589731575.481575.851208.064.0%6R.KADDKEPLSLLAFK.I2
*rpal_wt_anaer_light_1_cleared_1a.1812.1812.359.09750.4724571578.221575.851122.065.9%6R.KADDKEPLSLLAFK.I3
*rpal_wt_anaer_light_1_crude_4.2178.2178.135.64390.5376381446.921447.671244.055.0%2K.ADDKEPLSLLAFK.I1
*rpal_wt_anaer_light_1_cleared_full.2553.2553.281.83610.6966581615.321615.911227.080.8%7K.IMDDPFVGTITFCR.I2
*rpal_wt_anaer_light_1_crude_1a.2310.2310.243.45690.2943081723.641723.97128.050.0%5R.IYSGVLLSGTGVVNSTR.E2
*rpal_wt_anaer_light_1_crude_2.1110.1110.237.96160.3970121584.11585.8919.054.2%1R.MLLMHANNREDIK.E2
*rpal_wt_anaer_light_1_cleared_3.2663.2663.356.31540.3753382959.362958.4819.045.3%1R.MLLMHANNREDIKEAYAGDIVALAGLK.E3
*rpal_wt_anaer_light_1_cleared_3.2459.2459.361.23240.4263763315.43314.861204.051.2%2R.MLLMHANNREDIKEAYAGDIVALAGLKEAR.T3
*rpal_wt_anaer_light_1_crude_2.2781.2781.237.22530.5931581391.551391.611227.050.0%1K.EAYAGDIVALAGLK.E2
*rpal_wt_anaer_light_1_crude_2a.2290.2290.134.86470.4867271392.931391.611152.066.7%1K.EAYAGDIVALAGLK.E1
*rpal_wt_anaer_light_1_crude_full.1784.1784.144.27150.525411685.871686.921187.052.0%9R.TGDTLCDPANPVILEK.M1
*rpal_wt_anaer_light_1_cleared_2.1855.1855.277.57040.7011331686.31686.921221.075.9%10R.TGDTLCDPANPVILEK.M2
*rpal_wt_anaer_light_1_cleared_full.2810.2810.136.76210.6503711741.771743.071105.060.9%11K.MEFPEPVIEIAIEPK.S1
*rpal_wt_anaer_light_1_cleared_full.2795.2795.259.75510.6070091742.681743.07182.067.9%17K.MEFPEPVIEIAIEPK.S2
*rpal_wt_anaer_light_1_cleared_4.679.679.141.2370.3972381457.81458.71186.068.4%1K.SKADQEKLGVALAK.L1
*rpal_wt_anaer_light_1_cleared_2.741.741.259.49010.5816211460.251458.7173.070.8%1K.SKADQEKLGVALAK.L2
*rpal_wt_anaer_light_1_crude_1a.1133.1133.125.42420.0948703671.63671.859138.072.7%2K.LGVALAK.L1
*rpal_wt_anaer_light_1_cleared_1a.761.761.240.73270.3026861005.981006.11212.070.6%8K.LAAEDPSFR.V2
*rpal_wt_anaer_light_1_cleared_4.1329.1329.136.6830.5745111390.831391.561164.070.0%7R.VSTDLESGQTILK.G1
*rpal_wt_anaer_light_1_cleared_1a.1451.1451.266.12780.6352251391.571391.561202.082.6%13R.VSTDLESGQTILK.G2
*rpal_wt_anaer_light_1_crude_full.1442.1442.129.46680.271741112.611113.321220.072.7%2K.GMGELHLDIK.V1
*rpal_wt_anaer_light_1_cleared_1a.1708.1708.271.18960.6671511751.041751.01223.073.1%9R.TYKVDANIGAPQVAFR.E2
*rpal_wt_anaer_light_1_cleared_1.1845.1845.369.71480.5675511752.381751.01245.062.8%5R.TYKVDANIGAPQVAFR.E3
*rpal_wt_anaer_light_1_cleared_2.1542.1542.242.67420.5674831656.471656.961181.051.7%2K.IVGGAVPKEYIPGVEK.G2
*rpal_wt_anaer_light_1_cleared_1a.1522.1522.359.71910.5214361657.551656.961185.051.1%1K.IVGGAVPKEYIPGVEK.G3
*rpal_wt_anaer_light_1_cleared_2a.3588.3588.346.89820.2815743600.243598.221231.038.6%1K.IVGGAVPKEYIPGVEKGIESVLSSGVVAGFPVVDVK.V3
*rpal_wt_anaer_light_1_cleared_full.783.783.130.14620.429149934.45935.0651195.076.9%5K.EYIPGVEK.G1
*rpal_wt_anaer_light_1_membrane_3.4110.4110.351.49260.2635312876.332876.321227.041.0%4K.EYIPGVEKGIESVLSSGVVAGFPVVDVK.V3
*rpal_wt_anaer_light_1_cleared_full.3470.3470.256.89310.6224522876.842876.32156.048.0%3K.EYIPGVEKGIESVLSSGVVAGFPVVDVK.V2
*rpal_wt_anaer_light_1_cleared_full.2945.2945.271.37720.681461959.591960.281253.063.9%24K.GIESVLSSGVVAGFPVVDVK.V2
*rpal_wt_anaer_light_1_crude_1.3639.3639.368.75220.5544521960.461960.281248.059.0%5K.GIESVLSSGVVAGFPVVDVK.V3
*rpal_wt_anaer_light_1_crude_5.1813.1813.152.70420.6250371962.091960.281115.058.1%10K.GIESVLSSGVVAGFPVVDVK.V1
*rpal_wt_anaer_light_1_pellet_3.1995.1995.253.23930.6545881782.861781.92194.055.2%2K.YHDVDSSALAFEIASR.A2
*rpal_wt_anaer_light_1_cleared_2a.429.429.131.47390.3480571033.91034.2117.084.6%2R.AAFREALQK.G1
*rpal_wt_anaer_light_1_cleared_4.560.560.127.93340.3878731218.961219.43110.056.2%1R.AAFREALQKGK.S1
*rpal_wt_anaer_light_1_cleared_1.606.606.239.44740.4643371219.451219.431176.063.2%1R.AAFREALQKGK.S2
*rpal_wt_anaer_light_1_crude_4.1375.1375.138.82120.3562621214.931215.541236.070.6%3K.GKSVLLEPIMK.V1
*rpal_wt_anaer_light_1_crude_1.1615.1615.238.26090.4508731215.341215.541153.060.0%1K.GKSVLLEPIMK.V2
*rpal_wt_anaer_light_1_cleared_full.1493.1493.240.07930.3888971031.441030.321235.064.7%4K.SVLLEPIMK.V2
*rpal_wt_anaer_light_1_cleared_2a.1479.1479.138.59840.3805081032.411030.321174.078.6%9K.SVLLEPIMK.V1
*rpal_wt_anaer_light_1_cleared_2a.3138.3138.367.71290.4195173161.83162.63179.055.1%3K.SVLLEPIMKVEVVTPEDYTGSVIGDLNSR.R3
*rpal_wt_anaer_light_1_cleared_2a.3136.3136.252.81250.5884993162.533162.631228.037.3%2K.SVLLEPIMKVEVVTPEDYTGSVIGDLNSR.R2
*rpal_wt_anaer_light_1_crude_2a.2315.2315.279.2860.7603862152.32151.341170.069.4%11K.VEVVTPEDYTGSVIGDLNSR.R2
*rpal_wt_anaer_light_1_pellet_2.2881.2881.365.1280.4944142153.552151.341235.057.4%3K.VEVVTPEDYTGSVIGDLNSR.R3
*rpal_wt_anaer_light_1_cleared_4.4480.4480.267.6220.6707312553.432554.031168.060.0%13R.GNANVINAMVPLMNMFGYVNNLR.S2
*rpal_wt_anaer_light_1_cleared_full.4134.4134.385.31560.6385162553.612554.031250.066.2%7R.GNANVINAMVPLMNMFGYVNNLR.S3
*rpal_wt_anaer_light_1_cleared_full.1980.1980.259.34850.647752568.852569.811184.056.1%4R.ANFTMQFDHYAEAPANVSAEVQK.K2
*rpal_wt_anaer_light_1_cleared_full.1974.1974.365.80030.4401972569.12569.811219.056.7%3R.ANFTMQFDHYAEAPANVSAEVQK.K3
*rpal_wt_anaer_light_1_crude_full.1984.1984.264.81640.6876442696.652697.991217.051.2%7R.ANFTMQFDHYAEAPANVSAEVQKK.F2
*rpal_wt_anaer_light_1_cleared_1a.2062.2062.379.38060.555572697.62697.991239.060.3%12R.ANFTMQFDHYAEAPANVSAEVQKK.F3

URPA2919194577.4%186207647.6rrf ribosome releasing factor 3299823:3300383 reverse MW:20764
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_cleared_2a.899.899.130.21310.4822081194.741195.321172.060.0%1M.SDKFDVNELK.R1
*rpal_wt_anaer_light_1_cleared_1.1049.1049.241.87010.2311031351.721351.51184.065.0%1M.SDKFDVNELKR.R2
*rpal_wt_anaer_light_1_cleared_1.1043.1043.353.58660.4456191352.531351.51230.062.9%2M.SDKFDVNELKR.R3
*rpal_wt_anaer_light_1_cleared_full.1264.1264.252.92450.6691681696.631696.971208.056.7%3R.MQGAAQSLKHELGGLR.T2
*rpal_wt_anaer_light_1_cleared_5.1429.1429.240.17370.5505923381.993382.841144.026.8%4R.ASASMLEPVQVDAYGSHMPLNQVATVSVPEPR.L2
*rpal_wt_anaer_light_1_cleared_3.2695.2695.360.34430.5240733382.773382.841212.044.6%3R.ASASMLEPVQVDAYGSHMPLNQVATVSVPEPR.L3
*rpal_wt_anaer_light_1_pellet_3.1918.1918.126.18840.4158561087.741088.291177.064.3%1R.LISVQVWDK.S1
*rpal_wt_anaer_light_1_cleared_3.1911.1911.268.84530.6202342354.022354.671236.056.1%2K.AVEKGIVDSNLGLSPATEGQVIR.L2
*rpal_wt_anaer_light_1_cleared_5.1221.1221.137.84490.5094321926.081927.171132.062.1%1K.GIVDSNLGLSPATEGQVIR.L1
*rpal_wt_anaer_light_1_crude_1a.2445.2445.274.01270.6497451926.881927.171224.070.6%6K.GIVDSNLGLSPATEGQVIR.L2
*rpal_wt_anaer_light_1_cleared_1.2311.2311.351.88980.3683861927.131927.171175.052.5%2K.GIVDSNLGLSPATEGQVIR.L3
*rpal_wt_anaer_light_1_cleared_1.1522.1522.246.08250.3951721269.551269.441237.066.7%1R.LRIPELNEER.R2
*rpal_wt_anaer_light_1_cleared_1.1530.1530.348.26240.4401151271.431269.441244.054.5%1R.LRIPELNEER.R3
*rpal_wt_anaer_light_1_cleared_2.1021.1021.232.52470.3612051419.371416.66144.045.5%1R.RDGLDTIKKLEK.A2
*rpal_wt_anaer_light_1_cleared_3.3938.3938.357.45420.4035022911.812912.27144.052.1%1K.RLDQEVQKATDAAIAEIDQLLANKEK.E3
*rpal_wt_anaer_light_1_cleared_2a.4200.4200.353.18750.335093468.043467.94121.048.8%1K.RLDQEVQKATDAAIAEIDQLLANKEKEILTV.-3
*rpal_wt_anaer_light_1_crude_3.2821.2821.249.68260.4626491916.321915.1518.051.5%2K.ATDAAIAEIDQLLANKEK.E2
*rpal_wt_anaer_light_1_cleared_full.3490.3490.244.88710.4016432469.832470.8219.047.5%5K.ATDAAIAEIDQLLANKEKEILTV.-2
*rpal_wt_anaer_light_1_cleared_1a.3826.3826.366.03740.4994062471.92470.821243.054.5%7K.ATDAAIAEIDQLLANKEKEILTV.-3

