DTASelect v1.9
/auto/gtl/ms/gtl_rpal/gtl_rpal_proteome/global_analysis/dbd_tryptic_1/wt_anaer_auto_1
/auto/GAT/db/gtl/Rpal/rpal_3_plus_contams.fasta
DBDigger 1.05 in SQT format.

Jump to the summary table.

sequest.params modifications:
trueUse criteria
25.0Minimum +1 XCorr
30.0Minimum +2 XCorr
45.0Minimum +3 XCorr
0.08Minimum DeltCN
1Minimum charge state
3Maximum charge state
0.0Minimum ion proportion
1000Maximum Sp rank
-1.0Minimum Sp score
IncludeModified peptide inclusion
AnyTryptic status requirement
trueMultiple, ambiguous IDs allowed
IgnorePeptide validation handling
XCorrPurge duplicate peptides by protein
falseInclude only loci with unique peptide
falseRemove subset proteins
IgnoreLocus validation handling
0Minimum modified peptides per locus
10Minimum redundancy for low coverage loci
2Minimum peptides per locus

Locus Key:

Validation StatusLocusSequence CountSpectrum CountSequence CoverageLengthMolWtpIDescriptive Name

Similarity Key:

Locus# of identical peptides# of differing peptides

URPA421742150100.0%6679925.6RPA4217 conserved unknown protein 4761873:4762073 forward MW:7991
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_cleared_full.1338.1338.249.36710.5584271436.361435.611113.070.0%7-.MDWNRVEGNWK.Q2
*rpal_wt_anaer_auto_1_crude_3.1539.1539.244.86350.481791840.761839.09113.060.0%3-.MDWNRVEGNWKQFK.G2
*rpal_wt_anaer_auto_1_cleared_2.1627.1627.365.42910.4920032237.872237.55178.063.0%1-.MDWNRVEGNWKQFKGNVK.E3
*rpal_wt_anaer_auto_1_cleared_2c.1620.1620.237.15750.4905822237.962237.55132.046.9%2-.MDWNRVEGNWKQFKGNVK.E2
*rpal_wt_anaer_auto_1_cleared_3.758.758.133.67160.4932471135.631136.31212.076.9%3R.VEGNWKQFK.G1
*rpal_wt_anaer_auto_1_cleared_4.798.798.135.74660.4760231534.351534.76141.077.8%1R.VEGNWKQFKGNVK.E1
*rpal_wt_anaer_auto_1_cleared_4.732.732.145.4850.63341791.541792.05121.072.7%1R.VEGNWKQFKGNVKEK.W1
*rpal_wt_anaer_auto_1_cleared_2.724.724.242.56220.5502721791.571792.0519.055.6%1R.VEGNWKQFKGNVKEK.W2
*rpal_wt_anaer_auto_1_cleared_4.1733.1733.136.21550.5533821990.341990.18166.053.8%1K.EKWGKLTDDDLDVIEGR.R1
*rpal_wt_anaer_auto_1_cleared_1.1915.1915.357.31210.4784681990.421990.18119.059.3%1K.EKWGKLTDDDLDVIEGR.R3
*rpal_wt_anaer_auto_1_cleared_3.1718.1718.272.31410.6672591991.621990.181117.073.3%2K.EKWGKLTDDDLDVIEGR.R2
*rpal_wt_anaer_auto_1_crude_full.1700.1700.151.62260.5599911731.51732.891221.077.3%8K.WGKLTDDDLDVIEGR.R1
*rpal_wt_anaer_auto_1_cleared_full.1763.1763.287.33140.7215531732.721732.891174.085.2%6K.WGKLTDDDLDVIEGR.R2
*rpal_wt_anaer_auto_1_crude_full.1698.1698.369.30030.393451733.391732.891247.066.0%6K.WGKLTDDDLDVIEGR.R3
*rpal_wt_anaer_auto_1_cleared_3.1637.1637.255.79230.6265061889.891889.081238.058.6%6K.WGKLTDDDLDVIEGRR.D2
*rpal_wt_anaer_auto_1_crude_1c.1560.1560.360.71480.4770981890.671889.081214.062.0%2K.WGKLTDDDLDVIEGRR.D3
*rpal_wt_anaer_auto_1_cleared_2c.1738.1738.237.70870.1420522559.992559.8196.041.0%1K.WGKLTDDDLDVIEGRRDQLEGK.L2
*rpal_wt_anaer_auto_1_cleared_2.1765.1765.352.16170.2007852561.42559.81200.053.0%1K.WGKLTDDDLDVIEGRRDQLEGK.L3
*rpal_wt_anaer_auto_1_crude_full.1383.1383.145.71020.6355011360.431361.451248.083.3%8K.LTDDDLDVIEGR.R1
*rpal_wt_anaer_auto_1_cleared_1.1660.1660.272.05220.652071361.891361.451244.081.8%9K.LTDDDLDVIEGR.R2
*rpal_wt_anaer_auto_1_crude_1c.1204.1204.234.66640.4473031519.651517.64136.050.0%3K.LTDDDLDVIEGRR.D2
*rpal_wt_anaer_auto_1_cleared_2.350.350.125.20230.262857846.11845.932124.072.7%1R.RDQLEGK.L1
*rpal_wt_anaer_auto_1_cleared_1.612.612.259.62030.4138391372.171372.53158.085.0%3R.RDQLEGKLQER.Y2
*rpal_wt_anaer_auto_1_cleared_1.610.610.358.34230.4113021373.081372.531118.070.3%2R.RDQLEGKLQER.Y3
*rpal_wt_anaer_auto_1_crude_4.670.670.126.49250.3120471373.141372.531112.055.6%1R.RDQLEGKLQER.Y1
*rpal_wt_anaer_auto_1_cleared_1c.413.413.135.04890.240752689.54689.7441187.090.0%4R.DQLEGK.L1
*rpal_wt_anaer_auto_1_cleared_3.651.651.127.89230.3346551215.721216.341136.062.5%1R.DQLEGKLQER.Y1
*rpal_wt_anaer_auto_1_cleared_1c.710.710.253.41370.495711216.291216.341186.078.9%2R.DQLEGKLQER.Y2
*rpal_wt_anaer_auto_1_cleared_1.410.410.126.62460.352914601.43601.681212.087.5%2R.YGYAK.D1
*rpal_wt_anaer_auto_1_crude_full.594.594.242.56850.4686541101.241100.221226.072.2%2R.YGYAKDQVR.K2
*rpal_wt_anaer_auto_1_crude_2c.579.579.146.71450.3827481102.091100.22185.092.9%7R.YGYAKDQVR.K1
*rpal_wt_anaer_auto_1_cleared_3.421.421.140.82440.5123551229.051228.39119.081.2%3R.YGYAKDQVRK.D1
*rpal_wt_anaer_auto_1_cleared_full.2069.2069.252.71340.630582448.592449.73152.055.6%5R.YGYAKDQVRKDVDDWFTTLK.-2
*rpal_wt_anaer_auto_1_cleared_full.2071.2071.379.44390.6549012450.772449.731236.061.0%4R.YGYAKDQVRKDVDDWFTTLK.-3
*rpal_wt_anaer_auto_1_cleared_full.1956.1956.260.39340.6601071866.261867.071226.066.7%4K.DQVRKDVDDWFTTLK.-2
*rpal_wt_anaer_auto_1_cleared_1c.2100.2100.373.31030.575151867.011867.071188.069.6%3K.DQVRKDVDDWFTTLK.-3
*rpal_wt_anaer_auto_1_cleared_3c.2071.2071.134.89050.5408721867.051867.071104.063.6%4K.DQVRKDVDDWFTTLK.-1
*rpal_wt_anaer_auto_1_cleared_full.1693.1693.147.45850.6166761367.621368.531183.081.2%7R.KDVDDWFTTLK.-1
*rpal_wt_anaer_auto_1_cleared_1c.1818.1818.272.16680.6655891368.521368.531220.090.0%9R.KDVDDWFTTLK.-2
*rpal_wt_anaer_auto_1_cleared_full.1694.1694.353.69510.4677751369.051368.531227.061.1%3R.KDVDDWFTTLK.-3
*rpal_wt_anaer_auto_1_cleared_full.2150.2150.146.39960.6787261239.521240.351176.086.7%5K.DVDDWFTTLK.-1
*rpal_wt_anaer_auto_1_cleared_full.2155.2155.258.53830.574661240.161240.351190.083.3%5K.DVDDWFTTLK.-2