URPA11408037477.0%547576265.5groEL1 chaperonin GroEL1, cpn60 1247853:1249496 reverse MW:57626
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_pellet_1a.2184.2184.252.35170.5996521387.51386.71186.066.7%5R.MLRGVDVLANAVK.V2
*rpal_wt_anaer_light_1_pellet_1.2367.2367.346.38070.2777231387.971386.71234.050.0%1R.MLRGVDVLANAVK.V3
*rpal_wt_anaer_light_1_pellet_full.1398.1398.131.36390.41931985.63986.157145.066.7%6R.GVDVLANAVK.V1
*rpal_wt_anaer_light_1_crude_full.1275.1275.259.40280.516528986.45986.1571251.084.2%1R.GVDVLANAVK.V2
rpal_wt_anaer_light_1_crude_1.463.463.128.71220.227025616.4614.7631233.080.0%2K.VTLGPK.G11
*rpal_wt_anaer_light_1_cleared_1a.448.448.128.27630.12351716.51715.8681156.080.0%1R.NVLIEK.S1
rpal_wt_anaer_light_1_crude_1a.779.779.136.0950.294235634.46634.713119.0100.0%5K.SFGAPR.I11
rpal_wt_anaer_light_1_pellet_full.422.422.132.02860.3770221031.641032.231240.062.5%6R.ITKDGVTVAK.E11
rpal_wt_anaer_light_1_pellet_full.424.424.243.76170.5651931033.571032.231152.063.2%4R.ITKDGVTVAK.E22
*rpal_wt_anaer_light_1_pellet_full.2430.2430.375.20250.4838723038.943039.5154.062.2%2R.ITKDGVTVAKEVELEDKFENMGAQMVR.E3
*rpal_wt_anaer_light_1_pellet_2a.2282.2282.250.32330.6032373039.033039.51129.037.5%2R.ITKDGVTVAKEVELEDKFENMGAQMVR.E2
rpal_wt_anaer_light_1_crude_1a.713.713.125.70990.335069689.47689.7871130.072.7%1K.DGVTVAK.E11
*rpal_wt_anaer_light_1_pellet_4.2696.2696.258.82090.6198392697.032697.061103.050.0%6K.DGVTVAKEVELEDKFENMGAQMVR.E2
*rpal_wt_anaer_light_1_pellet_full.2625.2625.368.90990.462052698.012697.06193.054.7%4K.DGVTVAKEVELEDKFENMGAQMVR.E3
*rpal_wt_anaer_light_1_pellet_full.2217.2217.260.33870.557382025.942026.31119.066.7%5K.EVELEDKFENMGAQMVR.E2
*rpal_wt_anaer_light_1_pellet_1.2780.2780.360.94540.4524182026.652026.31170.059.3%2K.EVELEDKFENMGAQMVR.E3
*rpal_wt_anaer_light_1_pellet_1a.3118.3118.362.55630.4872092089.352089.311181.045.6%3K.TNDLAGDGTTTATVLAQAIVR.E3
*rpal_wt_anaer_light_1_pellet_full.2722.2722.274.61210.6468752089.762089.311251.065.8%8K.TNDLAGDGTTTATVLAQAIVR.E2
rpal_wt_anaer_light_1_pellet_1a.1848.1848.265.49090.680831217.751218.481175.077.3%9K.AVAAGMNPMDLK.R22
rpal_wt_anaer_light_1_cleared_4.1360.1360.146.25680.4356641220.91218.481255.066.7%12K.AVAAGMNPMDLK.R11
rpal_wt_anaer_light_1_crude_full.1198.1198.135.35880.448161373.661374.671106.068.4%7K.AVAAGMNPMDLKR.G11
rpal_wt_anaer_light_1_crude_1.1425.1425.345.07340.4263161374.81374.671190.051.3%1K.AVAAGMNPMDLKR.G33
rpal_wt_anaer_light_1_pellet_full.1333.1333.269.78570.6859591375.571374.671172.082.6%7K.AVAAGMNPMDLKR.G22
*rpal_wt_anaer_light_1_pellet_1.2797.2797.363.72950.4976271867.981867.251186.053.7%1K.RGIEIAVAAVVKDIQKR.A3
*rpal_wt_anaer_light_1_pellet_2.2925.2925.254.99660.5750681710.981711.061124.062.1%1R.GIEIAVAAVVKDIQKR.A2
*rpal_wt_anaer_light_1_pellet_1.3203.3203.348.55040.4157271712.151711.061234.057.1%2R.GIEIAVAAVVKDIQKR.A3
*rpal_wt_anaer_light_1_pellet_4.1724.1724.250.90290.6084052609.492609.941204.045.8%1K.RAKPVASSAEIAQVGTISANGDAPIGK.M2
*rpal_wt_anaer_light_1_pellet_1a.2059.2059.354.86590.437582453.72453.761110.050.7%3R.AKPVASSAEIAQVGTISANGDAPIGK.M3
*rpal_wt_anaer_light_1_pellet_full.1755.1755.286.87330.6503792453.982453.761237.067.4%7R.AKPVASSAEIAQVGTISANGDAPIGK.M2
*rpal_wt_anaer_light_1_crude_1a.906.906.138.90460.543458920.45921.1721241.084.6%7K.MIAQAMQK.V1
*rpal_wt_anaer_light_1_pellet_full.483.483.249.0910.485313921.14921.1721166.081.2%3K.MIAQAMQK.V2
*rpal_wt_anaer_light_1_pellet_2a.1008.1008.133.6440.4921771387.671388.52154.060.0%4K.VGNEGVITVEENK.S1
*rpal_wt_anaer_light_1_pellet_1.1482.1482.265.43740.7077961388.321388.521226.087.0%8K.VGNEGVITVEENK.S2
*rpal_wt_anaer_light_1_pellet_3.2964.2964.383.0190.6363112819.412820.151245.067.6%2K.VGNEGVITVEENKSLETEVDIVEGMK.F3
*rpal_wt_anaer_light_1_pellet_4.2473.2473.136.53660.5608131449.771450.651184.070.0%3K.SLETEVDIVEGMK.F1
*rpal_wt_anaer_light_1_pellet_2.2690.2690.269.22760.7388241450.671450.651245.082.6%5K.SLETEVDIVEGMK.F2
*rpal_wt_anaer_light_1_pellet_full.2019.2019.241.91630.2099761907.571908.121101.048.3%1K.FDRGYLSPYFVTNAEK.M2
*rpal_wt_anaer_light_1_pellet_full.1982.1982.263.16260.6436691489.561489.671165.079.2%8R.GYLSPYFVTNAEK.M2
*rpal_wt_anaer_light_1_pellet_4.2080.2080.146.81820.6179581491.681489.67155.078.9%9R.GYLSPYFVTNAEK.M1
*rpal_wt_anaer_light_1_pellet_2.2954.2954.271.40790.6508791790.431791.071219.074.1%14K.MTVELDDAYILLHEK.K2
*rpal_wt_anaer_light_1_pellet_full.2624.2624.357.34620.4752541791.131791.071212.058.7%5K.MTVELDDAYILLHEK.K3
*rpal_wt_anaer_light_1_pellet_5.1516.1516.143.66150.6161521792.881791.071147.078.3%6K.MTVELDDAYILLHEK.K1
*rpal_wt_anaer_light_1_pellet_2a.2144.2144.137.54980.5253481917.851919.25184.066.7%1K.MTVELDDAYILLHEKK.L1
*rpal_wt_anaer_light_1_pellet_1a.2645.2645.345.18330.3816591919.881919.251178.045.1%1K.MTVELDDAYILLHEKK.L3
*rpal_wt_anaer_light_1_pellet_3.2394.2394.263.95830.7028831922.241919.251222.071.4%2K.MTVELDDAYILLHEKK.L2
*rpal_wt_anaer_light_1_pellet_4.3728.3728.254.54490.4030642428.732429.88176.052.5%5R.KAMLEDIAILTGGQLISEDLGIK.L2
*rpal_wt_anaer_light_1_pellet_3.4186.4186.357.30160.3912533216.343214.83126.046.3%2R.KAMLEDIAILTGGQLISEDLGIKLETVTLK.M3
*rpal_wt_anaer_light_1_pellet_full.4099.4099.251.73740.6632922300.872301.71191.047.4%11K.AMLEDIAILTGGQLISEDLGIK.L2
*rpal_wt_anaer_light_1_pellet_2.4552.4552.353.58270.4568062302.932301.711174.046.2%2K.AMLEDIAILTGGQLISEDLGIK.L3
*rpal_wt_anaer_light_1_pellet_full.5320.5320.345.66310.2394583083.793086.66159.040.3%1K.AMLEDIAILTGGQLISEDLGIKLETVTLK.M3
*rpal_wt_anaer_light_1_crude_4.1013.1013.253.35680.6108522809.162810.27173.046.7%1R.AKKVVIDKENTTIVNGAGKKPEIEAR.V2
*rpal_wt_anaer_light_1_pellet_3.1216.1216.364.71340.3877982810.212810.271231.057.5%2R.AKKVVIDKENTTIVNGAGKKPEIEAR.V3
*rpal_wt_anaer_light_1_pellet_full.1202.1202.362.05880.5208042610.572611.02173.058.5%2K.KVVIDKENTTIVNGAGKKPEIEAR.V3
*rpal_wt_anaer_light_1_crude_4.1095.1095.242.38250.4943972611.242611.0210.043.9%1K.KVVIDKENTTIVNGAGKKPEIEAR.V2
*rpal_wt_anaer_light_1_pellet_2.1500.1500.352.66360.3808782482.652482.84194.050.8%2K.VVIDKENTTIVNGAGKKPEIEAR.V3
*rpal_wt_anaer_light_1_pellet_4.1440.1440.254.53770.5245672483.682482.84179.048.8%2K.VVIDKENTTIVNGAGKKPEIEAR.V2
*rpal_wt_anaer_light_1_pellet_5.589.589.126.57190.276711670.81671.72170.047.6%1K.AQIEETSSDYDREK.L1
*rpal_wt_anaer_light_1_pellet_2.751.751.253.76870.6038381671.11671.721226.068.0%1K.AQIEETSSDYDREK.L2
*rpal_wt_anaer_light_1_pellet_full.1089.1089.244.77850.6015452198.032198.311224.051.6%3K.AQIEETSSDYDREKLQER.L2
rpal_wt_anaer_light_1_crude_2.1146.1146.127.17790.170631855.68856.0571114.060.0%1K.LAGGVAVIR.V11
rpal_wt_anaer_light_1_pellet_full.1102.1102.257.72780.46845857.73856.0571240.088.2%17K.LAGGVAVIR.V22
rpal_wt_anaer_light_1_pellet_full.463.463.129.78120.436275988.62989.114176.066.7%5R.VGGATEVEVK.E11
rpal_wt_anaer_light_1_crude_1.532.532.256.830.32962988.98989.1141224.084.2%3R.VGGATEVEVK.E22
*rpal_wt_anaer_light_1_pellet_4.1587.1587.242.56530.4259622616.492615.91197.042.5%4R.VGGATEVEVKEKKDRVEDALNATR.A2
*rpal_wt_anaer_light_1_pellet_full.1468.1468.357.4270.3233272616.932615.91160.051.5%6R.VGGATEVEVKEKKDRVEDALNATR.A3
*rpal_wt_anaer_light_1_crude_1.736.736.232.28440.464151388.151388.521160.054.5%1K.KDRVEDALNATR.A2
*rpal_wt_anaer_light_1_crude_1.1245.1245.239.31140.4381661260.391260.351112.060.0%2K.DRVEDALNATR.A2
*rpal_wt_anaer_light_1_crude_1a.2483.2483.269.96060.3167481607.841607.891212.074.2%9R.AAVQEGIVPGGGVALLR.A2
*rpal_wt_anaer_light_1_pellet_full.2188.2188.364.39310.2422931608.411607.891240.057.4%3R.AAVQEGIVPGGGVALLR.A3
*rpal_wt_anaer_light_1_crude_5.1389.1389.148.35480.1137381610.081607.891194.074.1%5R.AAVQEGIVPGGGVALLR.A1
*rpal_wt_anaer_light_1_pellet_3.2531.2531.238.94280.1331161810.21811.05140.050.0%3R.ISNDNPDVQAGINIVLK.A2
*rpal_wt_anaer_light_1_pellet_3.2649.2649.245.16220.3413252322.042322.67165.037.5%2K.ALEAPIRQIAENAGVEGSIVVGK.I2
*rpal_wt_anaer_light_1_pellet_full.2535.2535.356.58810.4356872324.882322.671175.049.3%1K.ALEAPIRQIAENAGVEGSIVVGK.I3
*rpal_wt_anaer_light_1_pellet_1.525.525.126.35820.233058616.52616.736112.0100.0%1K.ILENK.T1
*rpal_wt_anaer_light_1_pellet_1a.534.534.128.48930.191307699.53699.8261240.072.7%4K.GIVDPAK.V1
*rpal_wt_anaer_light_1_pellet_full.4598.4598.279.10340.7429242546.612546.941230.062.2%26R.TALQDASSVASLLVTTEAMVAELPK.A2
*rpal_wt_anaer_light_1_pellet_2.5095.5095.385.90910.5834362547.52546.941255.059.0%42R.TALQDASSVASLLVTTEAMVAELPK.A3
*rpal_wt_anaer_light_1_pellet_2a.4562.4562.357.22730.5241664269.134268.961131.051.5%4R.TALQDASSVASLLVTTEAMVAELPKADAPAMPAGGGMGGMGGMGF.-3
*rpal_wt_anaer_light_1_crude_5.1568.1568.142.14560.6424211739.721741.041193.063.3%4K.ADAPAMPAGGGMGGMGGMGF.-1
*rpal_wt_anaer_light_1_pellet_2.2861.2861.243.25910.6101141741.21741.041210.044.4%1K.ADAPAMPAGGGMGGMGGMGF.-2
Similarities: RPA2164(14:66)

URPA46424618676.2%361393416.3cbbA fructose-bisphosphate aldolase 5225636:5226721 reverse MW:39341
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_pellet_full.1488.1488.259.28480.6864341126.471126.321154.083.3%7R.SYANDIMLAK.M2
*rpal_wt_anaer_light_1_crude_3.1473.1473.136.01710.5048911128.681126.321148.075.0%10R.SYANDIMLAK.M1
*rpal_wt_anaer_light_1_cleared_full.2655.2655.349.1280.3356523548.863548.061140.043.2%5K.MIDALAEMYPDIPLCMHQDHGNDEATCATAIR.Y3
*rpal_wt_anaer_light_1_pellet_2a.2056.2056.127.00560.4992591435.611436.691160.055.0%1R.YGFTSVMMDGSLK.A1
*rpal_wt_anaer_light_1_pellet_full.2202.2202.256.60070.673611436.631436.691248.070.8%3R.YGFTSVMMDGSLK.A2
*rpal_wt_anaer_light_1_pellet_full.1444.1444.257.84340.6737331530.591530.63198.073.9%3K.TAADYQYNVDITR.R2
*rpal_wt_anaer_light_1_pellet_2a.3173.3173.371.01380.5826473984.873986.3310.058.5%3R.RVVDMAHWVGASVEGELGVLGSLEHGGGEQEDGHGVEGK.V3
*rpal_wt_anaer_light_1_pellet_2a.3312.3312.347.14990.3531743829.233830.1414.042.6%1R.VVDMAHWVGASVEGELGVLGSLEHGGGEQEDGHGVEGK.V3
*rpal_wt_anaer_light_1_cleared_full.1925.1925.380.40780.5925822104.572103.341238.060.0%5K.VSREQLLTDPDQAVEFVR.A3
*rpal_wt_anaer_light_1_pellet_2a.2034.2034.248.48490.5441342106.012103.341202.056.2%6K.VSREQLLTDPDQAVEFVR.A2
*rpal_wt_anaer_light_1_pellet_2a.2177.2177.126.63640.1532341759.731760.941164.052.2%1R.EQLLTDPDQAVEFVR.A1
*rpal_wt_anaer_light_1_pellet_1a.2686.2686.367.57660.5637771761.871760.941119.066.7%2R.EQLLTDPDQAVEFVR.A3
*rpal_wt_anaer_light_1_crude_full.2270.2270.267.15230.6702721762.561760.941208.074.1%8R.EQLLTDPDQAVEFVR.A2
*rpal_wt_anaer_light_1_pellet_5.1101.1101.132.37010.5232791904.941906.211209.055.2%1R.ATKVDALAIAMGTSHGAYK.F1
*rpal_wt_anaer_light_1_pellet_full.1708.1708.278.12570.6211181905.841906.211246.071.4%4R.ATKVDALAIAMGTSHGAYK.F2
*rpal_wt_anaer_light_1_pellet_full.1704.1704.369.15870.5012181907.131906.211109.062.7%5R.ATKVDALAIAMGTSHGAYK.F3
*rpal_wt_anaer_light_1_pellet_1a.2228.2228.362.0150.5154082296.952296.661199.049.3%4R.ATKVDALAIAMGTSHGAYKFSR.K3
*rpal_wt_anaer_light_1_cleared_3.1784.1784.267.63130.6771482297.22296.661115.059.0%5R.ATKVDALAIAMGTSHGAYKFSR.K2
*rpal_wt_anaer_light_1_pellet_2a.1691.1691.149.88180.6576131604.731605.861156.066.7%3K.VDALAIAMGTSHGAYK.F1
*rpal_wt_anaer_light_1_crude_1a.2083.2083.268.0240.7169821605.31605.861228.072.4%5K.VDALAIAMGTSHGAYK.F2
*rpal_wt_anaer_light_1_pellet_1a.2138.2138.357.97350.5148681607.041605.861237.044.2%5K.VDALAIAMGTSHGAYK.F3
*rpal_wt_anaer_light_1_pellet_1.2576.2576.359.39320.5342871995.851996.31254.040.3%3K.VDALAIAMGTSHGAYKFSR.K3
*rpal_wt_anaer_light_1_pellet_2a.1899.1899.245.11780.5812361996.581996.31158.050.0%1K.VDALAIAMGTSHGAYKFSR.K2
*rpal_wt_anaer_light_1_pellet_2a.672.672.143.48910.5099391073.921074.291221.081.2%11R.KPDGDVLAMK.V1
*rpal_wt_anaer_light_1_pellet_1.916.916.254.51320.6279321074.021074.291166.083.3%9R.KPDGDVLAMK.V2
*rpal_wt_anaer_light_1_pellet_1.580.580.240.51080.580028882.03882.0081169.084.6%1K.VVEEIHR.R2
*rpal_wt_anaer_light_1_pellet_full.3915.3915.354.49770.497684751.464752.391180.041.9%1R.RLPNTHLVMHGSSSVPQDLQDIFNEFGGAMPQTFGVPVEEIVR.G3
*rpal_wt_anaer_light_1_pellet_full.4053.4053.351.24420.4731154594.624596.21210.050.0%3R.LPNTHLVMHGSSSVPQDLQDIFNEFGGAMPQTFGVPVEEIVR.G3
*rpal_wt_anaer_light_1_pellet_1.820.820.231.03060.178189936.66936.033153.060.0%1K.VNIDTDCR.L2
*rpal_wt_anaer_light_1_crude_full.1417.1417.129.43220.349457894.69895.113168.076.9%1R.LAMTGVFR.K1
*rpal_wt_anaer_light_1_crude_1.1696.1696.243.17570.640388896.68895.1131216.080.0%4R.LAMTGVFR.K2
*rpal_wt_anaer_light_1_pellet_1a.1460.1460.241.32230.5879561023.241023.291178.070.6%3R.LAMTGVFRK.V2
*rpal_wt_anaer_light_1_pellet_3.1382.1382.127.14090.2138291179.671180.48178.062.5%2K.FLKPAMDAMR.D1
*rpal_wt_anaer_light_1_pellet_1.1673.1673.234.88170.09448791180.141180.481140.061.1%1K.FLKPAMDAMR.D2
*rpal_wt_anaer_light_1_pellet_2.1549.1549.271.12930.7437271526.71526.691111.076.9%4K.LRFEQFGTAGNASK.I2
*rpal_wt_anaer_light_1_crude_1a.1101.1101.261.35280.6000611257.211257.351233.081.8%6R.FEQFGTAGNASK.I2
*rpal_wt_anaer_light_1_cleared_4.685.685.135.91980.614631258.771257.35175.057.9%7R.FEQFGTAGNASK.I1
*rpal_wt_anaer_light_1_pellet_2a.1181.1181.135.43070.4527711216.741217.581232.068.8%9K.IKVVPMAEMAK.R1
*rpal_wt_anaer_light_1_pellet_1.1703.1703.239.61260.4579831217.491217.581226.065.0%4K.IKVVPMAEMAK.R2
*rpal_wt_anaer_light_1_pellet_1.1699.1699.361.30460.5388081218.061217.581234.065.7%4K.IKVVPMAEMAK.R3
*rpal_wt_anaer_light_1_pellet_4.1355.1355.129.93050.3736861372.791373.77180.066.7%1K.IKVVPMAEMAKR.Y1
*rpal_wt_anaer_light_1_crude_full.803.803.132.19350.332126975.46976.2481153.071.4%2K.VVPMAEMAK.R1
*rpal_wt_anaer_light_1_pellet_2a.1183.1183.133.59520.4705941602.791603.821132.063.6%1R.YKSGALDPQIGQVAR.A1
*rpal_wt_anaer_light_1_pellet_2.1525.1525.266.02410.6548641603.581603.821206.075.0%9R.YKSGALDPQIGQVAR.A2
*rpal_wt_anaer_light_1_crude_1.1405.1405.365.67030.4707141605.01603.821231.060.9%4R.YKSGALDPQIGQVAR.A3
*rpal_wt_anaer_light_1_pellet_full.1377.1377.262.87730.4899611312.331312.471188.078.3%7K.SGALDPQIGQVAR.A2