URPA3875115699.0%98100924.4RPA3875 conserved unknown protein 4374071:4374367 forward MW:10092
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_cleared_2.462.462.127.9260.326799789.51789.8661172.072.7%1M.AVDGNWK.L1
*rpal_wt_anaer_auto_1_cleared_3.1606.1606.253.44490.5684321893.571894.181203.058.1%4M.AVDGNWKLTMSTPMGER.Q2
*rpal_wt_anaer_auto_1_cleared_3c.1615.1615.130.02340.5496251893.821894.181129.056.0%1M.AVDGNWKLTMSTPMGER.Q1
*rpal_wt_anaer_auto_1_cleared_1c.1659.1659.353.15410.4359571894.851894.181134.058.8%1M.AVDGNWKLTMSTPMGER.Q3
*rpal_wt_anaer_auto_1_cleared_full.933.933.238.51860.3679651123.431123.341232.063.2%3K.LTMSTPMGER.Q2
*rpal_wt_anaer_auto_1_crude_1c.635.635.126.71170.357873789.75788.92168.072.7%1R.QADLTLK.A1
*rpal_wt_anaer_auto_1_cleared_full.2191.2191.270.80450.709423156.783158.231251.048.1%8K.ADGSTLTGSQSADGDAGEIFDGTVNGDDVAWK.L2
*rpal_wt_anaer_auto_1_cleared_full.2189.2189.137.65270.5149481735.771737.071194.066.7%9K.LSITNPMPLTLSYTGK.V1
*rpal_wt_anaer_auto_1_crude_1c.2249.2249.259.35770.640821737.611737.071166.071.4%9K.LSITNPMPLTLSYTGK.V2
*rpal_wt_anaer_auto_1_cleared_full.2458.2458.264.05450.6391982387.992388.681188.055.8%5K.VSGDSISGEMGIGPMGSFPFTGTR.A2
*rpal_wt_anaer_auto_1_cleared_2c.2698.2698.273.46550.7094082459.412459.761188.059.1%14K.VSGDSISGEMGIGPMGSFPFTGTRA.-2

URPA4418207098.6%7171169.1RPA4418 conserved unknown protein 4978268:4978483 forward MW:7116
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_cleared_1c.1145.1145.265.82160.6388181748.561749.01226.072.4%5M.GSTMDKIKGQANELAGK.A2
*rpal_wt_anaer_auto_1_crude_4.1071.1071.150.13250.5829311748.951749.0126.069.2%5M.GSTMDKIKGQANELAGK.A1
*rpal_wt_anaer_auto_1_cleared_1.1256.1256.354.27390.5185271750.921749.01203.054.0%1M.GSTMDKIKGQANELAGK.A3
*rpal_wt_anaer_auto_1_crude_2c.549.549.132.88810.2809981128.881129.31114.062.5%3K.IKGQANELAGK.A1
*rpal_wt_anaer_auto_1_cleared_2c.1108.1108.350.12450.2047583258.963256.61216.044.8%2K.GQANELAGKAKQGIGEATGSDKLKGEGAIQEAK.G3
*rpal_wt_anaer_auto_1_cleared_3.788.788.270.54360.6294352388.62387.65179.058.1%3K.AKQGIGEATGSDKLKGEGAIQEAK.G2
*rpal_wt_anaer_auto_1_cleared_full.883.883.243.19240.5993652188.052188.4112.046.2%5K.QGIGEATGSDKLKGEGAIQEAK.G2
*rpal_wt_anaer_auto_1_cleared_2.898.898.356.29530.436152189.672188.41119.052.2%1K.QGIGEATGSDKLKGEGAIQEAK.G3
*rpal_wt_anaer_auto_1_crude_3.418.418.142.5490.6241911080.591081.18190.082.4%5K.GHGQQALGNAK.D1
*rpal_wt_anaer_auto_1_cleared_1.401.401.244.5760.6784641083.781081.18134.070.0%1K.GHGQQALGNAK.D2
*rpal_wt_anaer_auto_1_crude_1c.1234.1234.365.79550.5687792659.582659.92117.058.7%1K.GHGQQALGNAKDAVKDTADKVAGAAHK.N3
*rpal_wt_anaer_auto_1_cleared_2c.1331.1331.258.53280.7076322660.262659.921100.050.0%2K.GHGQQALGNAKDAVKDTADKVAGAAHK.N2
*rpal_wt_anaer_auto_1_cleared_4.1660.1660.245.54820.5118362889.152887.19110.043.1%4K.GHGQQALGNAKDAVKDTADKVAGAAHKNL.-2
*rpal_wt_anaer_auto_1_crude_3.1545.1545.380.27060.5892192889.282887.19134.058.5%4K.GHGQQALGNAKDAVKDTADKVAGAAHKNL.-3
*rpal_wt_anaer_auto_1_cleared_3c.825.825.156.30760.6842771596.881597.77190.079.2%7K.DAVKDTADKVAGAAHK.N1
*rpal_wt_anaer_auto_1_crude_1c.789.789.365.66360.5555711598.211597.771189.057.7%5K.DAVKDTADKVAGAAHK.N3
*rpal_wt_anaer_auto_1_pellet_2.814.814.266.36350.6888141598.751597.771137.075.9%5K.DAVKDTADKVAGAAHK.N2
*rpal_wt_anaer_auto_1_cleared_4.1272.1272.142.25580.5336971824.131825.03121.064.3%4K.DAVKDTADKVAGAAHKNL.-1
*rpal_wt_anaer_auto_1_crude_full.1160.1160.368.00850.5277021825.631825.03194.061.0%2K.DAVKDTADKVAGAAHKNL.-3
*rpal_wt_anaer_auto_1_cleared_2c.1286.1286.276.16280.7387541826.061825.031104.071.9%5K.DAVKDTADKVAGAAHKNL.-2

URPA01926726598.4%322339965.8mdh malate dehydrogenase 214807:215775 reverse MW:33996
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_pellet_2c.2860.2860.242.53780.5667482390.022389.85117.046.5%1M.ARDKIALIGSGQIGGTLAHLVGLK.E2
*rpal_wt_anaer_auto_1_pellet_2.2700.2700.350.80630.4026962391.052389.851129.046.1%1M.ARDKIALIGSGQIGGTLAHLVGLK.E3
*rpal_wt_anaer_auto_1_pellet_4.4196.4196.353.950.4412514258.994257.971153.050.0%3M.ARDKIALIGSGQIGGTLAHLVGLKELGDVVLFDIAEGVPQGK.A3
*rpal_wt_anaer_auto_1_pellet_2c.3141.3141.235.3350.4345272163.632162.581202.040.0%1R.DKIALIGSGQIGGTLAHLVGLK.E2
*rpal_wt_anaer_auto_1_pellet_4.3303.3303.135.74820.4202031918.31919.321106.060.0%2K.IALIGSGQIGGTLAHLVGLK.E1
*rpal_wt_anaer_auto_1_pellet_1c.3177.3177.352.13040.4030181919.991919.321225.048.4%3K.IALIGSGQIGGTLAHLVGLK.E3
*rpal_wt_anaer_auto_1_pellet_2c.3340.3340.272.16730.7181631920.221919.321156.069.4%5K.IALIGSGQIGGTLAHLVGLK.E2
*rpal_wt_anaer_auto_1_pellet_full.4027.4027.382.4010.6027723785.973787.441154.057.6%6K.IALIGSGQIGGTLAHLVGLKELGDVVLFDIAEGVPQGK.A3
*rpal_wt_anaer_auto_1_pellet_4.2971.2971.135.80060.5116761886.881887.14175.061.5%2K.ELGDVVLFDIAEGVPQGK.A1
*rpal_wt_anaer_auto_1_pellet_1.2865.2865.354.2590.4378761887.331887.141241.050.0%1K.ELGDVVLFDIAEGVPQGK.A3
*rpal_wt_anaer_auto_1_pellet_2c.3020.3020.269.23470.6567261889.61887.141109.065.6%2K.ELGDVVLFDIAEGVPQGK.A2
*rpal_wt_anaer_auto_1_cleared_3c.1641.1641.152.78030.5676321650.981651.771201.072.0%14K.ALDIAESSPVDGFDSK.L1
*rpal_wt_anaer_auto_1_cleared_2.1669.1669.282.55250.6077191653.141651.771253.079.3%10K.ALDIAESSPVDGFDSK.L2
*rpal_wt_anaer_auto_1_crude_3c.2326.2326.259.51980.6704173085.293085.311162.042.3%6K.ALDIAESSPVDGFDSKLTGANSYEAIEGAR.V2
*rpal_wt_anaer_auto_1_pellet_3.2328.2328.398.08940.6304953087.63085.31149.062.4%3K.ALDIAESSPVDGFDSKLTGANSYEAIEGAR.V3
*rpal_wt_anaer_auto_1_cleared_3c.1078.1078.131.04110.596881453.011452.56136.057.1%3K.LTGANSYEAIEGAR.V1
*rpal_wt_anaer_auto_1_pellet_full.985.985.272.57030.6356281453.361452.561254.080.8%9K.LTGANSYEAIEGAR.V2
*rpal_wt_anaer_auto_1_pellet_full.978.978.254.13960.4813091012.971011.251254.073.7%5R.VVIVTAGVPR.K2
*rpal_wt_anaer_auto_1_pellet_4.1939.1939.235.21520.3884062680.572680.2310.033.3%2R.VVIVTAGVPRKPGMSRDDLLSINLK.V2
*rpal_wt_anaer_auto_1_crude_1c.1832.1832.351.81080.3117842682.782680.23178.047.9%2R.VVIVTAGVPRKPGMSRDDLLSINLK.V3
*rpal_wt_anaer_auto_1_crude_2.1323.1323.244.73510.4801961687.541688.0116.063.0%2R.KPGMSRDDLLSINLK.V2
*rpal_wt_anaer_auto_1_pellet_4.1466.1466.129.37630.4742091688.121688.01208.052.2%1R.KPGMSRDDLLSINLK.V1
*rpal_wt_anaer_auto_1_pellet_2c.1970.1970.141.09010.4818341030.851031.191211.092.9%1R.DDLLSINLK.V1
*rpal_wt_anaer_auto_1_pellet_2c.600.600.125.19780.3045661160.621160.42117.061.1%1K.VMEQVGAGIKK.Y1
*rpal_wt_anaer_auto_1_pellet_1c.737.737.238.19890.3252661161.941160.42142.070.0%2K.VMEQVGAGIKK.Y2
*rpal_wt_anaer_auto_1_pellet_2c.4477.4477.262.5820.7035472708.352709.25155.053.5%2K.KYAPDAFVICITNPLDAMVWALQK.A2
*rpal_wt_anaer_auto_1_pellet_full.4229.4229.375.36510.6239922578.762581.071255.057.4%3K.YAPDAFVICITNPLDAMVWALQK.A3
*rpal_wt_anaer_auto_1_pellet_2c.4805.4805.278.55360.718982582.062581.071232.068.3%9K.YAPDAFVICITNPLDAMVWALQK.A2
*rpal_wt_anaer_auto_1_pellet_1.1555.1555.360.1620.5001231929.331928.311242.051.6%2K.ASGLPAKKVVGMAGVLDSAR.F3
*rpal_wt_anaer_auto_1_pellet_3.1521.1521.267.53180.7347861929.51928.311240.062.9%5K.ASGLPAKKVVGMAGVLDSAR.F2
*rpal_wt_anaer_auto_1_pellet_2c.1246.1246.146.02550.6207281303.21303.571104.085.0%3K.KVVGMAGVLDSAR.F1
*rpal_wt_anaer_auto_1_crude_1c.1095.1095.257.15470.6449411303.951303.571235.070.8%2K.KVVGMAGVLDSAR.F2
*rpal_wt_anaer_auto_1_pellet_full.1287.1287.267.17680.5720711175.371175.391254.078.3%9K.VVGMAGVLDSAR.F2
*rpal_wt_anaer_auto_1_pellet_3.1410.1410.137.8380.5315531175.431175.39173.068.4%2K.VVGMAGVLDSAR.F1
*rpal_wt_anaer_auto_1_cleared_full.5080.5080.349.79980.4084843372.83371.831237.043.4%8R.YFLADEFNVSVEDVTAFVLGGHGDTMVPLVK.Y3
*rpal_wt_anaer_auto_1_pellet_1c.2527.2527.250.8960.6763541472.851473.751156.065.4%7K.YSTVAGIPLPDLVK.M2
*rpal_wt_anaer_auto_1_crude_4.2492.2492.144.26040.6982581473.461473.751188.072.7%11K.YSTVAGIPLPDLVK.M1
*rpal_wt_anaer_auto_1_pellet_3.540.540.127.59360.360228936.89937.067164.075.0%1K.MGWTSQAR.L1
*rpal_wt_anaer_auto_1_cleared_1.747.747.236.85740.57806938.4937.0671263.066.7%1K.MGWTSQAR.L2
*rpal_wt_anaer_auto_1_pellet_full.542.542.126.9060.265034859.45859.9551147.072.7%2R.LDEIVDR.T1
*rpal_wt_anaer_auto_1_pellet_1.629.629.242.23380.361488860.88859.9551252.084.6%1R.LDEIVDR.T2
*rpal_wt_anaer_auto_1_cleared_2c.1794.1794.132.88880.4848641128.361128.31117.075.0%7R.NGGAEIVNLLK.T1
*rpal_wt_anaer_auto_1_pellet_full.1588.1588.263.19990.6078681129.571128.311238.085.0%7R.NGGAEIVNLLK.T2
*rpal_wt_anaer_auto_1_pellet_3.3570.3570.286.96050.776112137.472137.421146.073.0%9K.TGSAFYAPASSAIAMAESYLK.D2
*rpal_wt_anaer_auto_1_pellet_1c.3463.3463.352.73370.4705472138.132137.421233.046.4%1K.TGSAFYAPASSAIAMAESYLK.D3
*rpal_wt_anaer_auto_1_crude_full.3013.3013.264.79970.6758432379.72380.681148.063.2%8K.TGSAFYAPASSAIAMAESYLKDK.K2
*rpal_wt_anaer_auto_1_crude_full.3009.3009.350.93220.4144532382.482380.681198.033.3%4K.TGSAFYAPASSAIAMAESYLKDK.K3
*rpal_wt_anaer_auto_1_pellet_2c.3166.3166.241.56320.5104732508.792508.851128.045.2%1K.TGSAFYAPASSAIAMAESYLKDKK.R2
*rpal_wt_anaer_auto_1_pellet_full.2487.2487.248.40070.6456312664.952665.04180.047.7%4K.TGSAFYAPASSAIAMAESYLKDKKR.V2
*rpal_wt_anaer_auto_1_pellet_2.2779.2779.346.26710.1773832667.562665.041156.040.8%1K.TGSAFYAPASSAIAMAESYLKDKKR.V3
*rpal_wt_anaer_auto_1_crude_4.1095.1095.138.08160.5125781553.921553.81211.071.4%3R.VVPVAAHLNGEYGVK.D1
*rpal_wt_anaer_auto_1_cleared_2.1167.1167.249.69420.6473291554.681553.8162.064.0%8R.VVPVAAHLNGEYGVK.D2
*rpal_wt_anaer_auto_1_pellet_3c.2371.2371.245.93810.5715822928.332927.441169.042.9%2R.VVPVAAHLNGEYGVKDMYVGVPVVIGDK.G2
*rpal_wt_anaer_auto_1_pellet_3c.2259.2259.248.60310.6351433370.193368.931166.034.5%1R.VVPVAAHLNGEYGVKDMYVGVPVVIGDKGVER.I2
*rpal_wt_anaer_auto_1_pellet_3.2201.2201.384.00740.6038963371.433368.93177.064.6%5R.VVPVAAHLNGEYGVKDMYVGVPVVIGDKGVER.I3
*rpal_wt_anaer_auto_1_pellet_4.1936.1936.150.3580.6027211392.671392.661209.081.0%7K.DMYVGVPVVIGDK.G1
*rpal_wt_anaer_auto_1_crude_4.1766.1766.125.10950.3532131833.171834.151134.050.0%1K.DMYVGVPVVIGDKGVER.I1
*rpal_wt_anaer_auto_1_cleared_2c.1804.1804.265.65970.6277441834.341834.151155.071.0%7K.DMYVGVPVVIGDKGVER.I2
*rpal_wt_anaer_auto_1_pellet_3.1282.1282.273.90940.674831834.371834.081241.075.9%6R.IVEIELAGKDKEAFDR.S2
*rpal_wt_anaer_auto_1_crude_3c.1248.1248.127.7810.4617081834.591834.081146.054.2%1R.IVEIELAGKDKEAFDR.S1
*rpal_wt_anaer_auto_1_crude_3.1724.1724.139.65790.6639741275.651275.511136.073.7%1R.SVAAVQGLVEACK.K1
*rpal_wt_anaer_auto_1_pellet_1c.1872.1872.261.89090.7245591276.841275.511249.079.2%2R.SVAAVQGLVEACK.K2
*rpal_wt_anaer_auto_1_pellet_3c.1565.1565.140.75670.6744441404.01403.69165.076.2%8R.SVAAVQGLVEACKK.I1
*rpal_wt_anaer_auto_1_crude_2.1372.1372.254.38630.6474391405.711403.691208.068.0%8R.SVAAVQGLVEACKK.I2
*rpal_wt_anaer_auto_1_pellet_1.955.955.230.21770.139299984.23983.21208.052.9%1K.KIAPDLLGR.-2
*rpal_wt_anaer_auto_1_pellet_full.949.949.125.13130.202874855.5855.0261138.066.7%1K.IAPDLLGR.-1
*rpal_wt_anaer_auto_1_pellet_full.944.944.238.21580.281815856.18855.0261108.066.7%5K.IAPDLLGR.-2