URPA03605130276.0%537587726.3pckA phosphoenolpyruvate carboxykinase 389802:391415 forward MW:58772
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_cleared_3.1172.1172.260.58580.7064532054.172054.29135.060.6%9-.MQETGVHNGAYGTDKFGLK.N2
*rpal_wt_anaer_light_1_pellet_1a.1509.1509.360.62160.5179182054.952054.291221.057.9%5-.MQETGVHNGAYGTDKFGLK.N3
*rpal_wt_anaer_light_1_pellet_full.2550.2550.249.69780.6467652348.832349.71209.051.4%7K.NLKGVYWNFGAPQLYEHALK.N2
*rpal_wt_anaer_light_1_cleared_full.2248.2248.366.73860.548782350.342349.71210.056.7%8K.NLKGVYWNFGAPQLYEHALK.N3
*rpal_wt_anaer_light_1_pellet_2a.2462.2462.239.3180.5985961995.451994.261161.046.7%2K.GVYWNFGAPQLYEHALK.N2
*rpal_wt_anaer_light_1_cleared_4.2215.2215.230.96470.4092692448.862449.68164.031.8%1K.NGEAVLSSDGALVADTGVFTGRSPK.D2
*rpal_wt_anaer_light_1_pellet_3.2739.2739.270.25190.6624962297.912298.541222.063.2%4K.HAEGMTLFAQDLYGGADPTFR.I2
*rpal_wt_anaer_light_1_pellet_3.4081.4081.261.9670.6354482204.012204.531167.060.6%8R.AELENFVPELTLIDLPSFR.A2
*rpal_wt_anaer_light_1_pellet_1a.4345.4345.360.68920.4925212204.362204.531221.054.1%1R.AELENFVPELTLIDLPSFR.A3
*rpal_wt_anaer_light_1_pellet_4.1838.1838.136.3460.5847361220.981221.361176.070.6%4R.SENVVAIDFAR.K1
*rpal_wt_anaer_light_1_pellet_1a.2041.2041.255.54120.6336181221.61221.361254.075.0%4R.SENVVAIDFAR.K2
*rpal_wt_anaer_light_1_pellet_5.976.976.139.78740.576191736.01737.121101.064.0%2R.KIVLIGGTQYAGEMKK.S1
*rpal_wt_anaer_light_1_pellet_full.1400.1400.267.39850.6908271736.691737.121180.075.9%2R.KIVLIGGTQYAGEMKK.S2
*rpal_wt_anaer_light_1_pellet_1.1808.1808.366.96130.5707831737.011737.121195.056.9%4R.KIVLIGGTQYAGEMKK.S3
*rpal_wt_anaer_light_1_pellet_2.3085.3085.239.10760.3646381576.561575.81216.057.1%3K.SVFTTLNYYLPEK.G2
*rpal_wt_anaer_light_1_pellet_full.2404.2404.351.44260.3233533673.683672.971164.043.5%2K.TTLSADPNRTLIGDDEHGWGKDGVFNFEGGCYAK.C3
*rpal_wt_anaer_light_1_crude_4.2399.2399.236.55680.4799272716.412716.95134.034.9%1R.TLIGDDEHGWGKDGVFNFEGGCYAK.C2
*rpal_wt_anaer_light_1_pellet_2a.1201.1201.134.84660.3289731666.741667.771197.059.1%5K.LSSENEPEIYAASTR.F1
*rpal_wt_anaer_light_1_pellet_full.1337.1337.270.63090.5523811667.251667.771179.077.8%7K.LSSENEPEIYAASTR.F2
*rpal_wt_anaer_light_1_pellet_1a.3564.3564.236.660.4550631632.331631.871212.048.1%4R.FGAVLENVVLGELDR.K2
*rpal_wt_anaer_light_1_pellet_4.2983.2983.236.60470.5255232621.62621.91168.036.6%1R.FGAVLENVVLGELDRKPDFDDGSK.T2
*rpal_wt_anaer_light_1_pellet_2.3278.3278.347.9140.3830992622.012621.911218.049.3%1R.FGAVLENVVLGELDRKPDFDDGSK.T3
*rpal_wt_anaer_light_1_pellet_5.1550.1550.239.88040.5842073223.183223.531180.034.0%1R.FGAVLENVVLGELDRKPDFDDGSKTENTR.S2
*rpal_wt_anaer_light_1_pellet_3.2861.2861.366.21560.3976633223.243223.531223.053.3%8R.FGAVLENVVLGELDRKPDFDDGSKTENTR.S3
*rpal_wt_anaer_light_1_pellet_2a.1876.1876.138.17620.6186391675.881676.87181.066.7%6R.SAYPLESIPNASLTGR.A1
*rpal_wt_anaer_light_1_crude_1a.2314.2314.252.89140.5266811675.961676.871137.060.7%10R.SAYPLESIPNASLTGR.A2
*rpal_wt_anaer_light_1_crude_1a.3753.3753.264.78570.6904831844.061845.281216.065.6%22K.NVVMLAADAFGVMPPIAK.L2
*rpal_wt_anaer_light_1_crude_2a.3018.3018.155.42330.6552241846.951845.281147.071.4%16K.NVVMLAADAFGVMPPIAK.L1
*rpal_wt_anaer_light_1_pellet_1.3959.3959.395.75920.5551251847.041845.281241.074.1%20K.NVVMLAADAFGVMPPIAK.L3
*rpal_wt_anaer_light_1_cleared_5.1659.1659.141.72410.6648221899.031900.21198.065.2%6K.LTPAQAMYHFLSGYTAK.V1
*rpal_wt_anaer_light_1_crude_1a.3458.3458.257.3320.7175991899.71900.21151.063.3%17K.LTPAQAMYHFLSGYTAK.V2
*rpal_wt_anaer_light_1_crude_2a.2901.2901.234.17980.393252514.162513.88114.037.5%1K.LTPAQAMYHFLSGYTAKVAGTER.G2
*rpal_wt_anaer_light_1_pellet_2a.2756.2756.270.6640.7264122170.132170.45123.068.6%4R.GVTEPTPEFSTCFGSPFLPR.D2
*rpal_wt_anaer_light_1_pellet_1a.1781.1781.247.77780.681751152.691152.321134.077.8%2R.DPSVYGNMLR.E2
2rpal_wt_anaer_light_1_pellet_full.374.374.130.73620.178438573.63573.7111187.087.5%4R.ELIAK.H11
*rpal_wt_anaer_light_1_pellet_2.2739.2739.367.61640.5819762444.222444.71254.057.6%1K.HNVDCWLVNTGWTGGIYGTGHR.M3
*rpal_wt_anaer_light_1_pellet_4.2512.2512.259.95380.6441312444.242444.71195.050.0%2K.HNVDCWLVNTGWTGGIYGTGHR.M2
*rpal_wt_anaer_light_1_pellet_2.760.760.132.10220.173281844.51845.097178.081.8%3R.MPIKVTR.A1
*rpal_wt_anaer_light_1_pellet_1a.632.632.238.85090.316155846.26845.097162.078.6%5R.MPIKVTR.A2
*rpal_wt_anaer_light_1_crude_1a.2611.2611.273.76180.6425951200.331201.411127.087.0%34R.ALLTAALDGSLR.N2
*rpal_wt_anaer_light_1_pellet_4.2363.2363.133.49570.4734131201.11201.411160.063.2%2R.ALLTAALDGSLR.N1
*rpal_wt_anaer_light_1_pellet_full.3557.3557.258.14510.6176632631.032632.031244.047.7%11R.TDPYFGFAVPTALPGVPSEILDPVK.T2
*rpal_wt_anaer_light_1_pellet_1a.4026.4026.360.0290.4297762633.342632.031219.049.3%4R.TDPYFGFAVPTALPGVPSEILDPVK.T3
*rpal_wt_anaer_light_1_pellet_full.3692.3692.354.63680.399283233.213233.691177.047.0%6R.TDPYFGFAVPTALPGVPSEILDPVKTWADK.A3
*rpal_wt_anaer_light_1_cleared_5.1968.1968.238.6970.4742623233.533233.69145.033.3%7R.TDPYFGFAVPTALPGVPSEILDPVKTWADK.A2
*rpal_wt_anaer_light_1_cleared_2a.3810.3810.348.97510.2515184067.814067.591138.044.8%1R.TDPYFGFAVPTALPGVPSEILDPVKTWADKAAFDTTAR.K3
*rpal_wt_anaer_light_1_pellet_2.1480.1480.246.43620.5777651454.211454.581227.062.5%1K.TWADKAAFDTTAR.K2
*rpal_wt_anaer_light_1_pellet_1.626.626.230.99750.277822853.51852.923173.060.0%1K.AAFDTTAR.K2
*rpal_wt_anaer_light_1_crude_full.753.753.139.99320.549901950.61951.2211245.084.6%11R.KLVGMFQK.N1
*rpal_wt_anaer_light_1_crude_1.892.892.251.79310.6423954.13951.2211226.086.7%9R.KLVGMFQK.N2
*rpal_wt_anaer_light_1_cleared_full.315.315.128.2090.151604671.65671.7721234.072.7%2R.AAAPDVK.M1
Similarities: RPA3265(1:50)

URPA40454417175.4%426447027.7RPA4045 possible branched-chain amino acid ABC transport system substrate-binding protein 4576388:4577668 forward MW:44701
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_crude_full.1584.1584.275.05040.6660241782.751782.911184.081.5%8K.QLNVDTNDYGYQVPR.A2
*rpal_wt_anaer_light_1_crude_full.569.569.128.61130.179814678.58678.85161.088.9%1R.AIALYK.K1
*rpal_wt_anaer_light_1_cleared_full.437.437.134.17130.302257806.64807.024168.081.8%6R.AIALYKK.W1
*rpal_wt_anaer_light_1_cleared_1.570.570.234.03110.132726807.54807.0241206.069.2%1R.AIALYKK.W2
*rpal_wt_anaer_light_1_pellet_5.2096.2096.346.56440.450235017.595016.511174.042.4%1K.WSGGDKVAAIMGWGTADTEALTGFLANDKIPDLSGSYAAALTDPEGTSGK.A3
*rpal_wt_anaer_light_1_crude_1a.2615.2615.378.96660.5839042163.992165.411223.054.2%4K.AKPAPYNFFYGPSYSDALR.A3
*rpal_wt_anaer_light_1_cleared_full.2039.2039.258.48320.6865632164.672165.41170.063.6%8K.AKPAPYNFFYGPSYSDALR.A2
*rpal_wt_anaer_light_1_cleared_4.2158.2158.148.17170.5792241349.651350.541254.076.5%6R.AELMWAAEDWK.A1
*rpal_wt_anaer_light_1_cleared_1a.2252.2252.268.38180.6790021349.841350.541147.085.0%5R.AELMWAAEDWK.A2
*rpal_wt_anaer_light_1_cleared_2a.848.848.154.03440.6328561679.711680.93145.078.3%2K.FVHMGANHPYPNAPK.A1
*rpal_wt_anaer_light_1_cleared_full.847.847.270.77190.731461680.561680.931126.075.0%4K.FVHMGANHPYPNAPK.A2
*rpal_wt_anaer_light_1_crude_1.1070.1070.359.82650.5511551681.591680.931127.061.4%6K.FVHMGANHPYPNAPK.A3
*rpal_wt_anaer_light_1_crude_1a.698.698.125.8550.267418730.41730.841164.066.7%1K.AAGEAIAK.E1
*rpal_wt_anaer_light_1_cleared_5.2248.2248.236.49470.5054683590.593591.211142.023.3%1K.AAGEAIAKELGFEVLPPLVFALAPGDYSAQCLSLK.S2
*rpal_wt_anaer_light_1_cleared_full.4136.4136.346.11810.166163591.223591.211225.041.2%1K.AAGEAIAKELGFEVLPPLVFALAPGDYSAQCLSLK.S3
*rpal_wt_anaer_light_1_cleared_full.4208.4208.258.67910.6429362878.122879.391178.043.8%18K.ELGFEVLPPLVFALAPGDYSAQCLSLK.S2
*rpal_wt_anaer_light_1_cleared_full.4209.4209.367.1630.5384742879.12879.391221.052.6%10K.ELGFEVLPPLVFALAPGDYSAQCLSLK.S3
*rpal_wt_anaer_light_1_cleared_3.2060.2060.267.77560.6524072119.982120.351207.058.3%6K.SSGANYAYLGNTAASNISVMK.A2
*rpal_wt_anaer_light_1_cleared_full.1834.1834.259.92920.6590162422.612422.741173.048.7%4K.SSGANYAYLGNTAASNISVMKACK.A2
*rpal_wt_anaer_light_1_cleared_full.1753.1753.130.2230.3129271402.741403.581194.052.4%3K.TAGDAADGVIFPLR.T1
*rpal_wt_anaer_light_1_pellet_full.2038.2038.262.52560.6365421403.271403.581252.076.0%8K.TAGDAADGVIFPLR.T2
*rpal_wt_anaer_light_1_cleared_2a.2369.2369.235.38530.4117922174.332174.47142.036.8%1K.TAGDAADGVIFPLRTAVAWGGK.A2
*rpal_wt_anaer_light_1_cleared_full.2314.2314.356.34510.4293192658.332659.081116.050.6%1K.TAGDAADGVIFPLRTAVAWGGKAPGMK.T3
*rpal_wt_anaer_light_1_cleared_4.2489.2489.234.84920.4056912658.812659.0810.034.0%1K.TAGDAADGVIFPLRTAVAWGGKAPGMK.T2
*rpal_wt_anaer_light_1_cleared_2.584.584.128.92670.40249787.65789.911232.075.0%1R.TAVAWGGK.A1
*rpal_wt_anaer_light_1_crude_full.960.960.144.83130.5267351273.61274.531136.078.9%3R.TAVAWGGKAPGMK.T1
*rpal_wt_anaer_light_1_cleared_full.869.869.253.56250.5548551274.131274.531164.069.6%5R.TAVAWGGKAPGMK.T2
*rpal_wt_anaer_light_1_crude_1a.743.743.129.99790.361009805.45805.9041236.072.7%5K.TVEEISK.I1
*rpal_wt_anaer_light_1_crude_full.2973.2973.235.68320.5019792742.072742.1910.035.6%1K.ISDPSGNVYRPVHYVAAVCSALYMK.E2
*rpal_wt_anaer_light_1_cleared_full.2794.2794.369.38210.5690172743.452742.19195.060.9%8K.ISDPSGNVYRPVHYVAAVCSALYMK.E3
*rpal_wt_anaer_light_1_cleared_full.781.781.135.23570.335671917.55918.0371185.083.3%8K.EAIEWAAK.N1
*rpal_wt_anaer_light_1_cleared_3.400.400.127.26560.4526251017.661018.07150.058.8%1K.NGGATGENVAK.G1
*rpal_wt_anaer_light_1_cleared_2.1045.1045.235.02770.480381642.161641.78112.050.0%1K.NGGATGENVAKGFYQK.A2
*rpal_wt_anaer_light_1_cleared_full.2633.2633.252.83730.5997262120.582121.4175.051.4%4K.ADWVPAGMEGVCNPSTWTAK.D2
*rpal_wt_anaer_light_1_cleared_2a.2197.2197.230.91450.4414722528.812529.82116.035.0%1K.ADWVPAGMEGVCNPSTWTAKDHR.G2
*rpal_wt_anaer_light_1_cleared_5.941.941.130.15210.5347421728.061728.98138.056.5%1R.AKVSGPTDGDLKDLIAK.G1
*rpal_wt_anaer_light_1_crude_1a.1791.1791.252.77230.5739391728.311728.981240.063.3%5R.AKVSGPTDGDLKDLIAK.G2
*rpal_wt_anaer_light_1_cleared_4.1828.1828.238.07720.4783572500.312498.92130.034.9%2R.AKVSGPTDGDLKDLIAKGTIKLEK.V2
*rpal_wt_anaer_light_1_crude_full.1588.1588.140.8950.4719231528.691529.731179.066.7%2K.VSGPTDGDLKDLIAK.G1
*rpal_wt_anaer_light_1_crude_full.1583.1583.258.54740.5839881530.071529.731131.063.0%8K.VSGPTDGDLKDLIAK.G2
*rpal_wt_anaer_light_1_cleared_3.2099.2099.244.3180.5552442298.942299.67133.043.6%3K.VSGPTDGDLKDLIAKGTIKLEK.V2
*rpal_wt_anaer_light_1_cleared_full.1888.1888.351.36540.3348892300.362299.67132.050.0%1K.VSGPTDGDLKDLIAKGTIKLEK.V3
*rpal_wt_anaer_light_1_cleared_2.1876.1876.236.42540.2126921782.711783.081193.044.4%2K.VKTVDLPRKPEWAGW.-2
*rpal_wt_anaer_light_1_crude_2.1685.1685.135.86570.448373873.51873.9861172.090.9%2R.KPEWAGW.-1