URPA269272197.7%130143684.2rnpO RNA polymerase omega subunit 3063234:3063626 forward MW:14368
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_pellet_2c.2880.2880.363.82570.4450292873.112870.311242.055.7%2M.ARVTVEDCIDKVDNRFDLVLLAAHR.A3
*rpal_wt_anaer_auto_1_crude_3.1495.1495.232.93480.3998022515.82515.851160.031.7%2R.MISSGSPLTIDRDNDKNPVVSLR.E2
*rpal_wt_anaer_auto_1_crude_full.1439.1439.374.31460.4484212516.472515.851149.065.2%4R.MISSGSPLTIDRDNDKNPVVSLR.E3
*rpal_wt_anaer_auto_1_pellet_2c.2565.2565.255.95170.6762482523.262523.81104.059.0%2R.EIADQTISPEDLKEELVHSLQK.F2
*rpal_wt_anaer_auto_1_pellet_4.2633.2633.232.81030.4644153463.433462.7218.025.4%2K.FVEVDEPEPDTVPLIGSAGASVDADDTEVAMER.M2
*rpal_wt_anaer_auto_1_cleared_2c.2946.2946.244.27330.5414172714.832713.931204.041.9%4R.MTEEELLKGLEGLAPPEEQPEEDE.-2
*rpal_wt_anaer_auto_1_crude_4.1503.1503.136.57610.5018691739.651739.791156.066.7%5K.GLEGLAPPEEQPEEDE.-1

URPA09445623596.1%335359567.6cbbG glyceraldehyde-3-phosphate dehydrogenase(GAPDH) 1043108:1044115 reverse MW:35956
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_pellet_1.897.897.233.88970.441594835.2833.9661240.060.0%2R.VAINGFGR.I2
rpal_wt_anaer_auto_1_crude_1c.452.452.129.18780.0944538501.55501.607194.0100.0%1R.NVLR.A11
*rpal_wt_anaer_auto_1_pellet_3.2350.2350.3113.070.6308653195.263194.621230.071.2%8R.AIYESGRKDIEVVAINDLGPVETNAHLLR.F3
*rpal_wt_anaer_auto_1_pellet_4.2343.2343.245.63750.4952293196.583194.621194.036.5%7R.AIYESGRKDIEVVAINDLGPVETNAHLLR.F2
*rpal_wt_anaer_auto_1_pellet_2c.2336.2336.268.8220.5827482418.932417.771230.060.0%3R.KDIEVVAINDLGPVETNAHLLR.F2
*rpal_wt_anaer_auto_1_pellet_full.1984.1984.3115.1340.6598732419.682417.771255.073.2%4R.KDIEVVAINDLGPVETNAHLLR.F3
*rpal_wt_anaer_auto_1_pellet_2c.2660.2660.276.50530.7026862289.162289.591227.065.8%11K.DIEVVAINDLGPVETNAHLLR.F2
*rpal_wt_anaer_auto_1_pellet_2.2530.2530.363.69130.4790282291.02289.591215.052.2%3K.DIEVVAINDLGPVETNAHLLR.F3
*rpal_wt_anaer_auto_1_crude_4.1326.1326.127.73660.3808151564.971565.771132.052.6%3R.FDSVHGRFPFEVK.V1
*rpal_wt_anaer_auto_1_pellet_full.1269.1269.252.0490.5758041566.841565.77120.070.8%6R.FDSVHGRFPFEVK.V2
*rpal_wt_anaer_auto_1_pellet_1c.1478.1478.349.34890.456731566.891565.771205.050.0%3R.FDSVHGRFPFEVK.V3
*rpal_wt_anaer_auto_1_pellet_2c.1951.1951.239.20830.554862566.742565.81181.037.5%1R.FDSVHGRFPFEVKVDGDTIDAGR.G2
*rpal_wt_anaer_auto_1_pellet_2c.1763.1763.237.16080.5293942751.262751.031164.036.4%2R.FDSVHGRFPFEVKVDGDTIDAGRGK.I2
*rpal_wt_anaer_auto_1_crude_3.1541.1541.378.46980.5501942751.962751.03179.057.7%2R.FDSVHGRFPFEVKVDGDTIDAGRGK.I3
*rpal_wt_anaer_auto_1_pellet_1c.1363.1363.133.54950.223762766.99766.9151228.090.0%1R.FPFEVK.V1
*rpal_wt_anaer_auto_1_cleared_2c.580.580.125.47560.3260371019.071019.061209.060.0%1K.VDGDTIDAGR.G1
*rpal_wt_anaer_auto_1_crude_3.473.473.136.12680.4397981203.831204.281210.070.6%4K.VDGDTIDAGRGK.I1
*rpal_wt_anaer_auto_1_pellet_4.3363.3363.234.07190.322553422.323421.041192.028.1%1K.IKVTAIKDPSALPYKEVGVDIALECTGIFTAR.D2
*rpal_wt_anaer_auto_1_pellet_3.695.695.144.69770.5631411159.721160.361228.077.8%8R.DKAATLLTAGAK.R1
*rpal_wt_anaer_auto_1_cleared_1c.799.799.251.61340.6680981160.071160.361209.068.2%4R.DKAATLLTAGAK.R2
*rpal_wt_anaer_auto_1_pellet_full.574.574.358.10370.4365451316.941316.541236.063.4%2R.DKAATLLTAGAKR.V3
*rpal_wt_anaer_auto_1_crude_4.731.731.133.87440.3878741317.061316.541163.061.9%5R.DKAATLLTAGAKR.V1
*rpal_wt_anaer_auto_1_pellet_1.652.652.262.98610.6504961317.81316.541248.079.2%4R.DKAATLLTAGAKR.V2
*rpal_wt_anaer_auto_1_pellet_full.583.583.128.94460.357825916.57917.0941130.066.7%3K.AATLLTAGAK.R1
*rpal_wt_anaer_auto_1_pellet_1.563.563.239.22440.559051073.441073.281216.065.0%1K.AATLLTAGAKR.V2
*rpal_wt_anaer_auto_1_pellet_2c.1762.1762.253.14430.6189862700.412701.011228.043.5%2K.RVLVSAPSDGADATIVYGVNHETLSK.D2
*rpal_wt_anaer_auto_1_pellet_3.1671.1671.381.65190.5503892703.522701.011216.060.8%1K.RVLVSAPSDGADATIVYGVNHETLSK.D3
*rpal_wt_anaer_auto_1_crude_2c.1784.1784.248.13470.5370992544.642544.821241.050.0%2R.VLVSAPSDGADATIVYGVNHETLSK.D2
*rpal_wt_anaer_auto_1_pellet_4.2216.2216.347.98010.3096854575.014574.171192.047.8%2R.VLVSAPSDGADATIVYGVNHETLSKDHMVVSNGSCTTNCLAPVAK.V3
*rpal_wt_anaer_auto_1_pellet_2c.1322.1322.255.08760.6716122048.972048.3718.058.3%1K.DHMVVSNGSCTTNCLAPVAK.V2
*rpal_wt_anaer_auto_1_pellet_4.2921.2921.376.89390.5752913958.833956.451143.058.8%4K.VLNDTVGIETGFMTTIHAYTGDQPTLDTMHKDLYR.G3
*rpal_wt_anaer_auto_1_crude_3c.1084.1084.139.56360.474751408.31408.681173.072.7%11R.AAAMSMIPTSTGAAK.A1
*rpal_wt_anaer_auto_1_crude_full.1058.1058.261.15130.5989571408.581408.681211.074.1%8R.AAAMSMIPTSTGAAK.A2
*rpal_wt_anaer_auto_1_pellet_2c.2282.2282.138.42090.4231191053.021053.331250.080.0%10K.AIGLVLPELK.G1
*rpal_wt_anaer_auto_1_cleared_1c.2244.2244.249.15290.4167791054.391053.331253.077.8%5K.AIGLVLPELK.G2
*rpal_wt_anaer_auto_1_crude_3.2949.2949.355.12010.4017033213.653212.891211.044.6%1K.AIGLVLPELKGKLDGVAIRVPTPNVSVVDLK.I3
*rpal_wt_anaer_auto_1_crude_full.1936.1936.262.43690.6679242179.062178.5816.064.9%11K.GKLDGVAIRVPTPNVSVVDLK.I2
*rpal_wt_anaer_auto_1_pellet_1c.2157.2157.375.01780.6032822179.822178.581232.059.7%10K.GKLDGVAIRVPTPNVSVVDLK.I3
*rpal_wt_anaer_auto_1_crude_full.2108.2108.261.83420.6664321993.741993.36131.064.7%7K.LDGVAIRVPTPNVSVVDLK.I2
*rpal_wt_anaer_auto_1_pellet_full.1389.1389.238.43980.5763841268.721268.51160.063.6%2R.VPTPNVSVVDLK.I2
*rpal_wt_anaer_auto_1_pellet_2c.1636.1636.145.29720.5350461268.81268.51183.073.7%3R.VPTPNVSVVDLK.I1
*rpal_wt_anaer_auto_1_crude_4.702.702.144.89770.5754061630.731631.87184.076.2%6K.KATTKEEINEAIKR.A1
*rpal_wt_anaer_auto_1_pellet_full.518.518.264.77290.6278831633.661631.871199.080.0%4K.KATTKEEINEAIKR.A2
*rpal_wt_anaer_auto_1_pellet_2.748.748.257.70770.6243661503.341503.71228.073.9%3K.ATTKEEINEAIKR.A2
*rpal_wt_anaer_auto_1_pellet_3c.791.791.139.6770.4751691504.01503.7184.073.7%4K.ATTKEEINEAIKR.A1
*rpal_wt_anaer_auto_1_crude_1.723.723.348.13030.404291504.731503.7181.050.0%1K.ATTKEEINEAIKR.A3
*rpal_wt_anaer_auto_1_pellet_2c.537.537.125.7460.3249241101.931102.231170.057.1%1K.EEINEAIKR.A1
*rpal_wt_anaer_auto_1_cleared_1c.446.446.129.98690.292775788.38788.8761232.081.8%1R.AAEQELK.G1
*rpal_wt_anaer_auto_1_pellet_4.2319.2319.346.74920.3258624116.914115.491161.044.8%1R.AAEQELKGILGYTNAPNVSIDFNHDPHSSTFHMDQTK.V3
*rpal_wt_anaer_auto_1_crude_2c.1939.1939.359.98170.3823683347.223345.631220.054.2%8K.GILGYTNAPNVSIDFNHDPHSSTFHMDQTK.V3
*rpal_wt_anaer_auto_1_pellet_3c.2144.2144.354.42350.4114114215.744213.641118.051.9%3K.GILGYTNAPNVSIDFNHDPHSSTFHMDQTKVQNGTLVR.V3
*rpal_wt_anaer_auto_1_cleared_3.2222.2222.253.26660.6006351793.071791.941247.064.0%12R.VMSWYDNEWGFSNR.M2
*rpal_wt_anaer_auto_1_pellet_full.627.627.133.96470.502666977.02977.171182.068.8%10R.MADTAVAIGK.L1
*rpal_wt_anaer_auto_1_pellet_1.753.753.257.57660.399972977.38977.171115.078.9%6R.MADTAVAIGK.L2
*rpal_wt_anaer_auto_1_crude_3.2090.2090.139.460.4076131202.851203.491178.072.2%2R.MADTAVAIGKLI.-1
*rpal_wt_anaer_auto_1_pellet_1.2158.2158.240.66590.5140231204.161203.491114.061.9%3R.MADTAVAIGKLI.-2
Similarities: RPA0221(1:55)