URPA43085023675.2%529562155.6serA2 putative phosphoglycerate dehydrogenase 4858096:4859685 reverse MW:56215
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_crude_1a.4013.4013.276.89130.583451704.91705.01223.075.9%5K.VLISDALSEAAVQIFK.D2
*rpal_wt_anaer_light_1_cleared_1.3972.3972.364.79560.4431881706.81705.01221.064.0%2K.VLISDALSEAAVQIFK.D3
*rpal_wt_anaer_light_1_crude_3.3624.3624.257.59610.5654131976.461976.281207.060.6%13K.VLISDALSEAAVQIFKDR.G2
*rpal_wt_anaer_light_1_cleared_full.3168.3168.355.60560.5656751977.171976.281202.050.0%5K.VLISDALSEAAVQIFKDR.G3
*rpal_wt_anaer_light_1_pellet_full.3095.3095.364.30540.4846793289.313289.711223.048.7%3R.GIDVDFQPNLGKDKDKLAEIIGNYDGLAIR.S3
*rpal_wt_anaer_light_1_pellet_1a.2699.2699.249.8110.5066531518.191518.75181.060.0%2K.LAEIIGNYDGLAIR.S2
*rpal_wt_anaer_light_1_cleared_1a.1696.1696.252.37680.5701191526.591526.731243.060.7%7R.AGIGVDNVEIPAATAK.G2
*rpal_wt_anaer_light_1_pellet_5.1135.1135.145.65430.5044021528.061526.731176.069.6%8R.AGIGVDNVEIPAATAK.G1
*rpal_wt_anaer_light_1_cleared_full.4849.4849.362.20170.465682990.232991.571228.051.3%6K.GIIVMNTPFGNSITTAEHAITMMLSLAR.E3
*rpal_wt_anaer_light_1_pellet_full.4839.4839.260.46380.5886762991.662991.571210.040.8%11K.GIIVMNTPFGNSITTAEHAITMMLSLAR.E2
*rpal_wt_anaer_light_1_cleared_full.980.980.247.4170.6286991702.541702.86120.055.2%8R.EIPAADASTQAGKWEK.N2
*rpal_wt_anaer_light_1_pellet_2a.1511.1511.136.44590.453955995.7996.215176.080.0%7R.FMGVEITAK.T1
*rpal_wt_anaer_light_1_pellet_1a.2893.2893.254.89170.5508391645.671645.921220.058.1%5K.TLGVIGCGNIGSIVADR.A2
*3rpal_wt_anaer_light_1_pellet_full.432.432.133.99660.18904501.61501.6471116.0100.0%2R.ALGLK.M11
*rpal_wt_anaer_light_1_cleared_2.2485.2485.248.25130.5201061650.741650.981249.053.8%4K.MKVIAFDPFLSPER.A2
*rpal_wt_anaer_light_1_pellet_1.3076.3076.365.59530.5031351652.251650.981254.061.4%3K.MKVIAFDPFLSPER.A3
*rpal_wt_anaer_light_1_pellet_2.2824.2824.260.23020.6759051391.241391.611254.072.7%12K.VIAFDPFLSPER.A2
*rpal_wt_anaer_light_1_crude_1.2305.2305.349.89930.4392051989.591990.311199.052.8%1R.AKDLGVEKVELEDIFKR.A3
*rpal_wt_anaer_light_1_pellet_3.2191.2191.272.94520.7591851990.541990.31123.071.0%2R.AKDLGVEKVELEDIFKR.A2
*rpal_wt_anaer_light_1_pellet_2a.1743.1743.129.44740.4602821148.851149.331211.069.2%2K.VELEDIFKR.A1
*rpal_wt_anaer_light_1_crude_1.2060.2060.233.74090.4389891149.51149.33160.056.2%1K.VELEDIFKR.A2
*rpal_wt_anaer_light_1_crude_4.1918.1918.138.06750.5476671471.841472.681184.073.7%3R.ADFITLHTPLTDK.T1
*rpal_wt_anaer_light_1_pellet_1a.2305.2305.240.72040.5111961472.681472.68185.056.5%1R.ADFITLHTPLTDK.T2
*rpal_wt_anaer_light_1_pellet_2a.1581.1581.134.72790.47441700.891701.96198.060.9%1R.ADFITLHTPLTDKTK.N1
*rpal_wt_anaer_light_1_pellet_2.1972.1972.245.9680.5579451702.131701.96179.053.8%5R.ADFITLHTPLTDKTK.N2
*rpal_wt_anaer_light_1_crude_1a.1750.1750.132.97910.490687999.591000.18151.068.8%6K.NIIDAAAIAK.M1
*rpal_wt_anaer_light_1_pellet_full.1474.1474.248.07930.5383441000.521000.181172.073.7%5K.NIIDAAAIAK.M2
*rpal_wt_anaer_light_1_pellet_full.2329.2329.282.66560.6821571401.781400.571191.084.0%8R.GGLVDENALAEALK.S2
*rpal_wt_anaer_light_1_pellet_4.2421.2421.146.50960.558221402.791400.571216.071.4%8R.GGLVDENALAEALK.S1
*rpal_wt_anaer_light_1_pellet_full.3210.3210.372.3330.5625723302.423302.621101.054.1%4R.GGLVDENALAEALKSGHVAGAAFDVFSEEPATK.N3
*rpal_wt_anaer_light_1_crude_5.1243.1243.151.03090.695111919.861921.071169.070.4%2K.SGHVAGAAFDVFSEEPATK.N1
*rpal_wt_anaer_light_1_pellet_full.1832.1832.288.62030.7818651920.621921.071127.076.5%2K.SGHVAGAAFDVFSEEPATK.N2
*rpal_wt_anaer_light_1_pellet_1.2317.2317.350.89530.4469411921.581921.071113.046.6%1K.SGHVAGAAFDVFSEEPATK.N3
*rpal_wt_anaer_light_1_pellet_4.1758.1758.133.83050.2531190.261188.451220.066.7%6K.LKPFIELAEK.L1
*rpal_wt_anaer_light_1_pellet_2a.1732.1732.130.55510.555041522.681523.73185.054.5%3K.LGSFAGQLTETGITK.V1
*rpal_wt_anaer_light_1_pellet_1a.2188.2188.260.10420.6344321523.211523.731235.070.4%6K.LGSFAGQLTETGITK.V2
*rpal_wt_anaer_light_1_cleared_2a.3656.3656.378.2020.5031153049.663048.751249.052.1%7K.IKALTSAVLSGLLRPMLGDINVVSAPVIAK.E3
*rpal_wt_anaer_light_1_pellet_full.3907.3907.252.74390.5667782806.32807.421233.044.9%11K.ALTSAVLSGLLRPMLGDINVVSAPVIAK.E2
*rpal_wt_anaer_light_1_cleared_1a.4126.4126.376.40010.532132806.842807.421226.059.7%10K.ALTSAVLSGLLRPMLGDINVVSAPVIAK.E3
*rpal_wt_anaer_light_1_pellet_3.3966.3966.348.28240.3403023092.683092.72124.041.2%2K.ALTSAVLSGLLRPMLGDINVVSAPVIAKER.G3
*rpal_wt_anaer_light_1_pellet_4.2505.2505.241.00330.5166632383.032385.591241.043.2%2R.AAESDYESLITLTVTTEKQER.S2
*rpal_wt_anaer_light_1_pellet_1.732.732.247.2780.5814881337.361337.481105.060.9%4R.SVSGTVYADGKPR.L2
*2rpal_wt_anaer_light_1_crude_1a.884.884.125.39220.26516587.58587.7381189.075.0%2R.LVDIK.G1
*rpal_wt_anaer_light_1_pellet_4.2448.2448.245.22880.6074182506.942505.811144.040.0%2R.VDAEFGSSMIYVTNEDKPGFIGK.F2
*rpal_wt_anaer_light_1_crude_full.1252.1252.135.4780.498689921.54922.0691209.078.6%4K.FASLLGDAK.V1
*rpal_wt_anaer_light_1_crude_full.1748.1748.128.90990.4833711104.691105.28172.068.8%2K.VNIATFNLGR.H1
*rpal_wt_anaer_light_1_crude_1.2110.2110.260.69970.566961105.441105.281215.084.2%3K.VNIATFNLGR.H2
*rpal_wt_anaer_light_1_pellet_4.2567.2567.260.62110.6515522434.172434.711218.047.7%5R.HTEGGDAIALVTIDGPAPTEVLEK.V2
*rpal_wt_anaer_light_1_pellet_2.1137.1137.131.45650.261793882.63883.0791225.069.2%8K.VQALPQVK.Q1
*rpal_wt_anaer_light_1_pellet_full.912.912.235.22590.40885883.21883.0791187.066.7%4K.VQALPQVK.Q2
Similarities: RPA2553(1:49)

URPA162971575.2%121135045.2cheY2 chemotaxis response regulator, CheY2 1810628:1810993 forward MW:13503
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_cleared_3.3062.3062.356.51710.4535492680.192679.021127.045.7%1R.RILEGLDFEIVEAEDGEKALEACK.H3
*rpal_wt_anaer_light_1_crude_4.3343.3343.233.00650.4180842523.292522.831156.035.0%1R.ILEGLDFEIVEAEDGEKALEACK.H2
*rpal_wt_anaer_light_1_cleared_2a.3621.3621.258.47710.639692689.842690.121249.046.3%5K.HGLPDAVLLDWNMPVMDGYEFLR.N2
*rpal_wt_anaer_light_1_crude_2.1803.1803.236.63460.589891674.931675.91173.044.4%1K.VVFCTTENDVAHIAR.A2
*rpal_wt_anaer_light_1_cleared_2a.1493.1493.258.06490.6554342433.082433.831228.052.6%5R.ALHAGANEYIMKPFDKDIVTAK.F2
*rpal_wt_anaer_light_1_cleared_2.1726.1726.349.70230.4824552434.492433.831120.047.6%1R.ALHAGANEYIMKPFDKDIVTAK.F3
*rpal_wt_anaer_light_1_cleared_full.1763.1763.131.17510.516002805.51805.9491149.075.0%1K.FQEVGLI.-1

URPA29213314874.7%308322065.8tsf elongation factor Ts 3301233:3302159 reverse MW:32206
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_crude_3.924.924.126.97250.428544905.81906.13410.064.3%2M.ATITAAMVK.E1
*rpal_wt_anaer_light_1_cleared_1a.788.788.238.91520.465638906.74906.1341104.070.6%4M.ATITAAMVK.E2
*rpal_wt_anaer_light_1_cleared_2.1186.1186.242.69480.5520721571.171570.8518.053.8%1K.ELRETTGVGMMDCK.Q2
*rpal_wt_anaer_light_1_cleared_4.2274.2274.144.44680.5806091415.771416.621186.072.7%6R.VAAEGLIGALTDGTK.G1
*rpal_wt_anaer_light_1_pellet_full.2382.2382.263.22690.6338441416.561416.621235.074.1%9R.VAAEGLIGALTDGTK.G2
*rpal_wt_anaer_light_1_cleared_full.4088.4088.348.28090.3351913035.653033.411197.037.3%1R.VAAEGLIGALTDGTKGVVIEVNSETDFVAR.N3
*rpal_wt_anaer_light_1_cleared_full.956.956.131.89270.4795671062.631063.216.071.4%6R.NEQFQGLVK.M1
*rpal_wt_anaer_light_1_cleared_1a.1083.1083.244.91830.5557781063.841063.21218.075.0%5R.NEQFQGLVK.M2
*rpal_wt_anaer_light_1_crude_2.1256.1256.130.98410.309426873.59874.1351214.069.2%4K.MIAQVALK.V1
*rpal_wt_anaer_light_1_cleared_1.1222.1222.241.24010.402977874.25874.1351152.075.0%1K.MIAQVALK.V2
*rpal_wt_anaer_light_1_cleared_full.4858.4858.367.72770.5587683440.743441.89141.046.9%9K.VGADLDAINAAPVGSTTVAGAIADAIATIGENMTLR.R3
*rpal_wt_anaer_light_1_crude_full.4853.4853.266.21830.6383523441.913441.891229.040.6%12K.VGADLDAINAAPVGSTTVAGAIADAIATIGENMTLR.R2
*rpal_wt_anaer_light_1_crude_4.4922.4922.349.64990.3316973597.643598.071179.041.1%3K.VGADLDAINAAPVGSTTVAGAIADAIATIGENMTLRR.A3
*rpal_wt_anaer_light_1_pellet_4.2676.2676.243.44230.5599752555.072555.910.044.4%3R.RAAALSVSQGVVASYIHNAVIDGAGK.M2
*rpal_wt_anaer_light_1_crude_1a.2894.2894.389.33080.6431962555.682555.91251.060.3%9R.RAAALSVSQGVVASYIHNAVIDGAGK.M3
*rpal_wt_anaer_light_1_crude_2a.2521.2521.274.6410.7346612399.222399.711123.059.5%10R.AAALSVSQGVVASYIHNAVIDGAGK.M2
*rpal_wt_anaer_light_1_cleared_2.2890.2890.363.8060.5366032400.622399.711199.052.8%7R.AAALSVSQGVVASYIHNAVIDGAGK.M3
*rpal_wt_anaer_light_1_cleared_1a.5344.5344.356.45770.4728732102.252100.491159.044.1%7K.MGVIVALESAGKADELAVLGR.Q3
*rpal_wt_anaer_light_1_pellet_3.1575.1575.133.15760.261117943.89944.0761177.078.6%2K.ADELAVLGR.Q1
*rpal_wt_anaer_light_1_crude_1.1626.1626.248.17410.255664945.25944.0761123.076.5%3K.ADELAVLGR.Q2
*rpal_wt_anaer_light_1_crude_full.2232.2232.252.14380.5563612714.512715.111146.050.0%3R.QLAMHVAAANPQALDPTSLDPAVVQR.E2
*rpal_wt_anaer_light_1_cleared_full.2065.2065.363.80720.4349762715.022715.111249.050.6%3R.QLAMHVAAANPQALDPTSLDPAVVQR.E3
*rpal_wt_anaer_light_1_cleared_full.673.673.236.00.5171441403.31402.5914.052.0%1K.GKSVAQAVKEAEGK.V2
*rpal_wt_anaer_light_1_pellet_1a.1190.1190.249.0960.5371031217.961217.371105.068.2%6K.SVAQAVKEAEGK.V2
*rpal_wt_anaer_light_1_crude_2a.1660.1660.143.73510.4930641255.911256.58153.077.8%4K.VGAPIKIVGFVR.Y1
*rpal_wt_anaer_light_1_cleared_full.1525.1525.243.00090.6230241256.91256.581168.066.7%3K.VGAPIKIVGFVR.Y2
*rpal_wt_anaer_light_1_cleared_1a.1734.1734.369.47880.6549261258.31256.581241.067.6%4K.VGAPIKIVGFVR.Y3
*rpal_wt_anaer_light_1_cleared_3.1061.1061.137.94430.332248979.76980.1061211.073.3%10R.YALGEGIEK.Q1
*rpal_wt_anaer_light_1_cleared_1.1163.1163.251.7630.485115980.55980.1061225.083.3%2R.YALGEGIEK.Q2
*rpal_wt_anaer_light_1_cleared_full.2624.2624.347.29790.3717972542.752542.761197.045.9%1R.YALGEGIEKQTSDFAAEVAAASGQK.-3
*rpal_wt_anaer_light_1_cleared_4.2841.2841.247.77020.5305942543.62542.761147.047.7%3R.YALGEGIEKQTSDFAAEVAAASGQK.-2
*rpal_wt_anaer_light_1_crude_5.1213.1213.129.26970.5960091580.861581.68136.054.2%1K.QTSDFAAEVAAASGQK.-1
*rpal_wt_anaer_light_1_cleared_2.1668.1668.263.7530.7145061583.81581.68195.066.7%3K.QTSDFAAEVAAASGQK.-2

URPA4749249874.2%314324175.4etfA electron transfer flavoprotein alpha-subunit, (ETFLS) 5360445:5361389 reverse MW:32417
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_crude_3.1094.1094.258.30960.6841092077.062076.3217.060.6%1M.ATLLIAEHDNAHLKDATNK.A2
*rpal_wt_anaer_light_1_pellet_2.556.556.128.84930.227395717.62716.8131172.069.2%3K.AVADAAAK.L1
*rpal_wt_anaer_light_1_cleared_1a.872.872.246.80310.5269121285.911285.491188.060.0%1K.AVADAAAKLQGAAK.V2
*rpal_wt_anaer_light_1_cleared_2.641.641.136.79750.358079891.52892.112169.091.7%1R.FKNVMPR.V1
*rpal_wt_anaer_light_1_crude_2a.3025.3025.135.27790.5168341628.831630.01112.069.6%2R.VAALLDVMQVSEIIK.V1
*rpal_wt_anaer_light_1_pellet_full.3287.3287.267.84210.646881630.141630.01179.076.9%20R.VAALLDVMQVSEIIK.V2
*rpal_wt_anaer_light_1_pellet_1.3971.3971.393.24570.6298951630.481630.01247.080.9%4R.VAALLDVMQVSEIIK.V3
*rpal_wt_anaer_light_1_cleared_3.1928.1928.243.27640.5439992291.092290.63110.043.2%8K.VVAPDTFERPIYAGNAIQTVK.S2
*rpal_wt_anaer_light_1_cleared_full.1738.1738.368.82610.5531042291.12290.631138.054.7%4K.VVAPDTFERPIYAGNAIQTVK.S3
*2rpal_wt_anaer_light_1_cleared_2.496.496.126.19810.14974715.94715.915196.080.0%2K.KVITVR.T1
*rpal_wt_anaer_light_1_cleared_2a.3156.3156.359.65770.4115393427.983428.691250.046.3%1R.TSTFQATGEGGSAAIETVAAAADPGLSSFVGEEVAK.S3
*rpal_wt_anaer_light_1_crude_2a.2999.2999.240.67690.5589023428.523428.691184.023.4%5R.TSTFQATGEGGSAAIETVAAAADPGLSSFVGEEVAK.S2
*rpal_wt_anaer_light_1_pellet_2.649.649.131.96330.249486701.82701.845196.083.3%1K.IIVSGGR.A1
*rpal_wt_anaer_light_1_cleared_full.2348.2348.239.08330.5041332336.972337.641144.038.5%1R.ENFTKYIEPLADKLGAGVGASR.A2
*rpal_wt_anaer_light_1_crude_3.854.854.131.88310.295577948.67949.0921158.069.2%4K.YIEPLADK.L1
*rpal_wt_anaer_light_1_cleared_2a.1400.1400.128.27340.4641251716.861717.961200.048.1%1K.YIEPLADKLGAGVGASR.A1
*rpal_wt_anaer_light_1_crude_1.1889.1889.379.75450.6379511717.281717.961170.067.3%5K.YIEPLADKLGAGVGASR.A3
*rpal_wt_anaer_light_1_pellet_full.1707.1707.270.33960.587391717.681717.96131.068.8%8K.YIEPLADKLGAGVGASR.A2
*rpal_wt_anaer_light_1_crude_1a.1938.1938.257.62770.6397811948.411949.091166.060.6%4R.AAVDAGYAPNDWQVGQTGK.V2
*rpal_wt_anaer_light_1_cleared_5.1002.1002.134.91350.3643431948.981949.091177.055.6%1R.AAVDAGYAPNDWQVGQTGK.V1
*rpal_wt_anaer_light_1_crude_2.4360.4360.345.38450.3819082668.022669.161131.036.0%1K.VVAPELYIAVGISGAIQHLAGMKDSK.V3
*rpal_wt_anaer_light_1_crude_2a.3534.3534.248.27890.5956352668.782669.161131.042.2%8K.VVAPELYIAVGISGAIQHLAGMKDSK.V2
*rpal_wt_anaer_light_1_pellet_full.4513.4513.361.95460.5438264147.234148.7182.050.6%7K.VIVAINKDEDAPIFQVADYGLVADLYQAVPELTEELGK.L3
*rpal_wt_anaer_light_1_cleared_full.4618.4618.353.86740.4927284446.244447.081172.044.2%5K.VIVAINKDEDAPIFQVADYGLVADLYQAVPELTEELGKLGK.-3