URPA37258257792.7%409446537.5ilvJ possible leucine/isoleucine/valine-binding protein precursor 4208080:4209309 forward MW:44653
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_cleared_full.701.701.254.88690.6838211224.371224.27161.076.2%9K.YDPGASDTEIR.I2
*rpal_wt_anaer_auto_1_crude_full.1923.1923.277.41150.6082511923.781924.231151.073.5%17R.IGNIMPYSGPASAYGVIGR.T2
*rpal_wt_anaer_auto_1_cleared_1.2290.2290.379.37570.4887971925.321924.231186.066.7%4R.IGNIMPYSGPASAYGVIGR.T3
*rpal_wt_anaer_auto_1_cleared_3c.2085.2085.145.5320.5533121927.171924.23141.071.4%13R.IGNIMPYSGPASAYGVIGR.T1
*rpal_wt_anaer_auto_1_cleared_1c.679.679.135.55620.366642829.39829.9281148.081.8%10R.TEAAYFK.M1
*rpal_wt_anaer_auto_1_cleared_1c.683.683.240.10520.368371830.37829.9281198.084.6%3R.TEAAYFK.M2
2rpal_wt_anaer_auto_1_cleared_1.391.391.131.33840.220295620.36620.7471234.0100.0%3K.MINDK.G111
3rpal_wt_anaer_auto_1_crude_2c.598.598.132.48960.1240121174.881175.351136.066.7%2K.MINDKGGINGR.K111
3rpal_wt_anaer_auto_1_crude_1c.534.534.255.55990.2656271176.91175.351177.081.0%3K.MINDKGGINGR.K2222
rpal_wt_anaer_auto_1_cleared_full.1475.1475.155.64190.7400661757.421758.971152.082.6%13R.KINFISYDDAYSPPK.T111
rpal_wt_anaer_auto_1_pellet_full.1378.1378.273.23810.6618591759.971758.971181.084.6%10R.KINFISYDDAYSPPK.T222
rpal_wt_anaer_auto_1_pellet_1.1558.1558.373.09060.5947591760.241758.971250.066.7%3R.KINFISYDDAYSPPK.T333
*rpal_wt_anaer_auto_1_cleared_full.1493.1493.380.2050.09147682443.632443.721189.068.3%4R.KINFISYDDAYSPPKTVEQAR.K3
*rpal_wt_anaer_auto_1_cleared_3.1545.1545.274.83980.1109022445.112443.721175.066.7%4R.KINFISYDDAYSPPKTVEQAR.K2
*rpal_wt_anaer_auto_1_cleared_2.1423.1423.357.27990.1470672573.452571.89137.050.0%1R.KINFISYDDAYSPPKTVEQARK.L3
rpal_wt_anaer_auto_1_cleared_3c.1750.1750.137.14240.5440791629.681630.79193.061.9%4K.INFISYDDAYSPPK.T111
rpal_wt_anaer_auto_1_pellet_2.1728.1728.245.61640.2098111632.991630.791158.060.0%5K.INFISYDDAYSPPK.T222
*rpal_wt_anaer_auto_1_crude_full.1560.1560.254.7820.0984012314.472315.541201.055.6%3K.INFISYDDAYSPPKTVEQAR.K2
*rpal_wt_anaer_auto_1_cleared_full.2754.2754.273.71450.68292722.782723.141217.057.8%16R.KLVESDEVLLIFNSLGTPPNSAIHK.Y2
*rpal_wt_anaer_auto_1_crude_2c.2805.2805.3101.00.6330132725.822723.141222.064.9%17R.KLVESDEVLLIFNSLGTPPNSAIHK.Y3
*rpal_wt_anaer_auto_1_crude_4.3008.3008.252.32590.6228453345.353346.871136.038.5%7R.KLVESDEVLLIFNSLGTPPNSAIHKYMNSK.K2
*rpal_wt_anaer_auto_1_cleared_full.2810.2810.393.33820.5795183345.743346.871153.063.3%7R.KLVESDEVLLIFNSLGTPPNSAIHKYMNSK.K3
*rpal_wt_anaer_auto_1_cleared_2c.3225.3225.257.35590.6015372595.282594.971206.051.2%9K.LVESDEVLLIFNSLGTPPNSAIHK.Y2
*rpal_wt_anaer_auto_1_cleared_full.2976.2976.377.51060.5723842595.452594.971139.053.4%6K.LVESDEVLLIFNSLGTPPNSAIHK.Y3
*rpal_wt_anaer_auto_1_cleared_3.3237.3237.349.25160.1546913218.783218.71232.040.0%1K.LVESDEVLLIFNSLGTPPNSAIHKYMNSK.K3
*rpal_wt_anaer_auto_1_cleared_full.349.349.128.66720.146069642.39642.7531120.087.5%4K.YMNSK.K1
rpal_wt_anaer_auto_1_pellet_4.1131.1131.145.39240.5587481345.651346.611171.078.9%24K.KVPQLFVATGASK.W11
rpal_wt_anaer_auto_1_pellet_1.1158.1158.256.46180.5932581347.41346.611138.075.0%11K.KVPQLFVATGASK.W22
rpal_wt_anaer_auto_1_cleared_1.1280.1280.365.22760.5783611348.421346.611254.070.7%4K.KVPQLFVATGASK.W33
rpal_wt_anaer_auto_1_crude_2c.1438.1438.235.17340.1946591987.051987.3118.043.8%1K.KVPQLFVATGASKWNDPK.N22
*rpal_wt_anaer_auto_1_cleared_full.2258.2258.381.69670.5416843246.583247.571169.068.7%8K.WNDPKNYPWTMGWQPNYQSETQIYAK.Y3
*rpal_wt_anaer_auto_1_crude_full.2183.2183.245.86280.5177313246.93247.57116.039.1%6K.WNDPKNYPWTMGWQPNYQSETQIYAK.Y2
*rpal_wt_anaer_auto_1_cleared_full.2284.2284.267.87180.7273042606.992606.881162.063.2%15K.NYPWTMGWQPNYQSETQIYAK.Y2
*rpal_wt_anaer_auto_1_cleared_full.2300.2300.367.67090.5450572607.692606.881186.060.7%2K.NYPWTMGWQPNYQSETQIYAK.Y3
*rpal_wt_anaer_auto_1_cleared_3.886.886.144.69430.5304521206.731207.481180.086.7%5K.YILKEMPNAK.I1
*rpal_wt_anaer_auto_1_cleared_1c.944.944.239.61590.4380111207.691207.481249.066.7%3K.YILKEMPNAK.I2
*rpal_wt_anaer_auto_1_cleared_2.1110.1110.235.8450.3425951399.561399.54184.061.9%1K.IAVLYQNDDYGK.D2
*rpal_wt_anaer_auto_1_cleared_3c.1540.1540.145.33350.6429621919.091919.14145.068.0%3K.IAVLYQNDDYGKDYLK.G1
*rpal_wt_anaer_auto_1_crude_2c.1515.1515.257.74560.6757241920.791919.141170.067.9%7K.IAVLYQNDDYGKDYLK.G2
*rpal_wt_anaer_auto_1_crude_3c.2351.2351.274.58570.7499122793.662794.091184.058.5%18K.IAVLYQNDDYGKDYLKGFEDGLGAK.G2
*rpal_wt_anaer_auto_1_pellet_3.2360.2360.383.68880.5505872795.772794.091139.071.2%13K.IAVLYQNDDYGKDYLKGFEDGLGAK.G3
*rpal_wt_anaer_auto_1_cleared_full.759.759.131.42810.402096893.7893.9721184.071.4%6K.GFEDGLGAK.G1
*rpal_wt_anaer_auto_1_pellet_full.694.694.128.30030.375056893.73894.1461192.069.2%5K.GQSMIVMK.E1
*rpal_wt_anaer_auto_1_cleared_1.875.875.244.93270.658231894.33894.146173.080.0%5K.GQSMIVMK.E2
*rpal_wt_anaer_auto_1_cleared_4.1772.1772.256.6650.6544662735.612736.141173.051.2%5K.GQSMIVMKESYEVSEPTIDNHIVK.L2
*rpal_wt_anaer_auto_1_cleared_full.1680.1680.395.70990.6316992736.312736.141151.070.6%7K.GQSMIVMKESYEVSEPTIDNHIVK.L3
*rpal_wt_anaer_auto_1_cleared_4.1898.1898.234.51650.4945232977.372977.471129.033.3%2K.GQSMIVMKESYEVSEPTIDNHIVKLK.S2
*rpal_wt_anaer_auto_1_cleared_3.1876.1876.370.74180.5086552978.152977.471186.062.9%2K.GQSMIVMKESYEVSEPTIDNHIVKLK.S3
*rpal_wt_anaer_auto_1_crude_full.1168.1168.141.22760.5341451859.721861.02173.062.5%11K.ESYEVSEPTIDNHIVK.L1
*rpal_wt_anaer_auto_1_crude_full.1158.1158.263.17110.6926251860.511861.021161.075.0%8K.ESYEVSEPTIDNHIVK.L2
*rpal_wt_anaer_auto_1_pellet_full.1152.1152.346.00630.3632811860.831861.021228.054.9%1K.ESYEVSEPTIDNHIVK.L3
*rpal_wt_anaer_auto_1_crude_2c.1404.1404.247.83860.6224992102.312102.351164.059.4%7K.ESYEVSEPTIDNHIVKLK.S2
*rpal_wt_anaer_auto_1_crude_1.1522.1522.361.07870.4848781705.431705.991253.059.1%1K.LKSTGADVFINITTPK.F3
*rpal_wt_anaer_auto_1_cleared_2.1705.1705.270.8420.6895151705.841705.991119.078.6%6K.LKSTGADVFINITTPK.F2
*rpal_wt_anaer_auto_1_crude_3c.1611.1611.148.08260.6488541706.521705.991108.076.2%13K.LKSTGADVFINITTPK.F1
*rpal_wt_anaer_auto_1_crude_4.1970.1970.133.61930.5079341463.961464.661112.061.9%42K.STGADVFINITTPK.F1
*rpal_wt_anaer_auto_1_cleared_1c.1918.1918.257.76210.6407061464.961464.661218.068.0%9K.STGADVFINITTPK.F2
rpal_wt_anaer_auto_1_cleared_1.635.635.240.440.23025748.76748.9011202.078.6%3K.FAAQAIK.K22
rpal_wt_anaer_auto_1_cleared_2.555.555.129.9360.349435749.71748.9011192.083.3%4K.FAAQAIK.K11
rpal_wt_anaer_auto_1_crude_full.598.598.135.02210.409764876.59877.0751162.084.6%7K.FAAQAIKK.L11
rpal_wt_anaer_auto_1_crude_full.601.601.250.92230.555326877.4877.0751201.081.2%5K.FAAQAIKK.L22
*rpal_wt_anaer_auto_1_cleared_full.2683.2683.370.83950.5631584415.694417.07180.057.0%10K.KLAEVGWKPTHFLNNVSASVGSVIKPAGYENAQGVISAAYLK.D3
*rpal_wt_anaer_auto_1_cleared_full.2814.2814.371.34530.5537934287.434288.9164.064.4%18K.LAEVGWKPTHFLNNVSASVGSVIKPAGYENAQGVISAAYLK.D3
*rpal_wt_anaer_auto_1_cleared_3.596.596.133.25230.556298992.8993.0181125.069.2%1K.DVSDDQWK.D1
*rpal_wt_anaer_auto_1_crude_4.886.886.150.44220.7492951609.91610.7190.085.0%7K.DVSDDQWKDDAGMK.Q1
*rpal_wt_anaer_auto_1_cleared_2.902.902.263.04570.7334791612.01610.71119.080.0%7K.DVSDDQWKDDAGMK.Q2
*rpal_wt_anaer_auto_1_cleared_full.3468.3468.370.10440.5015223803.583802.381211.056.2%4K.QFLAFMDKEFPEGNKLDGGTVVGYGVAQTLVEVLK.A3
*rpal_wt_anaer_auto_1_cleared_2c.3460.3460.233.45670.4656682019.982019.351220.040.0%1K.LDGGTVVGYGVAQTLVEVLK.A2
*rpal_wt_anaer_auto_1_cleared_full.415.415.243.96380.377381851.03849.9431174.084.6%1K.ACGDNLTR.E2
*rpal_wt_anaer_auto_1_crude_full.759.759.234.66380.4258791450.281451.67110.052.2%3K.ACGDNLTRENVMK.Q2
*rpal_wt_anaer_auto_1_cleared_full.760.760.132.20050.5505231450.611451.67166.063.2%4K.ACGDNLTRENVMK.Q1
rpal_wt_anaer_auto_1_pellet_1.372.372.125.60030.210287622.58620.747176.087.5%1R.ENVMK.Q11
*rpal_wt_anaer_auto_1_crude_3.548.548.126.60740.3634211051.851052.18181.064.3%1K.QAASLKDYR.T1
*rpal_wt_anaer_auto_1_cleared_full.1393.1393.141.09940.41906969.58970.1981235.085.7%11R.TEVLLPGIK.I1
*rpal_wt_anaer_auto_1_pellet_full.1293.1293.239.64140.318248970.12970.1981236.064.7%8R.TEVLLPGIK.I2
*rpal_wt_anaer_auto_1_cleared_4.3142.3142.258.64830.5975012942.82944.471100.044.9%9R.TEVLLPGIKINTSATDFAPVSQLQLMR.F2
*rpal_wt_anaer_auto_1_pellet_full.2787.2787.356.8860.1226052947.332944.471212.050.0%1R.TEVLLPGIKINTSATDFAPVSQLQLMR.F3
*rpal_wt_anaer_auto_1_cleared_full.2203.2203.127.1560.5349461991.721993.291128.051.9%2K.INTSATDFAPVSQLQLMR.F1
*rpal_wt_anaer_auto_1_cleared_1c.2393.2393.390.21890.5722431992.991993.291251.066.7%6K.INTSATDFAPVSQLQLMR.F3
*rpal_wt_anaer_auto_1_cleared_2c.2348.2348.269.31490.642661993.791993.291163.069.7%17K.INTSATDFAPVSQLQLMR.F2
*rpal_wt_anaer_auto_1_cleared_full.2468.2468.262.08190.6663892055.572055.29125.069.7%15R.FKGEKWELFGDVISADVGG.-2
*rpal_wt_anaer_auto_1_cleared_4.3264.3264.127.93550.4949941466.731465.61156.054.5%2K.WELFGDVISADVGG.-1
Similarities: RPA0580(4:78)
RPA1798(4:78)
RPA3724(9:73)
RPA1651(5:77)
RPA3723(1:81)
RPA3486(3:79)