URPA15353420274.1%139146339.5cycA cytochrome c2 1703088:1703507 reverse MW:14633
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_crude_2.563.563.134.88640.378087721.81721.8321232.090.9%6K.AGEAVFK.Q1
*rpal_wt_anaer_light_1_cleared_full.1209.1209.260.55880.5553871541.571541.821186.065.5%8R.ADKNMVGPALGGVVGR.K2
*rpal_wt_anaer_light_1_cleared_1a.1366.1366.368.30220.4231681542.11541.821191.059.6%9R.ADKNMVGPALGGVVGR.K3
*rpal_wt_anaer_light_1_crude_5.1100.1100.133.66240.4778741543.021541.821136.054.2%6R.ADKNMVGPALGGVVGR.K1
*rpal_wt_anaer_light_1_cleared_full.1005.1005.255.7950.6559551669.661669.99174.061.3%4R.ADKNMVGPALGGVVGRK.A2
*rpal_wt_anaer_light_1_cleared_1a.1158.1158.356.47310.4013731671.641669.991215.055.8%3R.ADKNMVGPALGGVVGRK.A3
*rpal_wt_anaer_light_1_crude_2a.1523.1523.125.9150.4451511226.791227.47141.050.0%2K.NMVGPALGGVVGR.K1
*rpal_wt_anaer_light_1_cleared_full.1376.1376.245.39260.4548631227.321227.471179.058.3%5K.NMVGPALGGVVGR.K2
*rpal_wt_anaer_light_1_pellet_full.3889.3889.357.51720.4652384495.514496.01197.054.7%5R.KAGTAAGFTYSPLNHNSGEAGLVWTADNIINYLNDPNAFLKK.F3
*rpal_wt_anaer_light_1_crude_full.4365.4365.351.98610.4465794238.444239.651173.047.7%2K.AGTAAGFTYSPLNHNSGEAGLVWTADNIINYLNDPNAFLK.K3
*rpal_wt_anaer_light_1_cleared_full.3933.3933.363.38420.4715784366.624367.821219.053.5%3K.AGTAAGFTYSPLNHNSGEAGLVWTADNIINYLNDPNAFLKK.F3
*rpal_wt_anaer_light_1_cleared_2a.534.534.148.1330.5483371806.911807.11106.065.4%2K.KFLTDKGKADQAVGVTK.M1
*rpal_wt_anaer_light_1_cleared_1.806.806.355.24560.4920371807.651807.11212.050.0%1K.KFLTDKGKADQAVGVTK.M3
*rpal_wt_anaer_light_1_crude_3.728.728.269.75390.7061911808.161807.11217.074.2%4K.KFLTDKGKADQAVGVTK.M2
*2rpal_wt_anaer_light_1_cleared_1a.391.391.128.31860.173112623.65623.7271242.087.5%2K.FLTDK.G11
*rpal_wt_anaer_light_1_cleared_2.476.476.133.06790.228194808.7808.9531178.090.9%3K.FLTDKGK.A1
*rpal_wt_anaer_light_1_cleared_2a.638.638.155.34120.5958091677.911678.931226.080.0%11K.FLTDKGKADQAVGVTK.M1
*rpal_wt_anaer_light_1_pellet_1a.1138.1138.274.56030.7030911678.661678.931186.076.7%17K.FLTDKGKADQAVGVTK.M2
*rpal_wt_anaer_light_1_cleared_1.956.956.359.01790.2600891679.831678.931171.059.2%10K.FLTDKGKADQAVGVTK.M3
*rpal_wt_anaer_light_1_crude_3.478.478.139.88920.4585131073.641074.221218.076.5%4K.GKADQAVGVTK.M1
*rpal_wt_anaer_light_1_cleared_2.436.436.136.17660.501092888.57888.9971184.078.6%7K.ADQAVGVTK.M1
*rpal_wt_anaer_light_1_cleared_4.922.922.140.60040.5477241365.831366.58132.082.4%2K.MTFKLANEQQR.K1
*rpal_wt_anaer_light_1_cleared_1.1133.1133.253.1120.6383771366.231366.581225.075.0%2K.MTFKLANEQQR.K2
*rpal_wt_anaer_light_1_cleared_1.1130.1130.348.10380.4114891368.011366.581194.065.7%1K.MTFKLANEQQR.K3
*rpal_wt_anaer_light_1_cleared_full.295.295.133.71890.284437858.59858.93140.090.9%4K.LANEQQR.K1
*rpal_wt_anaer_light_1_cleared_1.394.394.231.80210.307546860.61858.931193.061.5%1K.LANEQQR.K2
*rpal_wt_anaer_light_1_crude_3.438.438.128.14390.326682986.71987.105125.072.7%1K.LANEQQRK.D1
*rpal_wt_anaer_light_1_cleared_full.1694.1694.356.17130.3331562061.242061.391238.048.2%2K.LANEQQRKDVVAYLATLK.-3
*rpal_wt_anaer_light_1_crude_3.2011.2011.248.27570.5950882061.42061.39126.054.8%6K.LANEQQRKDVVAYLATLK.-2
*rpal_wt_anaer_light_1_cleared_4.1748.1748.146.57820.5868351218.641221.481190.081.2%24R.KDVVAYLATLK.-1
*rpal_wt_anaer_light_1_cleared_1a.1841.1841.372.7410.5817851222.481221.481253.075.7%9R.KDVVAYLATLK.-3
*rpal_wt_anaer_light_1_pellet_full.1972.1972.270.07210.6621581222.761221.481234.090.0%14R.KDVVAYLATLK.-2
*rpal_wt_anaer_light_1_cleared_full.2168.2168.141.62430.487221092.651093.31136.081.2%14K.DVVAYLATLK.-1
*rpal_wt_anaer_light_1_crude_1.2770.2770.249.96380.4935191093.491093.311247.072.2%8K.DVVAYLATLK.-2
Similarities: RPA1606(1:33)

URPA3246132773.9%921022010.4rpsS 30S ribosomal protein S19 3656696:3656974 reverse MW:10219
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_membrane_1.2583.2583.347.69610.3284541817.441817.181225.044.0%1M.VRSVWKGPFVEASLLK.K3
*rpal_wt_anaer_light_1_membrane_3.2312.2312.235.34570.4671431818.41817.181195.042.9%1M.VRSVWKGPFVEASLLK.K2
*rpal_wt_anaer_light_1_membrane_1.2210.2210.348.28950.2943411945.971945.361122.044.4%1M.VRSVWKGPFVEASLLKK.A3
*rpal_wt_anaer_light_1_membrane_1.2389.2389.355.07320.4947361691.41690.04187.058.1%1R.SVWKGPFVEASLLKK.A3
*rpal_wt_anaer_light_1_pellet_2a.1718.1718.129.13520.4241841060.921061.271154.066.7%1K.GPFVEASLLK.K1
*rpal_wt_anaer_light_1_membrane_3.406.406.129.78970.438991982.76983.1161102.076.9%1R.ASGRHDVIK.I1
*rpal_wt_anaer_light_1_membrane_3.3249.3249.249.9480.6265022226.432226.581226.047.2%2R.RSTILPQFVGLTFGVYNGQK.H2
*rpal_wt_anaer_light_1_membrane_3.3633.3633.250.11860.6417242070.022070.41152.055.9%3R.STILPQFVGLTFGVYNGQK.H2
*rpal_wt_anaer_light_1_crude_2.1053.1053.230.45310.3614511562.261562.791129.046.2%1K.HVPVSVNEEMVGHK.F2
*rpal_wt_anaer_light_1_pellet_1a.1250.1250.358.60260.5385171564.331562.791144.052.2%5K.HVPVSVNEEMVGHK.F3
*rpal_wt_anaer_light_1_pellet_2a.1629.1629.254.51570.6472942486.492484.8136.053.8%4K.HVPVSVNEEMVGHKFGEFSPTR.T2
*rpal_wt_anaer_light_1_pellet_3.1184.1184.125.09720.344708940.89941.0311160.069.2%1K.FGEFSPTR.T1
*rpal_wt_anaer_light_1_membrane_1a.1052.1052.244.43990.666568941.12941.0311252.068.8%5K.FGEFSPTR.T2

URPA061671573.6%106111885.5RPA0616 Uncharacterized BCR 684542:684862 forward MW:11188
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_crude_full.1690.1690.131.16580.43309913.41913.1481187.069.2%1M.ADFLGMMK.Q1
*rpal_wt_anaer_light_1_crude_full.2779.2779.242.43580.470522406.422404.81128.036.6%1K.MKAMQAELDQIEVEGLSGGGLVK.V2
*rpal_wt_anaer_light_1_cleared_3.2925.2925.265.87260.6489342144.552145.441254.057.9%3K.AMQAELDQIEVEGLSGGGLVK.V2
*rpal_wt_anaer_light_1_cleared_full.1603.1603.131.67550.4889931042.621043.251178.066.7%2R.GISIDPSLIK.A1
*rpal_wt_anaer_light_1_cleared_1a.1798.1798.237.89460.464381043.881043.251174.061.1%2R.GISIDPSLIK.A2
*rpal_wt_anaer_light_1_crude_2.2711.2711.357.78450.4736372189.572189.35154.050.0%1K.ADEREVLEDLLAAAHGDAHR.K3
*rpal_wt_anaer_light_1_cleared_2a.2985.2985.158.92250.72141551.711552.881181.076.0%5K.MQALTGGLGLPPGLGLG.-1

URPA1175122673.3%131144406.1RPA1175 response regulator receiver (CheY-like protein) 1283518:1283913 forward MW:14439
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_cleared_2a.2433.2433.248.21050.5071862391.12391.641171.050.0%3R.NLLKQLGFENIDDASDGSAALAK.M2
*rpal_wt_anaer_light_1_membrane_full.1962.1962.249.92070.5557451922.241923.04184.050.0%4K.QLGFENIDDASDGSAALAK.M2
*rpal_wt_anaer_light_1_crude_4.3298.3298.234.72110.4331722474.162474.91194.037.8%1K.KYGLVISDWNMEPMTGYDLLK.E2
*rpal_wt_anaer_light_1_crude_2a.3128.3128.254.8530.6617632346.022346.731152.055.6%5K.YGLVISDWNMEPMTGYDLLK.E2
*rpal_wt_anaer_light_1_cleared_1a.3571.3571.345.56840.3535042730.132731.161206.043.8%1K.YGLVISDWNMEPMTGYDLLKEVR.A3
*rpal_wt_anaer_light_1_cleared_2a.3281.3281.234.08190.4810122730.992731.161170.036.6%1K.YGLVISDWNMEPMTGYDLLKEVR.A2
*rpal_wt_anaer_light_1_cleared_3.2646.2646.244.80820.6226651963.681964.251115.048.4%3R.ADPNLSQTPFIMITAESK.T2
*rpal_wt_anaer_light_1_cleared_1a.1591.1591.355.54410.4540391950.241949.31153.050.8%2K.KAGVNNYIVKPFNAATLK.T3
*rpal_wt_anaer_light_1_cleared_3.1555.1555.239.1190.4387181950.421949.31232.041.9%1K.KAGVNNYIVKPFNAATLK.T2
*rpal_wt_anaer_light_1_cleared_4.1387.1387.139.88040.5119981398.91398.61172.065.0%1K.TKIEAVFPDHVAA.-1
*rpal_wt_anaer_light_1_cleared_full.1424.1424.235.13660.5186961168.931169.321208.042.1%1K.IEAVFPDHVAA.-2
*rpal_wt_anaer_light_1_crude_3.1733.1733.130.97040.3010231171.781169.321161.062.5%3K.IEAVFPDHVAA.-1

URPA05573413472.9%332345448.7cysK cysteine synthase, cytosolic O-acetylserine(thiol)lyase 618596:619594 forward MW:34544
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_cleared_full.1789.1789.249.27360.6822561982.361983.191192.051.6%3R.GRVYESIADAYGDTPLVR.L2
*rpal_wt_anaer_light_1_cleared_full.1836.1836.129.34260.5408281768.821769.951197.054.2%1R.VYESIADAYGDTPLVR.L1
*rpal_wt_anaer_light_1_pellet_2.2337.2337.275.47910.7363011770.661769.951255.076.7%8R.VYESIADAYGDTPLVR.L2
*rpal_wt_anaer_light_1_crude_1.488.488.360.62870.5149391289.751290.511243.069.7%1R.LNRLPQQHGVK.A3
*rpal_wt_anaer_light_1_crude_4.578.578.133.39960.4862181289.931290.5115.064.7%3R.LNRLPQQHGVK.A1
*rpal_wt_anaer_light_1_cleared_1a.398.398.242.43160.5558641290.711290.5113.065.0%3R.LNRLPQQHGVK.A2
*rpal_wt_anaer_light_1_crude_full.1485.1485.136.84340.56141254.581255.411226.070.6%4K.LEYFNPASSVK.D1
*rpal_wt_anaer_light_1_crude_1a.1876.1876.242.02610.473421255.041255.411220.060.0%2K.LEYFNPASSVK.D2
*rpal_wt_anaer_light_1_crude_full.1320.1320.242.64750.5418981526.221526.691146.058.3%3K.LEYFNPASSVKDR.I2
*rpal_wt_anaer_light_1_cleared_1.2096.2096.366.12660.5154761532.661533.91244.072.1%3R.LKLVMPESMSIER.R3
*rpal_wt_anaer_light_1_cleared_full.1731.1731.234.50530.2572881535.491533.91161.050.0%1R.LKLVMPESMSIER.R2
*rpal_wt_anaer_light_1_crude_1a.2034.2034.245.59720.6479061291.851292.56188.065.0%5K.LVMPESMSIER.R2
*rpal_wt_anaer_light_1_crude_1a.4683.4683.237.16230.5822541677.511678.05132.050.0%2K.MLAFLGAELVLTEAAK.G2
*rpal_wt_anaer_light_1_cleared_full.2340.2340.262.00690.6704452370.772371.761190.050.0%4K.GAVAKAEELVAATPNAVMPQQFK.N2
*rpal_wt_anaer_light_1_crude_full.2024.2024.141.22880.6581011943.811945.251183.059.3%7K.AEELVAATPNAVMPQQFK.N1
*rpal_wt_anaer_light_1_cleared_1a.2079.2079.345.02180.4115071944.041945.251244.040.0%1K.AEELVAATPNAVMPQQFK.N3
*rpal_wt_anaer_light_1_pellet_full.2093.2093.260.4740.6844911944.331945.251249.062.5%8K.AEELVAATPNAVMPQQFK.N2
*rpal_wt_anaer_light_1_cleared_2a.3597.3597.356.55790.4682483717.483719.11101.045.4%10R.TTAEEIWNDTDGAVDIFVAGVGTGGTVSGVGQVLKPR.K3
*rpal_wt_anaer_light_1_cleared_2a.1258.1258.252.17730.6279952584.522584.981206.042.6%2R.KASLKVVAVEPEESPVLSGGAPGPHK.I2
*rpal_wt_anaer_light_1_cleared_full.1260.1260.351.08550.4376252585.652584.981172.046.8%1R.KASLKVVAVEPEESPVLSGGAPGPHK.I3
*rpal_wt_anaer_light_1_crude_2a.1366.1366.256.70740.6889192057.112057.311134.054.1%4K.VVAVEPEESPVLSGGAPGPHK.I2
*rpal_wt_anaer_light_1_pellet_1.1884.1884.358.14210.5481422058.492057.311241.049.3%4K.VVAVEPEESPVLSGGAPGPHK.I3
*rpal_wt_anaer_light_1_cleared_2a.2604.2604.354.88710.4220683609.783610.11133.047.8%2K.VVAVEPEESPVLSGGAPGPHKIQGIGAGFVPDILDR.S3
*rpal_wt_anaer_light_1_crude_5.1631.1631.231.39540.4521973611.363610.1110.025.0%1K.VVAVEPEESPVLSGGAPGPHKIQGIGAGFVPDILDR.S2
*rpal_wt_anaer_light_1_cleared_full.2573.2573.273.92860.7141161572.481571.821248.078.6%6K.IQGIGAGFVPDILDR.S2
*rpal_wt_anaer_light_1_crude_2.1406.1406.127.54880.151328888.51889.037121.075.0%1R.SVIDEVVK.I1
*rpal_wt_anaer_light_1_cleared_full.2134.2134.368.79660.5211752016.092016.31240.053.2%7R.SVIDEVVKIPSATAIETSR.A3
*rpal_wt_anaer_light_1_pellet_full.2365.2365.246.37140.4902312017.02016.31210.047.1%10R.SVIDEVVKIPSATAIETSR.A2
*rpal_wt_anaer_light_1_crude_1.1236.1236.249.42960.6231911148.641146.29123.071.4%2K.IPSATAIETSR.A2
*rpal_wt_anaer_light_1_crude_full.2183.2183.254.87210.6371232772.342773.1210.042.3%7R.HEGIPGGISSGAAIAAAIELGKRPENAGK.T2
*rpal_wt_anaer_light_1_pellet_full.2304.2304.359.46940.5236342772.712773.121176.044.7%7R.HEGIPGGISSGAAIAAAIELGKRPENAGK.T3
*rpal_wt_anaer_light_1_cleared_full.1851.1851.128.38070.4858441318.731319.54134.063.2%1K.TIVAIVPSFSER.Y1
*rpal_wt_anaer_light_1_cleared_full.1850.1850.250.64410.5326211318.861319.541228.068.2%8K.TIVAIVPSFSER.Y2
*rpal_wt_anaer_light_1_cleared_full.2678.2678.125.99840.357261127.581128.31134.057.1%2R.YLSTVLFEGV.-1