URPA29693414490.1%203217765.3RPA2969 unknown protein 3363340:3363951 forward MW:21776
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_pellet_3.2001.2001.258.54840.6160081827.111826.121136.065.4%2-.MTKPDLTQAYLEWTK.Q2
*rpal_wt_anaer_auto_1_pellet_1c.1870.1870.255.00480.6424421695.231694.931133.072.0%3M.TKPDLTQAYLEWTK.Q2
*rpal_wt_anaer_auto_1_pellet_3c.1889.1889.138.82130.6131141695.411694.931169.066.7%6M.TKPDLTQAYLEWTK.Q1
*rpal_wt_anaer_auto_1_membrane_full.592.592.133.25310.4645821274.591275.45140.063.2%6K.QKLDESAATIAK.I1
*rpal_wt_anaer_auto_1_membrane_full.593.593.249.10970.6521661275.61275.45158.068.2%5K.QKLDESAATIAK.I2
*rpal_wt_anaer_auto_1_membrane_3.666.666.129.06250.3843821018.881019.14180.068.8%3K.LDESAATIAK.I1
*rpal_wt_anaer_auto_1_membrane_1c.721.721.257.74250.5992451020.671019.141222.084.2%2K.LDESAATIAK.I2
*rpal_wt_anaer_auto_1_membrane_1c.389.389.127.13580.487183748.47748.8121194.069.2%1K.IGDASSAK.A1
*rpal_wt_anaer_auto_1_membrane_1c.1646.1646.257.90230.5598521730.191729.931152.054.8%4K.IGDASSAKAQEALAQLR.T2
*rpal_wt_anaer_auto_1_membrane_3.903.903.141.4740.312021000.521000.141131.086.7%7K.AQEALAQLR.T1
*rpal_wt_anaer_auto_1_pellet_1.847.847.260.34580.3944531001.911000.141252.082.4%4K.AQEALAQLR.T2
*rpal_wt_anaer_auto_1_membrane_4.2348.2348.155.19490.744651839.851840.99145.081.5%10R.DAFQAQVSAVQADFGASK.Q1
*rpal_wt_anaer_auto_1_membrane_full.2298.2298.269.52510.6992711842.021840.991245.068.8%3R.DAFQAQVSAVQADFGASK.Q2
*rpal_wt_anaer_auto_1_membrane_2c.3607.3607.269.31090.7253852507.232506.781251.061.0%4K.QVTDAALSAVSAQWNEVELAFQK.F2
*rpal_wt_anaer_auto_1_membrane_full.1317.1317.139.59840.34711246.631247.441234.071.4%8K.FLGAAGDQAGLVK.D1
*rpal_wt_anaer_auto_1_membrane_1.1492.1492.273.01550.5637651248.891247.441229.087.5%8K.FLGAAGDQAGLVK.D2
*rpal_wt_anaer_auto_1_membrane_2c.2213.2213.278.20750.670671844.391845.111126.076.5%10K.FLGAAGDQAGLVKDALAAR.A2
*rpal_wt_anaer_auto_1_membrane_3c.2280.2280.134.09370.4388991845.441845.111136.063.0%1K.FLGAAGDQAGLVKDALAAR.A1
*rpal_wt_anaer_auto_1_membrane_full.2093.2093.358.78890.4778231845.661845.111205.049.2%6K.FLGAAGDQAGLVKDALAAR.A3
*rpal_wt_anaer_auto_1_pellet_2c.2721.2721.245.84950.5394062288.872288.521137.045.0%2R.QSFLSSLETIHTGAAAALEQGR.K2
*rpal_wt_anaer_auto_1_pellet_2c.2506.2506.245.64940.4937092416.622416.7148.047.6%2R.QSFLSSLETIHTGAAAALEQGRK.E2
*rpal_wt_anaer_auto_1_pellet_2.2359.2359.350.7040.4157032418.472416.71223.046.5%2R.QSFLSSLETIHTGAAAALEQGRK.E3
*rpal_wt_anaer_auto_1_pellet_2c.3282.3282.348.20570.2387293250.593249.631249.046.8%1R.QSFLSSLETIHTGAAAALEQGRKEMESSLR.R3
*rpal_wt_anaer_auto_1_membrane_3.429.429.131.79350.390599922.43922.9671156.075.0%2R.WTEETEK.T1
*rpal_wt_anaer_auto_1_membrane_3c.868.868.135.86940.593791419.671419.571224.068.4%4R.WTEETEKTLGPK.L1
*rpal_wt_anaer_auto_1_membrane_full.362.362.128.83180.248004515.61515.6311176.088.9%1K.TLGPK.L1
*rpal_wt_anaer_auto_1_crude_2.1838.1838.254.58010.6469171716.881718.91166.062.1%2K.LTQLSAAGDETWNALK.A2
*rpal_wt_anaer_auto_1_pellet_3c.1977.1977.142.45210.6258511721.551718.9152.075.0%5K.LTQLSAAGDETWNALK.A1
*rpal_wt_anaer_auto_1_pellet_4.3366.3366.265.75860.6042872966.522967.261216.047.1%7K.LTQLSAAGDETWNALKAGLDETAAVYEK.T2
*rpal_wt_anaer_auto_1_pellet_full.2937.2937.391.0550.6018592969.852967.261201.064.1%5K.LTQLSAAGDETWNALKAGLDETAAVYEK.T3
*rpal_wt_anaer_auto_1_pellet_3.937.937.150.9680.6959541267.81267.381115.088.9%6K.AGLDETAAVYEK.T1
*rpal_wt_anaer_auto_1_membrane_1.1157.1157.261.68990.6581421268.911267.381255.081.0%2K.AGLDETAAVYEK.T2
*rpal_wt_anaer_auto_1_crude_2c.618.618.130.16450.138611020.41020.221102.078.6%6R.ISQAFTKPK.-1
*rpal_wt_anaer_auto_1_membrane_1.497.497.245.09830.6163181021.141020.22199.081.2%4R.ISQAFTKPK.-2