URPA38205972.8%8184208.5RPA3820 Protein of unknown function UPF0062 4316040:4316285 reverse MW:8419
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_pellet_1a.577.577.126.38860.196274701.5701.8421180.072.7%2K.AIEGALK.S1
*rpal_wt_anaer_light_1_pellet_1a.1836.1836.247.78270.5281561030.411030.211243.061.9%1K.SLGVAGIASVR.Q2
*rpal_wt_anaer_light_1_crude_2.1746.1746.234.26110.4538061493.731492.671233.042.3%1K.VFDIELDGAADKAK.A2
*rpal_wt_anaer_light_1_pellet_4.2747.2747.253.74670.6383552390.612390.71192.053.8%2K.AEAALKDAADKLLANTVIENYR.V2
*rpal_wt_anaer_light_1_pellet_4.3263.3263.266.6670.6809082887.842888.29183.048.9%3K.AEAALKDAADKLLANTVIENYRVEVLG.-2

URPA17893010972.2%385408848.5RPA1789 putative branched-chain amino acid transport system substrate-binding protein 2004817:2005974 forward MW:40884
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_cleared_3.1161.1161.138.50070.400925891.91892.043119.091.7%8R.NALEFVAK.E1
*rpal_wt_anaer_light_1_cleared_full.1001.1001.237.80130.454201893.72892.0431204.073.3%2R.NALEFVAK.E2
*rpal_wt_anaer_light_1_cleared_2a.1503.1503.259.57910.577322618.242618.911228.053.5%8K.EIGGHPLKVIVLDDGGDPTAATTNAR.R2
*rpal_wt_anaer_light_1_cleared_2.1749.1749.375.20510.4785552618.52618.911199.052.1%3K.EIGGHPLKVIVLDDGGDPTAATTNAR.R3
*rpal_wt_anaer_light_1_cleared_full.1239.1239.286.22880.594991787.731786.941238.078.1%8K.VIVLDDGGDPTAATTNAR.R2
*rpal_wt_anaer_light_1_cleared_4.3262.3262.355.37870.2805213963.873964.58176.050.0%5K.ADVIMGSSVTPPTVAVSNVANEAQVPHIALAPLPITPER.A3
*rpal_wt_anaer_light_1_crude_5.1441.1441.142.60340.5121591754.031755.21203.066.7%1R.AKWSVAMPQPIPIMGK.V1
*rpal_wt_anaer_light_1_cleared_full.2079.2079.262.84910.6701851756.151755.21190.067.9%6R.AKWSVAMPQPIPIMGK.V2
*rpal_wt_anaer_light_1_cleared_1a.2316.2316.349.38440.3224461757.131755.21227.048.9%3R.AKWSVAMPQPIPIMGK.V3
*rpal_wt_anaer_light_1_cleared_2a.2402.2402.139.01020.5965771554.671555.951182.055.0%5K.WSVAMPQPIPIMGK.V1
*rpal_wt_anaer_light_1_cleared_full.2398.2398.243.05380.5370881556.211555.951143.056.0%5K.WSVAMPQPIPIMGK.V2
*rpal_wt_anaer_light_1_cleared_2a.2542.2542.238.40590.158222441.382442.691194.043.2%1K.TVGYIGYSDSYGDLWFNDLKK.Q2
*rpal_wt_anaer_light_1_cleared_4.1281.1281.137.81060.3923451488.741489.72125.059.1%5R.FARPDTSVAGQVLK.L1
*rpal_wt_anaer_light_1_cleared_1.1516.1516.346.03220.3343831489.411489.721242.052.4%1R.FARPDTSVAGQVLK.L3
*rpal_wt_anaer_light_1_cleared_full.1228.1228.263.61860.6299571490.011489.721255.073.1%8R.FARPDTSVAGQVLK.L2
*rpal_wt_anaer_light_1_crude_full.2764.2764.281.07150.6857292477.742478.851242.060.9%12K.LVAANPDAILVGASGTAAALPQTSLR.E2
*rpal_wt_anaer_light_1_pellet_1a.3184.3184.364.19460.5468082478.062478.851122.049.3%8K.LVAANPDAILVGASGTAAALPQTSLR.E3
*rpal_wt_anaer_light_1_cleared_full.2381.2381.353.91590.4635592764.772764.161180.038.3%1K.LVAANPDAILVGASGTAAALPQTSLRER.G3
*rpal_wt_anaer_light_1_crude_3.2017.2017.255.6510.6451552129.022129.451207.052.9%1R.GYKGLIYQTHGAASMDFIR.I2
*rpal_wt_anaer_light_1_crude_4.2260.2260.232.46610.390332505.662506.771131.031.8%1K.SAEGVLMASGPVMDPEGQDDSALTK.K2
*rpal_wt_anaer_light_1_cleared_2a.2183.2183.349.12370.3800533921.223922.381132.044.6%2K.SAEGVLMASGPVMDPEGQDDSALTKKPGLELNTAYEAK.Y3
*rpal_wt_anaer_light_1_crude_full.1359.1359.146.53820.6566461355.561356.481240.072.2%5R.SQFAAHSFDAFK.V1
*rpal_wt_anaer_light_1_cleared_1a.1393.1393.258.49090.745131356.581356.481109.077.3%2R.SQFAAHSFDAFK.V2
*rpal_wt_anaer_light_1_cleared_3.2070.2070.247.61010.6685161856.171854.081240.051.7%1R.SQFAAHSFDAFKVLER.V2
*rpal_wt_anaer_light_1_cleared_1a.1212.1212.345.44620.4366441841.731842.19184.051.1%1R.VVPVALKTAKPGTQEFR.E3
*rpal_wt_anaer_light_1_cleared_3.1208.1208.246.73980.6133721844.081842.191171.055.2%2R.VVPVALKTAKPGTQEFR.E2
*rpal_wt_anaer_light_1_cleared_4.1951.1951.254.10060.6357992389.732388.591182.046.2%1K.ALVSEKDIAASQGVYSFTETDR.Y2
*rpal_wt_anaer_light_1_cleared_1.795.795.237.55230.429486986.59987.2291205.064.7%1R.ILLTVKDGK.Y2
*rpal_wt_anaer_light_1_cleared_3.731.731.126.64260.288711986.74987.2291192.064.3%1R.ILLTVKDGK.Y1
*rpal_wt_anaer_light_1_cleared_1.550.550.125.95640.140724639.49639.8361172.087.5%1K.YVMVK.-1

URPA32542311071.8%1561768810.3rpsG 30S ribosomal protein S7 3663258:3663728 reverse MW:17688
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_crude_2.652.652.125.6490.283286797.5797.9271246.058.3%1R.EVLPDPK.F1
*rpal_wt_anaer_light_1_membrane_full.1167.1167.133.16460.43765891.64892.086165.083.3%8K.FGNIIVTK.F1
*rpal_wt_anaer_light_1_pellet_full.1260.1260.253.28950.437625892.0892.0861251.081.2%8K.FGNIIVTK.F2
*rpal_wt_anaer_light_1_pellet_1.1776.1776.230.50210.1521931150.861148.39136.050.0%1K.FMNSVMYAGK.K2
*rpal_wt_anaer_light_1_pellet_4.1308.1308.128.43150.3722811275.871276.56140.070.6%1K.FMNSVMYAGKK.S1
*rpal_wt_anaer_light_1_membrane_1.4261.4261.359.86360.5260161940.461941.23198.050.9%2K.KSVAESIVYGAFDLIEAK.T3
*rpal_wt_anaer_light_1_membrane_1a.3993.3993.250.96190.6047831940.781941.231211.056.2%3K.KSVAESIVYGAFDLIEAK.T2
*rpal_wt_anaer_light_1_membrane_2a.3926.3926.148.99870.662551811.651813.061252.070.8%2K.SVAESIVYGAFDLIEAK.T1
*rpal_wt_anaer_light_1_membrane_1a.4260.4260.269.62990.7028681812.051813.061234.075.0%14K.SVAESIVYGAFDLIEAK.T2
*rpal_wt_anaer_light_1_membrane_1a.4261.4261.398.71770.6966561813.571813.061183.076.0%14K.SVAESIVYGAFDLIEAK.T3
*rpal_wt_anaer_light_1_membrane_2a.3811.3811.258.49240.6534372583.082584.01146.057.1%18K.TKQPPLGVFEQALDNVMPTIEVR.S2
*rpal_wt_anaer_light_1_membrane_full.3741.3741.354.20020.3675892583.672584.011228.050.0%7K.TKQPPLGVFEQALDNVMPTIEVR.S3
*rpal_wt_anaer_light_1_membrane_full.4047.4047.231.16560.4215322353.912354.73137.029.7%1K.QPPLGVFEQALDNVMPTIEVR.S2
*rpal_wt_anaer_light_1_membrane_full.1242.1242.244.79420.6053461531.791531.761177.061.5%3R.RVGGATYQVPVEVR.S2
*rpal_wt_anaer_light_1_membrane_1.1538.1538.346.19910.4022481532.671531.761234.044.4%1R.RVGGATYQVPVEVR.S3
*rpal_wt_anaer_light_1_membrane_2a.1359.1359.136.61470.4685221374.741375.57169.073.7%6R.VGGATYQVPVEVR.S1
*rpal_wt_anaer_light_1_membrane_1a.1577.1577.255.66480.4097291375.121375.571234.069.6%5R.VGGATYQVPVEVR.S2
*rpal_wt_anaer_light_1_membrane_1.588.588.230.49860.193012814.47813.9791116.057.1%1R.RQALGIR.W2
*rpal_wt_anaer_light_1_pellet_1.1851.1851.233.20970.222829830.99831.0061192.071.4%3R.WLITAAR.G2
*rpal_wt_anaer_light_1_crude_2.1392.1392.242.92290.5041851770.411772.961193.050.0%3R.LSAELLDASNNRGNAVK.K2
*rpal_wt_anaer_light_1_membrane_5.856.856.125.73660.3384671771.931772.961130.048.0%2R.LSAELLDASNNRGNAVK.K1
*rpal_wt_anaer_light_1_cleared_1.1336.1336.360.11170.4047081773.411772.961252.060.0%4R.LSAELLDASNNRGNAVK.K3
*rpal_wt_anaer_light_1_membrane_3.1103.1103.232.87870.4552191900.481901.1311.041.9%2R.LSAELLDASNNRGNAVKK.R2

URPA38344615271.6%408454106.7idh NADP-dependent isocitrate dehydrogenase 4328043:4329269 forward MW:45410
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_crude_1a.1793.1793.249.0080.5956581702.081702.93133.059.3%3K.VKNPVVELDGDEMTR.I2
*rpal_wt_anaer_light_1_pellet_1.1978.1978.357.95040.5031351702.961702.931247.057.1%2K.VKNPVVELDGDEMTR.I3
*rpal_wt_anaer_light_1_cleared_4.1365.1365.127.52460.3992391474.751475.62152.052.6%1K.NPVVELDGDEMTR.I1
*rpal_wt_anaer_light_1_cleared_2.1503.1503.257.33020.6812991476.521475.62193.070.8%1K.NPVVELDGDEMTR.I2
*rpal_wt_anaer_light_1_crude_1.2161.2161.241.30420.379874932.05932.2171167.076.9%3R.IIWQMIK.D2
*rpal_wt_anaer_light_1_pellet_4.3988.3988.232.7280.4250822682.692684.1510.041.0%1K.DKLITPFLDVELMYFDLGMEHR.D2
*rpal_wt_anaer_light_1_pellet_2a.1323.1323.145.02320.5077761717.641718.86163.070.8%2R.DKTDDQVTIDAANAIK.Q1
*rpal_wt_anaer_light_1_pellet_2.1692.1692.262.85630.5455331718.31718.86170.069.0%4R.DKTDDQVTIDAANAIK.Q2
*rpal_wt_anaer_light_1_pellet_1.1883.1883.347.15920.2945551719.51718.861196.047.8%1R.DKTDDQVTIDAANAIK.Q3
*rpal_wt_anaer_light_1_pellet_2.2577.2577.352.63880.3755922385.972386.67186.039.7%3R.DKTDDQVTIDAANAIKQVGVGVK.C3
*rpal_wt_anaer_light_1_cleared_4.2161.2161.254.69230.5679062386.52386.671112.051.2%5R.DKTDDQVTIDAANAIKQVGVGVK.C2
*rpal_wt_anaer_light_1_crude_full.350.350.125.58710.153632689.54686.83140.075.0%1K.QVGVGVK.C1
*rpal_wt_anaer_light_1_crude_1a.935.935.131.52610.321013820.47821.0081204.081.8%5R.VKEFGLK.S1
*rpal_wt_anaer_light_1_pellet_full.2669.2669.263.87810.6583321672.191673.08153.073.1%8R.NILGGVIFREPIICK.N2
*rpal_wt_anaer_light_1_pellet_4.1975.1975.135.64720.3994681435.911436.78172.076.5%4R.LVPGWTKPIVIGR.H1
*rpal_wt_anaer_light_1_cleared_full.1564.1564.235.37740.5492211436.691436.78138.052.4%5R.LVPGWTKPIVIGR.H2
*rpal_wt_anaer_light_1_crude_5.1268.1268.131.15150.4180631577.01577.891197.052.2%2R.ATDIKFPGPGTLTMK.F1
*rpal_wt_anaer_light_1_pellet_2.2175.2175.231.07680.213961578.951577.891196.040.7%1R.ATDIKFPGPGTLTMK.F2
*rpal_wt_anaer_light_1_pellet_1a.2231.2231.345.81580.3937051580.81577.891139.043.8%1R.ATDIKFPGPGTLTMK.F3
*rpal_wt_anaer_light_1_crude_1.1315.1315.249.61960.6466861208.31208.311178.077.8%5K.FVGEDGSVIER.E2
*rpal_wt_anaer_light_1_pellet_2a.1109.1109.129.37240.2857791208.711208.311194.062.5%1K.FVGEDGSVIER.E1
*rpal_wt_anaer_light_1_cleared_3.3206.3206.371.32030.5051692846.322848.271163.056.8%6R.EVFKAPGAGVAMSMYNLDESIKDFAR.A3
*rpal_wt_anaer_light_1_crude_full.3067.3067.251.93930.6346292847.272848.271195.047.8%7R.EVFKAPGAGVAMSMYNLDESIKDFAR.A2
*rpal_wt_anaer_light_1_pellet_2.3402.3402.345.75230.4191512346.852344.671210.047.8%1K.APGAGVAMSMYNLDESIKDFAR.A3
*rpal_wt_anaer_light_1_cleared_3.1289.1289.130.3330.3293871024.771025.22168.071.4%3R.ASLNYGLMR.N1
*rpal_wt_anaer_light_1_pellet_1.1848.1848.242.61120.5259421026.561025.221173.070.6%5R.ASLNYGLMR.N2
*rpal_wt_anaer_light_1_cleared_2a.970.970.135.83420.5489141084.841085.251142.078.6%8R.NYPVYLSTK.N1
*rpal_wt_anaer_light_1_crude_full.3148.3148.232.22980.5135221906.551906.1910.042.9%1R.FKDIFQEIFDAEFKK.E2
*rpal_wt_anaer_light_1_crude_4.3082.3082.241.29110.4910672515.62512.82168.045.7%2R.FKDIFQEIFDAEFKKEYDAK.G2
*rpal_wt_anaer_light_1_crude_2a.1925.1925.138.28180.592181175.741176.421166.075.0%3R.LIDDMVASALK.W1
*rpal_wt_anaer_light_1_crude_1.2402.2402.258.80570.656881175.841176.421183.084.2%6R.LIDDMVASALK.W2
*rpal_wt_anaer_light_1_pellet_4.691.691.127.98230.5047261341.811342.45140.057.9%1K.TVEAEAAHGTVTR.H1
*rpal_wt_anaer_light_1_cleared_3.2558.2558.253.67510.6693641812.041812.041218.060.0%1K.GKATSTNSIASIFAWTR.G2
*rpal_wt_anaer_light_1_pellet_2.3264.3264.250.18520.6613641626.351626.811238.059.3%4K.ATSTNSIASIFAWTR.G2
*rpal_wt_anaer_light_1_cleared_4.546.546.125.32380.33481245.861246.361146.056.2%1R.AKLDSNEELAR.F1
*rpal_wt_anaer_light_1_crude_1a.880.880.230.63580.4492591247.611246.361224.045.0%1R.AKLDSNEELAR.F2
*rpal_wt_anaer_light_1_pellet_full.1385.1385.136.05980.41599835.54835.9761237.081.8%4R.FADLLEK.V1
*rpal_wt_anaer_light_1_crude_1.1444.1444.240.44420.508253835.89835.9761225.078.6%3R.FADLLEK.V2
*rpal_wt_anaer_light_1_crude_3.3410.3410.247.87490.53012142.212141.511136.052.8%3R.FADLLEKVCVDTVEAGAMTK.D2
*rpal_wt_anaer_light_1_cleared_1a.3277.3277.353.69520.4628982144.082141.511236.041.5%2R.FADLLEKVCVDTVEAGAMTK.D3
*rpal_wt_anaer_light_1_crude_2a.1283.1283.134.43150.60461323.771324.561196.070.0%3K.VCVDTVEAGAMTK.D1
*rpal_wt_anaer_light_1_pellet_1a.1586.1586.253.7250.7109391324.71324.561148.066.7%3K.VCVDTVEAGAMTK.D2
*rpal_wt_anaer_light_1_pellet_1.2369.2369.255.36960.5958291172.151171.341251.071.4%2K.DLALLVGADQR.W2
*rpal_wt_anaer_light_1_pellet_full.2083.2083.136.16330.5876451195.761196.35157.075.0%11R.WLSTEGFLDK.V1
*rpal_wt_anaer_light_1_crude_1.2338.2338.235.51030.4598721196.131196.351144.057.9%4R.WLSTEGFLDK.V2
*rpal_wt_anaer_light_1_cleared_full.2763.2763.268.51480.6071081963.571964.231127.069.0%8R.WLSTEGFLDKVAQNLNK.A2

URPA05314523971.4%392405536.8RPA0531 beta-ketothiolase, acetoacetyl-CoA thiolase 590894:592072 forward MW:40553
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_crude_2a.1175.1175.135.61730.3693091131.811132.261206.068.8%8M.SDDVVIVSAAR.T1
*rpal_wt_anaer_light_1_crude_1.1265.1265.255.76980.3205821132.541132.261182.076.2%3M.SDDVVIVSAAR.T2
*rpal_wt_anaer_light_1_pellet_3.2529.2529.248.37440.6487612343.942344.631180.046.3%10R.TAVGSFNGAFANTPAHELGAVAIK.A2
*rpal_wt_anaer_light_1_pellet_2.2729.2729.351.57140.3946432345.292344.63193.048.5%5R.TAVGSFNGAFANTPAHELGAVAIK.A3
*rpal_wt_anaer_light_1_crude_full.3824.3824.393.26290.5727252707.392709.06162.059.7%13R.GGIDPAQVSEVIMGQILTAGQGQNPAR.Q3
*rpal_wt_anaer_light_1_pellet_full.3777.3777.293.34590.7117752707.992709.061254.060.9%20R.GGIDPAQVSEVIMGQILTAGQGQNPAR.Q2
*rpal_wt_anaer_light_1_pellet_full.3119.3119.261.75970.6717972581.942582.941140.054.3%9R.QASIAAGIPVDSPAWGINQLCGSGLR.S2
*rpal_wt_anaer_light_1_pellet_1a.3551.3551.358.88850.4802012582.652582.94198.054.1%3R.QASIAAGIPVDSPAWGINQLCGSGLR.S3
*rpal_wt_anaer_light_1_crude_2a.2608.2608.141.64080.2803571306.761307.621156.076.5%2K.MGAVELVDTMLK.D1
*rpal_wt_anaer_light_1_crude_1a.3248.3248.272.29340.4692411307.71307.621251.090.0%9K.MGAVELVDTMLK.D2
*rpal_wt_anaer_light_1_pellet_2a.4136.4136.362.23420.5118913628.83628.1187.050.6%6K.MGAVELVDTMLKDGLWDAFNGYHMGNTAENVAR.Q3
*rpal_wt_anaer_light_1_pellet_2.2844.2844.360.45970.5069642339.322339.511173.050.8%3K.DGLWDAFNGYHMGNTAENVAR.Q3
*rpal_wt_anaer_light_1_pellet_3.2630.2630.256.38020.5776032339.462339.51188.054.1%9K.DGLWDAFNGYHMGNTAENVAR.Q2
*rpal_wt_anaer_light_1_pellet_full.1042.1042.277.82810.6380641494.461494.561252.087.5%7R.DQQDEFAVASQQK.A2
*rpal_wt_anaer_light_1_pellet_5.860.860.153.98820.5606931496.811494.56128.085.0%9R.DQQDEFAVASQQK.A1
*rpal_wt_anaer_light_1_pellet_2.1409.1409.354.73810.4595562093.772093.221227.057.7%1R.DQQDEFAVASQQKAEAAQK.A3
*rpal_wt_anaer_light_1_pellet_2a.1076.1076.256.71190.5754952094.272093.221193.061.8%4R.DQQDEFAVASQQKAEAAQK.A2
*rpal_wt_anaer_light_1_pellet_3.1537.1537.237.52250.4464492144.232144.52198.042.9%1K.AEAAQKAGKFKDEIVPVTIK.T2
*rpal_wt_anaer_light_1_pellet_full.1448.1448.251.81050.5224191545.41545.861220.068.0%4K.AGKFKDEIVPVTIK.T2
*rpal_wt_anaer_light_1_pellet_2a.1312.1312.149.67020.6463011545.891545.861149.076.2%3K.AGKFKDEIVPVTIK.T1
*rpal_wt_anaer_light_1_cleared_1.1433.1433.352.31810.3260111548.211545.861169.054.8%3K.AGKFKDEIVPVTIK.T3
*rpal_wt_anaer_light_1_crude_full.1467.1467.148.990.5429391288.721289.561223.083.3%8K.FKDEIVPVTIK.T1
*rpal_wt_anaer_light_1_cleared_1a.1502.1502.250.82410.5888471289.771289.561237.070.0%8K.FKDEIVPVTIK.T2
*rpal_wt_anaer_light_1_pellet_2a.1091.1091.148.25410.6479031506.721507.641213.080.0%5R.KGDIVVDTDEYPR.H1
*rpal_wt_anaer_light_1_pellet_1a.1418.1418.368.36430.5506511508.141507.641119.071.1%4R.KGDIVVDTDEYPR.H3
*rpal_wt_anaer_light_1_crude_full.1069.1069.276.05950.6859081508.521507.641255.082.6%8R.KGDIVVDTDEYPR.H2
*rpal_wt_anaer_light_1_cleared_4.1319.1319.239.74710.4584212518.362517.82133.037.5%2R.KGDIVVDTDEYPRHGATLEAMAK.L2
*rpal_wt_anaer_light_1_pellet_2a.527.527.140.35660.498921028.741029.211226.080.0%9R.HGATLEAMAK.L1
*rpal_wt_anaer_light_1_pellet_full.484.484.270.26020.6855721029.941029.211223.089.5%4R.HGATLEAMAK.L2
*rpal_wt_anaer_light_1_pellet_full.2282.2282.253.2720.5673323092.113092.54166.040.4%4K.LKPAFEKDGTVTAGSASGINDGAAAVVLMTAK.Q2
*rpal_wt_anaer_light_1_pellet_full.2275.2275.369.93460.5024743093.643092.541198.052.7%6K.LKPAFEKDGTVTAGSASGINDGAAAVVLMTAK.Q3
*rpal_wt_anaer_light_1_pellet_1.541.541.236.18580.352801883.73883.1261192.066.7%1K.LGKKPLAR.I2
*rpal_wt_anaer_light_1_crude_4.1317.1317.126.01260.3890881256.781257.431128.061.1%3R.IVSWGQAGVDPK.I1
*rpal_wt_anaer_light_1_cleared_1.1414.1414.263.31910.6060221257.971257.431229.077.3%7R.IVSWGQAGVDPK.I2
*rpal_wt_anaer_light_1_pellet_3.1138.1138.129.67150.2592451085.741086.31129.062.5%3K.IMGSGPIPASR.A1
*rpal_wt_anaer_light_1_pellet_1.1365.1365.243.13850.3957721086.471086.31230.065.0%6K.IMGSGPIPASR.A2
*rpal_wt_anaer_light_1_pellet_full.2144.2144.370.32910.5819582734.262735.031199.059.0%2K.DLGWDTSKVNVNGGAIAIGHPIGASGAR.V3
*rpal_wt_anaer_light_1_pellet_4.2242.2242.245.74840.6038722734.622735.03188.040.4%1K.DLGWDTSKVNVNGGAIAIGHPIGASGAR.V2
*rpal_wt_anaer_light_1_pellet_3.1565.1565.265.310.6951091831.661832.071248.061.1%4K.VNVNGGAIAIGHPIGASGAR.V2
*rpal_wt_anaer_light_1_crude_2a.1675.1675.143.09090.564231310.771311.631213.070.6%4R.VLVTLLHEMQK.R1
*rpal_wt_anaer_light_1_pellet_full.1848.1848.262.77240.6986721311.791311.631213.080.0%4R.VLVTLLHEMQK.R2
*rpal_wt_anaer_light_1_pellet_1.2333.2333.345.94630.2599561312.051311.631184.060.0%2R.VLVTLLHEMQK.R3
*rpal_wt_anaer_light_1_pellet_2a.1533.1533.137.51910.4723491466.861467.821147.066.7%3R.VLVTLLHEMQKR.D1
*rpal_wt_anaer_light_1_pellet_1a.1963.1963.260.66310.6620681467.341467.821198.077.3%6R.VLVTLLHEMQKR.D2
*rpal_wt_anaer_light_1_pellet_1.2138.2138.357.77910.4747081468.561467.821156.065.0%3R.VLVTLLHEMQKR.D3

URPA3101258671.4%161172669.0RPA3101 conserved unknown protein 3507093:3507578 reverse MW:17266
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_cleared_1a.336.336.129.01240.349127563.62563.7391250.087.5%5K.AMLTK.A1
*rpal_wt_anaer_light_1_cleared_2.407.407.134.94970.242271844.65844.9871204.078.6%1K.AAAAVKADK.A1
*rpal_wt_anaer_light_1_cleared_3.399.399.142.26350.4604191043.721044.241232.081.2%1K.AAAAVKADKAK.A1
*rpal_wt_anaer_light_1_crude_2.737.737.128.30650.385067749.69749.8851166.072.7%3K.ALAEFAK.G1
*rpal_wt_anaer_light_1_cleared_full.2473.2473.361.9010.5109723886.653886.381233.050.5%2K.ALAEFAKGEGGFKDRDLYPFCGGPDGLFTAHPTLTGK.S3
*rpal_wt_anaer_light_1_crude_full.2484.2484.239.40550.4724523155.333155.521192.037.3%3K.GEGGFKDRDLYPFCGGPDGLFTAHPTLTGK.S2
*rpal_wt_anaer_light_1_crude_full.2473.2473.379.76780.5319633155.443155.521227.059.3%6K.GEGGFKDRDLYPFCGGPDGLFTAHPTLTGK.S3
*rpal_wt_anaer_light_1_crude_3.3031.3031.240.63840.5815582308.62308.62120.043.6%3R.DLYPFCGGPDGLFTAHPTLTGK.S2
*rpal_wt_anaer_light_1_cleared_3.467.467.126.01420.149349948.74947.12133.066.7%1K.SLKDLKDK.T1
*rpal_wt_anaer_light_1_crude_full.1377.1377.264.61390.6602682406.112406.781141.063.2%6K.SLKDLKDKTGKPLGEEIYATAK.E2
*rpal_wt_anaer_light_1_crude_full.1379.1379.370.64690.5660012406.532406.781208.061.3%7K.SLKDLKDKTGKPLGEEIYATAK.E3
*rpal_wt_anaer_light_1_cleared_2a.1410.1410.345.94040.3204482951.082949.37126.044.7%1K.SLKDLKDKTGKPLGEEIYATAKEGEVK.E3
*rpal_wt_anaer_light_1_cleared_2a.1053.1053.247.44040.6224592078.622078.371211.055.9%2K.DLKDKTGKPLGEEIYATAK.E2
*rpal_wt_anaer_light_1_cleared_5.797.797.134.20660.4834361720.981721.95180.054.2%2K.DKTGKPLGEEIYATAK.E1
*rpal_wt_anaer_light_1_cleared_full.945.945.266.07890.7197831722.441721.951130.078.6%2K.DKTGKPLGEEIYATAK.E2
*rpal_wt_anaer_light_1_cleared_2a.981.981.145.86920.5955171477.751478.691183.075.0%3K.TGKPLGEEIYATAK.E1
*rpal_wt_anaer_light_1_cleared_1.1263.1263.356.57960.4499341478.921478.691190.060.5%2K.TGKPLGEEIYATAK.E3
*rpal_wt_anaer_light_1_cleared_2.1173.1173.263.12150.6869771478.931478.691137.076.0%5K.TGKPLGEEIYATAK.E2
*rpal_wt_anaer_light_1_cleared_2a.1499.1499.240.37450.462252544.952545.88153.035.9%7K.EGEVKEVAYMWPRPGQTDPVQK.V2
*rpal_wt_anaer_light_1_cleared_3.2117.2117.349.55360.3437773207.313207.681159.041.3%1K.EGEVKEVAYMWPRPGQTDPVQKVSFVTK.I3
*rpal_wt_anaer_light_1_crude_full.1545.1545.244.7330.5677082003.482003.291224.053.3%4K.EVAYMWPRPGQTDPVQK.V2
*rpal_wt_anaer_light_1_cleared_4.1982.1982.235.54860.4965652666.212665.091170.035.0%1K.EVAYMWPRPGQTDPVQKVSFVTK.I2
*rpal_wt_anaer_light_1_cleared_1.599.599.131.85420.355821680.44680.8221152.088.9%6K.VSFVTK.I1
*rpal_wt_anaer_light_1_cleared_4.1035.1035.140.11890.5382081317.831318.491130.068.4%7K.IGDQTCAVGYYK.-1
*rpal_wt_anaer_light_1_cleared_full.984.984.266.8320.7130971318.441318.491243.085.7%5K.IGDQTCAVGYYK.-2

URPA36721111871.4%8490738.5cspA5 cold shock DNA binding protein 4145943:4146197 forward MW:9073
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_pellet_full.652.652.130.76890.477593766.42766.8751179.090.0%11K.WFNATK.G1
*rpal_wt_anaer_light_1_cleared_2a.2356.2356.273.78910.7061642493.272493.71182.063.4%70K.GYGFIQPDDGGNDVFVHISAVER.A2
*rpal_wt_anaer_light_1_cleared_2.2676.2676.361.58560.5076452496.072493.71139.058.2%20K.GYGFIQPDDGGNDVFVHISAVER.A3
*rpal_wt_anaer_light_1_crude_3.588.588.127.67290.377811129.71130.291161.066.7%2R.AGLGTLREGQK.I1
*rpal_wt_anaer_light_1_cleared_full.463.463.246.59730.6230831130.561130.291109.057.9%2R.AGLGTLREGQK.I2
*rpal_wt_anaer_light_1_cleared_1a.1981.1981.361.65170.5332912177.462177.471196.044.4%2R.AGLGTLREGQKISYEIVADR.R3
*rpal_wt_anaer_light_1_cleared_full.910.910.234.42970.3258121664.731664.86134.052.0%1R.EGQKISYEIVADRR.S2
*rpal_wt_anaer_light_1_cleared_2a.1112.1112.133.82190.5150891065.751066.2199.078.6%1K.ISYEIVADR.R1
*rpal_wt_anaer_light_1_crude_1.1515.1515.257.30820.552681066.51066.21254.082.4%5K.ISYEIVADR.R2
*rpal_wt_anaer_light_1_cleared_1a.1067.1067.230.91290.2981051222.441222.391176.052.6%2K.ISYEIVADRR.S2
*rpal_wt_anaer_light_1_crude_3.453.453.132.15530.4114191034.641035.1198.066.7%2R.SGKSSADNLR.A1