URPA46425223289.8%361393416.3cbbA fructose-bisphosphate aldolase 5225636:5226721 reverse MW:39341
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_pellet_3c.4509.4509.351.29660.3362114662.734661.3219.052.2%4R.QLLDHAAEHGYGVPAFNINNMEQGLAIMEAAALVDAPVIIQASR.G3
*rpal_wt_anaer_auto_1_cleared_full.1203.1203.130.71010.4746391125.451126.3210.068.8%10R.SYANDIMLAK.M1
*rpal_wt_anaer_auto_1_crude_full.1136.1136.260.09880.6110941128.051126.321156.083.3%9R.SYANDIMLAK.M2
*rpal_wt_anaer_auto_1_pellet_2c.2832.2832.362.73490.3744343549.643548.061184.051.9%9K.MIDALAEMYPDIPLCMHQDHGNDEATCATAIR.Y3
*rpal_wt_anaer_auto_1_pellet_1c.2003.2003.238.67850.5814861436.461436.691241.054.2%1R.YGFTSVMMDGSLK.A2
*rpal_wt_anaer_auto_1_pellet_4.1992.1992.149.74880.6997681436.691436.691178.085.0%5R.YGFTSVMMDGSLK.A1
*rpal_wt_anaer_auto_1_pellet_4.1183.1183.126.2680.4284341530.811530.631128.057.9%2K.TAADYQYNVDITR.R1
*rpal_wt_anaer_auto_1_crude_2.1105.1105.232.14370.386811531.021530.631169.047.8%2K.TAADYQYNVDITR.R2
*rpal_wt_anaer_auto_1_pellet_full.2834.2834.3102.0790.5899463986.053986.33154.071.6%6R.RVVDMAHWVGASVEGELGVLGSLEHGGGEQEDGHGVEGK.V3
*rpal_wt_anaer_auto_1_pellet_full.2958.2958.381.32210.5339133830.293830.141139.063.8%8R.VVDMAHWVGASVEGELGVLGSLEHGGGEQEDGHGVEGK.V3
*rpal_wt_anaer_auto_1_crude_2.1857.1857.387.79080.6353552106.072103.341247.068.4%5K.VSREQLLTDPDQAVEFVR.A3
*rpal_wt_anaer_auto_1_pellet_1.2115.2115.358.27230.4955411761.971760.941107.059.2%1R.EQLLTDPDQAVEFVR.A3
*rpal_wt_anaer_auto_1_crude_2.2037.2037.270.49140.7012441763.01760.941225.078.6%8R.EQLLTDPDQAVEFVR.A2
*rpal_wt_anaer_auto_1_crude_4.1397.1397.158.35530.642551905.751906.211129.075.9%5R.ATKVDALAIAMGTSHGAYK.F1
*rpal_wt_anaer_auto_1_pellet_3.1453.1453.269.88860.5930141907.651906.211249.065.7%5R.ATKVDALAIAMGTSHGAYK.F2
*rpal_wt_anaer_auto_1_pellet_1c.1537.1537.382.58660.558261907.651906.211238.067.2%5R.ATKVDALAIAMGTSHGAYK.F3
*rpal_wt_anaer_auto_1_pellet_1c.1738.1738.373.8290.5569792295.882296.661194.064.6%2R.ATKVDALAIAMGTSHGAYKFSR.K3
*rpal_wt_anaer_auto_1_pellet_3.1692.1692.280.23310.7007442296.162296.661185.069.2%4R.ATKVDALAIAMGTSHGAYKFSR.K2
*rpal_wt_anaer_auto_1_crude_2.1480.1480.262.71680.5780911603.481605.861116.069.0%6K.VDALAIAMGTSHGAYK.F2
*rpal_wt_anaer_auto_1_pellet_4.1612.1612.140.73020.5614611605.41605.861180.070.8%5K.VDALAIAMGTSHGAYK.F1
*rpal_wt_anaer_auto_1_pellet_full.1442.1442.361.21910.4886351606.31605.861232.056.6%2K.VDALAIAMGTSHGAYK.F3
*rpal_wt_anaer_auto_1_pellet_1.1833.1833.368.78740.5385751995.151996.31236.059.7%3K.VDALAIAMGTSHGAYKFSR.K3
*rpal_wt_anaer_auto_1_pellet_2c.1922.1922.268.27160.6277431997.481996.31210.067.6%2K.VDALAIAMGTSHGAYKFSR.K2
*rpal_wt_anaer_auto_1_pellet_full.582.582.249.90750.6150221073.541074.291171.077.8%4R.KPDGDVLAMK.V2
*rpal_wt_anaer_auto_1_pellet_2c.735.735.145.65620.4776631073.731074.291222.081.2%11R.KPDGDVLAMK.V1
*rpal_wt_anaer_auto_1_crude_1c.490.490.129.25850.361198881.52882.008153.081.8%1K.VVEEIHR.R1
*rpal_wt_anaer_auto_1_pellet_1.434.434.236.26750.398878884.6882.0081177.076.9%1K.VVEEIHR.R2
*rpal_wt_anaer_auto_1_crude_4.3905.3905.372.92150.5482424752.164752.391196.055.8%15R.RLPNTHLVMHGSSSVPQDLQDIFNEFGGAMPQTFGVPVEEIVR.G3
*rpal_wt_anaer_auto_1_pellet_full.3575.3575.366.29050.5417054594.84596.21143.059.8%10R.LPNTHLVMHGSSSVPQDLQDIFNEFGGAMPQTFGVPVEEIVR.G3
*rpal_wt_anaer_auto_1_pellet_3.455.455.138.14140.6263271064.331064.211120.085.7%5R.KVNIDTDCR.L1
*rpal_wt_anaer_auto_1_pellet_1.502.502.243.61240.5781021064.41064.211237.070.6%2R.KVNIDTDCR.L2
*rpal_wt_anaer_auto_1_pellet_1.1343.1343.245.82150.509796895.36895.1131173.086.7%3R.LAMTGVFR.K2
*rpal_wt_anaer_auto_1_pellet_1.1024.1024.240.34010.5611341023.281023.291210.064.7%4R.LAMTGVFRK.V2
*rpal_wt_anaer_auto_1_pellet_2c.937.937.134.27820.4066141308.821308.65149.066.7%1R.KFLKPAMDAMR.D1
*rpal_wt_anaer_auto_1_crude_1c.1562.1562.359.78760.5135581770.131768.221122.060.0%2R.KFLKPAMDAMRDICK.L3
*rpal_wt_anaer_auto_1_pellet_3.1005.1005.132.01470.3021171179.71180.48126.075.0%4K.FLKPAMDAMR.D1
*rpal_wt_anaer_auto_1_pellet_full.938.938.235.30840.4718311181.041180.481134.066.7%1K.FLKPAMDAMR.D2
*rpal_wt_anaer_auto_1_pellet_full.940.940.350.45350.5210621182.771180.481219.057.6%1K.FLKPAMDAMR.D3
*rpal_wt_anaer_auto_1_crude_1c.1750.1750.346.23360.4570461640.611640.051212.051.1%1K.FLKPAMDAMRDICK.L3
*rpal_wt_anaer_auto_1_crude_2.1733.1733.247.74320.6583091640.831640.051144.065.4%2K.FLKPAMDAMRDICK.L2
*rpal_wt_anaer_auto_1_crude_2.968.968.264.04980.6978631527.91526.69147.076.9%1K.LRFEQFGTAGNASK.I2
*rpal_wt_anaer_auto_1_cleared_full.731.731.141.12440.5992911256.381257.35175.073.7%8R.FEQFGTAGNASK.I1
*rpal_wt_anaer_auto_1_crude_full.746.746.258.15070.6032521257.321257.351203.081.8%5R.FEQFGTAGNASK.I2
*rpal_wt_anaer_auto_1_crude_full.983.983.133.67480.2104041216.611217.581216.068.8%9K.IKVVPMAEMAK.R1
*rpal_wt_anaer_auto_1_pellet_full.959.959.242.58910.4648941217.381217.581226.065.0%7K.IKVVPMAEMAK.R2
*rpal_wt_anaer_auto_1_pellet_1.1089.1089.365.42880.5399561219.181217.581243.079.4%2K.IKVVPMAEMAK.R3
*rpal_wt_anaer_auto_1_crude_2c.849.849.133.22910.40612976.22976.2481168.078.6%5K.VVPMAEMAK.R1
*rpal_wt_anaer_auto_1_pellet_full.948.948.258.58080.6409061604.781603.821205.064.3%7R.YKSGALDPQIGQVAR.A2
*rpal_wt_anaer_auto_1_pellet_full.954.954.371.60450.5100641605.831603.821243.061.2%3R.YKSGALDPQIGQVAR.A3
*rpal_wt_anaer_auto_1_pellet_3c.1079.1079.125.56240.4469261606.091603.821128.056.5%1R.YKSGALDPQIGQVAR.A1
*rpal_wt_anaer_auto_1_crude_4.1065.1065.129.50930.2077181311.561312.471132.063.2%1K.SGALDPQIGQVAR.A1
*rpal_wt_anaer_auto_1_pellet_1c.1182.1182.264.79990.553841312.621312.471220.078.3%6K.SGALDPQIGQVAR.A2