URPA42165220971.3%724786276.6glcB malate synthase G 4759508:4761682 forward MW:78627
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_cleared_1.600.600.231.13320.3673831155.81155.37168.055.6%1-.MNRIDAHGLK.I2
*rpal_wt_anaer_light_1_cleared_full.2708.2708.261.450.66531234.591234.52160.085.0%10K.IAPVLFDFIAK.E2
*rpal_wt_anaer_light_1_crude_4.3054.3054.139.54880.4932011237.081234.521248.075.0%5K.IAPVLFDFIAK.E1
*rpal_wt_anaer_light_1_crude_5.2214.2214.133.60630.4961451757.071758.071130.056.0%6K.TGIAPDVFWAGLAAIVR.D1
*rpal_wt_anaer_light_1_cleared_1.4492.4492.396.93230.56171758.021758.071255.064.4%9K.TGIAPDVFWAGLAAIVR.D3
*rpal_wt_anaer_light_1_pellet_full.3958.3958.280.22290.6586121758.471758.071165.077.4%26K.TGIAPDVFWAGLAAIVR.D2
*rpal_wt_anaer_light_1_crude_3.1108.1108.129.39990.1241067.751068.221228.069.2%3K.IDAWHLANK.G1
*rpal_wt_anaer_light_1_pellet_4.1208.1208.126.35530.3622691252.841253.451200.056.2%2K.IDAWHLANKGK.K1
*rpal_wt_anaer_light_1_cleared_1.940.940.234.62450.4396081253.631253.45176.060.0%1K.IDAWHLANKGK.K2
*rpal_wt_anaer_light_1_pellet_4.2963.2963.240.66690.4681012754.162755.091194.040.9%1K.EIGYLLPEPPTVPVETTNIDEEIGK.L2
*rpal_wt_anaer_light_1_crude_full.3889.3889.351.41210.4183674201.554203.841163.048.3%1K.EIGYLLPEPPTVPVETTNIDEEIGKLCGPQLVVPLSNAR.Y3
*rpal_wt_anaer_light_1_pellet_full.2065.2065.233.24410.5288581467.591467.781249.040.0%2K.LCGPQLVVPLSNAR.Y2
*rpal_wt_anaer_light_1_crude_1a.950.950.129.52830.360312963.56964.07133.071.4%1R.YALNAANAR.W1
*rpal_wt_anaer_light_1_pellet_1.805.805.247.01350.533934964.17964.071248.072.2%3R.YALNAANAR.W2
*rpal_wt_anaer_light_1_pellet_full.2734.2734.264.50590.6957692433.752433.641150.057.9%9R.WGSLYDAFYGTDAIPQEATQAK.G2
*rpal_wt_anaer_light_1_pellet_3.2721.2721.347.6350.2782052979.622977.31126.043.4%1K.AFLDQAAPLATGSHSDVTGYSVIAGQLSAK.L3
*rpal_wt_anaer_light_1_cleared_3.1159.1159.240.0370.529821992.481992.331210.045.7%2K.LKSGNATGLKKPAQFAGFR.G2
*rpal_wt_anaer_light_1_pellet_full.4947.4947.380.14530.6158593932.333933.291188.056.2%7R.ANTIGKDDPAGVADLVIESAVSTILDMEDSVAAVDADDK.V3
*rpal_wt_anaer_light_1_pellet_5.1450.1450.132.99960.5796011741.851742.941132.056.0%1R.NTLGLMDGTLSESFEK.G1
*rpal_wt_anaer_light_1_crude_1a.2813.2813.258.1360.6767851742.231742.941124.069.0%5R.NTLGLMDGTLSESFEK.G2
*rpal_wt_anaer_light_1_cleared_3.2145.2145.240.10810.5625171984.881985.221161.042.4%3R.NTLGLMDGTLSESFEKGGK.T2
*rpal_wt_anaer_light_1_cleared_2.1166.1166.352.28790.4762332274.962272.48155.047.7%1R.ALNGDRTYTAPDGKEISLHGR.S3
*rpal_wt_anaer_light_1_pellet_2.1324.1324.238.97830.5139421646.961645.81196.055.6%1R.TYTAPDGKEISLHGR.S2
*rpal_wt_anaer_light_1_crude_1a.1671.1671.126.9530.237406732.4732.965166.088.9%1R.SLLLMR.N1
*rpal_wt_anaer_light_1_pellet_full.4124.4124.354.67140.3885834073.134073.531209.043.5%4R.NVGHHMWTDAVLDSDGQEIPEGFLDAAVSGLIAIHDLK.H3
*rpal_wt_anaer_light_1_cleared_full.508.508.126.96780.2889931091.511092.32169.060.0%1R.TGSVYIVKPK.M1
*rpal_wt_anaer_light_1_pellet_1.815.815.239.28010.3615141092.371092.321212.070.6%5R.TGSVYIVKPK.M2
*rpal_wt_anaer_light_1_cleared_full.1856.1856.268.70040.5132751390.651391.671179.083.3%10R.VETMLGLTANTLK.V2
*rpal_wt_anaer_light_1_pellet_4.2239.2239.139.49150.3739441393.791391.67182.075.0%6R.VETMLGLTANTLK.V1
*rpal_wt_anaer_light_1_pellet_1a.841.841.241.2530.510644951.62949.0721192.080.0%1K.VGIMDEER.R2
*rpal_wt_anaer_light_1_crude_1.581.581.240.71070.4072421105.271105.26176.068.8%2K.VGIMDEERR.T2
*rpal_wt_anaer_light_1_cleared_1a.2548.2548.258.98630.6641811295.641295.521205.080.0%9R.IVFINTGFLDR.T2
*rpal_wt_anaer_light_1_pellet_full.1439.1439.251.45870.6719581745.391745.971106.063.0%4R.TGDEIHTSMEAGPMIR.K2
*rpal_wt_anaer_light_1_pellet_1.1858.1858.360.19930.4548261746.631745.971237.059.6%3R.TGDEIHTSMEAGPMIR.K3
*rpal_wt_anaer_light_1_cleared_full.2204.2204.270.57790.6202542456.552456.671215.060.0%9K.AYEDWNVDTGLVDGLPGHAQIGK.G2
*rpal_wt_anaer_light_1_pellet_2.2751.2751.361.31520.482972456.832456.671248.051.4%7K.AYEDWNVDTGLVDGLPGHAQIGK.G3
*rpal_wt_anaer_light_1_pellet_2.1127.1127.131.12480.360838875.49876.0231206.069.2%2K.GMWAAPDK.M1
*rpal_wt_anaer_light_1_pellet_1.1220.1220.231.11450.370528875.63876.023197.066.7%1K.GMWAAPDK.M2
*rpal_wt_anaer_light_1_pellet_2.2612.2612.244.90490.5621171764.281765.131169.055.2%1K.GMWAAPDKMADMLAQK.I2
*rpal_wt_anaer_light_1_crude_3.738.738.136.07170.342651907.76908.131243.076.9%5K.MADMLAQK.I1
*rpal_wt_anaer_light_1_pellet_1.1053.1053.245.64640.507021908.33908.131213.075.0%1K.MADMLAQK.I2
*rpal_wt_anaer_light_1_pellet_full.2265.2265.374.1240.5924923589.183589.051225.055.4%12K.IGHPQAGATTAWVPSPTAATLHALHYHQVDVIAR.Q3
*rpal_wt_anaer_light_1_cleared_full.3825.3825.345.9160.4049024057.784058.521163.041.9%1K.LEDILTIPVSNSNWAPDDVRQEIDNNCQGILGYVVR.W3
*rpal_wt_anaer_light_1_pellet_4.2335.2335.246.49760.6058482570.92570.911180.045.2%4R.WIDQGVGCSKVPDIHDVGLMEDR.A2
*rpal_wt_anaer_light_1_cleared_full.2000.2000.354.0710.4244382571.542570.911255.047.1%3R.WIDQGVGCSKVPDIHDVGLMEDR.A3
*rpal_wt_anaer_light_1_pellet_2.1908.1908.247.49760.6928061496.41496.681101.065.2%1K.VPDIHDVGLMEDR.A2
*rpal_wt_anaer_light_1_pellet_1.2121.2121.364.4790.600941496.811496.68168.069.8%2K.VPDIHDVGLMEDR.A3
*rpal_wt_anaer_light_1_cleared_full.1283.1283.265.54210.5768091928.111928.2150.066.7%5R.ISSQHLANWLHHGVVTK.E2
*rpal_wt_anaer_light_1_cleared_full.1285.1285.362.90390.5272521928.971928.21189.061.7%1R.ISSQHLANWLHHGVVTK.E3
*rpal_wt_anaer_light_1_cleared_3.2151.2151.360.7150.4313862998.332997.431102.050.0%2R.ISSQHLANWLHHGVVTKEQVLDSLKR.M3
*rpal_wt_anaer_light_1_cleared_full.733.733.239.05150.4053951087.61088.25119.064.7%4K.EQVLDSLKR.M2
*rpal_wt_anaer_light_1_pellet_2.582.582.134.47510.428695855.62854.942142.091.7%1K.AAHLESAR.-1

URPA2513144771.3%188207175.6efp elongation factor P 2856053:2856619 reverse MW:20717
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_cleared_1.850.850.246.97610.4338551033.441033.281200.080.0%5-.MRVIASSIR.K2
*rpal_wt_anaer_light_1_crude_3.494.494.126.10940.3661821089.661088.2111.071.4%1R.KGNVLEQDGK.L1
*rpal_wt_anaer_light_1_cleared_3.1063.1063.273.92060.7319521839.981840.041117.071.4%1R.YKTTDQVEKVTIEER.N2
*rpal_wt_anaer_light_1_cleared_1a.1046.1046.345.27890.3882931841.311840.041198.047.7%1R.YKTTDQVEKVTIEER.N3
*rpal_wt_anaer_light_1_cleared_full.2670.2670.348.06010.3458053260.363261.514.047.1%1R.NYSFLYEDGEGFHFMEPESYDQVQVTK.D32
*rpal_wt_anaer_light_1_crude_1a.2574.2574.256.93490.5077971763.331764.051176.063.3%5K.DVVGSAAPYLQEGMVVK.L2
*rpal_wt_anaer_light_1_cleared_5.1279.1279.149.74760.6407811766.01764.051202.068.0%5K.DVVGSAAPYLQEGMVVK.L1
*rpal_wt_anaer_light_1_crude_full.1332.1332.144.00790.5663261401.731402.591177.080.0%8R.ATLEVVDTEPVTK.G1
*rpal_wt_anaer_light_1_crude_2.1546.1546.261.18480.48011402.741402.591246.069.6%5R.ATLEVVDTEPVTK.G2
*rpal_wt_anaer_light_1_cleared_2a.1575.1575.231.06270.4298923205.633206.58180.027.8%1R.ATLEVVDTEPVTKGQTASSSYKPAVLSNGVR.T2
*rpal_wt_anaer_light_1_crude_full.1730.1730.361.7570.3675843206.323206.581234.054.3%4R.ATLEVVDTEPVTKGQTASSSYKPAVLSNGVR.T3
*rpal_wt_anaer_light_1_crude_full.1044.1044.244.19570.502471822.761823.02144.048.3%3K.GQTASSSYKPAVLSNGVR.T2
*rpal_wt_anaer_light_1_cleared_4.555.555.126.53430.424271264.021264.43117.061.1%1R.TQVPPHIGTGTR.I1
*rpal_wt_anaer_light_1_cleared_2.1568.1568.266.19460.7390411480.811480.661226.079.2%6R.IVVLTEDGSYVER.A2

URPA1589317671.2%2052355910.1rpsD 30S ribosomal protein S4 1768213:1768830 reverse MW:23559
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_membrane_1.1125.1125.236.50280.552791187.571187.41165.061.1%2R.MGQNIWGRPK.S2
*rpal_wt_anaer_light_1_membrane_1a.1668.1668.357.56680.4656261220.021220.411135.068.6%1K.GKLSDFGVQLR.A3
*rpal_wt_anaer_light_1_membrane_1.1848.1848.245.89640.6019171220.051220.411230.061.9%2K.GKLSDFGVQLR.A2
*rpal_wt_anaer_light_1_membrane_full.1641.1641.128.7410.3350341034.571035.191168.064.3%3K.LSDFGVQLR.A1
*rpal_wt_anaer_light_1_membrane_1.2018.2018.256.53260.5593681035.691035.191241.082.4%4K.LSDFGVQLR.A2
*rpal_wt_anaer_light_1_membrane_2.915.915.242.53110.6109011770.191770.04136.055.6%1R.AKQKLKGYYANISER.Q2
*rpal_wt_anaer_light_1_membrane_2.1153.1153.234.27880.4952921571.781570.79149.050.0%1K.QKLKGYYANISER.Q2
*rpal_wt_anaer_light_1_membrane_4.927.927.134.78940.4540231313.841314.48198.070.6%2K.LKGYYANISER.Q1
*rpal_wt_anaer_light_1_membrane_1a.1046.1046.247.70120.6291181314.121314.481168.075.0%3K.LKGYYANISER.Q2
*rpal_wt_anaer_light_1_membrane_1a.1048.1048.354.69760.45171315.721314.481118.068.6%1K.LKGYYANISER.Q3
*rpal_wt_anaer_light_1_membrane_1.1143.1143.238.25650.5998541074.931073.15150.064.7%1K.GYYANISER.Q2
*rpal_wt_anaer_light_1_membrane_full.1198.1198.129.96980.4833031335.761335.51132.068.8%1R.QFHAIYVEATR.L1
*rpal_wt_anaer_light_1_membrane_5.1337.1337.140.71840.4516681613.931614.841140.060.9%3R.LKGDSGENLIGLLER.R1
*rpal_wt_anaer_light_1_membrane_1a.2511.2511.278.27820.724381614.51614.841206.082.1%3R.LKGDSGENLIGLLER.R2
*rpal_wt_anaer_light_1_membrane_1.2737.2737.353.83860.2933251614.611614.841215.052.1%3R.LKGDSGENLIGLLER.R3
*rpal_wt_anaer_light_1_membrane_3.667.667.125.90970.339707991.72992.1671169.061.5%3R.RLDAVVYR.A1
*rpal_wt_anaer_light_1_membrane_1.866.866.249.61210.370841994.56992.1671233.081.2%6R.RLDAVVYR.A2
*rpal_wt_anaer_light_1_membrane_1.1061.1061.235.30720.436081836.13835.9791215.069.2%1R.LDAVVYR.A2
*rpal_wt_anaer_light_1_membrane_1.1180.1180.349.22320.4075441233.081232.471169.058.8%1K.RVNIPSYKVR.V3
*rpal_wt_anaer_light_1_membrane_1a.896.896.254.14380.505354859.32859.0111227.086.7%4R.VGDVIEVK.E2
*rpal_wt_anaer_light_1_membrane_full.824.824.129.21590.250908861.72859.0111240.069.2%5R.VGDVIEVK.E1
*rpal_wt_anaer_light_1_membrane_1.864.864.236.47160.4681451274.571274.461206.052.4%1R.VGDVIEVKEASK.Q2
*rpal_wt_anaer_light_1_membrane_2a.646.646.136.55350.6063711274.861274.461216.082.4%1R.VGDVIEVKEASK.Q1
*rpal_wt_anaer_light_1_membrane_2a.2582.2582.256.27350.6263931990.841991.251102.054.8%2K.EASKQLAFVLEASQLAER.D2
*rpal_wt_anaer_light_1_membrane_2.3195.3195.259.32290.4912931575.681575.81162.065.4%1K.QLAFVLEASQLAER.D2
*rpal_wt_anaer_light_1_membrane_4.1143.1143.142.24910.6278411443.611444.54182.076.5%1R.DVPDYIEVDHNK.M1
*rpal_wt_anaer_light_1_membrane_1a.1296.1296.240.10660.5323311444.211444.5410.059.1%2R.DVPDYIEVDHNK.M2
*rpal_wt_anaer_light_1_membrane_5.878.878.128.56740.4957781874.771876.1128.058.3%1R.DVPDYIEVDHNKMTAK.F1
*rpal_wt_anaer_light_1_membrane_full.1322.1322.249.37640.6131011875.551876.1110.064.3%1R.DVPDYIEVDHNKMTAK.F2
*rpal_wt_anaer_light_1_membrane_4.3967.3967.248.94660.6065552759.192760.231192.041.9%4R.IPALSDVPFAVQMEPHLIVEFYSR.-2
*rpal_wt_anaer_light_1_membrane_full.3661.3661.379.70880.5727072759.552760.231198.065.2%11R.IPALSDVPFAVQMEPHLIVEFYSR.-3

URPA32978254671.1%450483067.7RPA3297 possible branched-chain amino acid transport system substrate-binding protein 3717617:3718969 reverse MW:48306
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_light_1_cleared_full.2341.2341.389.10910.6790482687.932688.971206.065.3%9K.GKEVVFGFNVPQSGAYADEGMDELK.A3
*rpal_wt_anaer_light_1_pellet_4.2659.2659.271.6850.7293052688.42688.971166.060.0%9