URPA4138218689.8%127140236.2RPA4138 conserved unknown protein 4679786:4680169 reverse MW:14022
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_membrane_2c.1115.1115.230.31750.4416691947.641947.12116.037.0%1M.DQEERDRFEIPKEVR.S2
*rpal_wt_anaer_auto_1_membrane_1.1197.1197.358.01450.4409311290.371289.481237.068.8%3R.DRFEIPKEVR.S3
*rpal_wt_anaer_auto_1_membrane_full.1053.1053.250.80630.4510211290.741289.48162.072.2%3R.DRFEIPKEVR.S2
*rpal_wt_anaer_auto_1_membrane_1.1268.1268.230.76720.4676541018.521018.21217.056.2%1R.FEIPKEVR.S2
*rpal_wt_anaer_auto_1_membrane_2c.857.857.134.88130.3916971182.621183.291208.070.6%3R.SMAEAGFDQAR.K1
*rpal_wt_anaer_auto_1_membrane_1.922.922.261.99360.6149781183.561183.291251.081.0%1R.SMAEAGFDQAR.K2
*rpal_wt_anaer_auto_1_membrane_1.655.655.239.30780.5719681311.271311.461228.059.1%1R.SMAEAGFDQARK.A2
*rpal_wt_anaer_auto_1_crude_full.1670.1670.277.82450.4777792235.862235.481206.066.7%6R.KAFEHMLSSAQQTAATIEDR.G2
*rpal_wt_anaer_auto_1_pellet_1c.1874.1874.368.97990.5060022237.652235.481255.056.7%2R.KAFEHMLSSAQQTAATIEDR.G3
*rpal_wt_anaer_auto_1_pellet_3.2013.2013.265.15460.597252108.552107.31181.067.6%1K.AFEHMLSSAQQTAATIEDR.G2
*rpal_wt_anaer_auto_1_membrane_3.406.406.128.570.401323957.8960.079177.069.2%2R.ANAKEITGR.A1
*rpal_wt_anaer_auto_1_pellet_3c.1881.1881.142.32030.6225361779.01779.01152.070.8%4R.NVHAALDYAQQLVHAK.D1
*rpal_wt_anaer_auto_1_pellet_full.1624.1624.382.30710.6478861779.231779.01195.069.4%6R.NVHAALDYAQQLVHAK.D3
*rpal_wt_anaer_auto_1_pellet_2c.1920.1920.282.82890.7610931780.191779.011187.082.1%12R.NVHAALDYAQQLVHAK.D2
*rpal_wt_anaer_auto_1_membrane_1c.978.978.129.95460.237923805.48805.931162.075.0%3K.DLGDVMR.V1
*rpal_wt_anaer_auto_1_membrane_full.482.482.148.25230.6896251335.531336.511182.082.4%3R.VHSEYVQSQMK.A1
*rpal_wt_anaer_auto_1_membrane_1.539.539.246.83670.6004011336.111336.511134.070.0%1R.VHSEYVQSQMK.A2
*rpal_wt_anaer_auto_1_membrane_1c.1758.1758.287.76570.634711564.811564.741254.085.7%10K.AFAEQASEIGQVVSK.A2
*rpal_wt_anaer_auto_1_pellet_4.1591.1591.155.14780.4839921566.891564.741122.081.8%19K.AFAEQASEIGQVVSK.A1
*rpal_wt_anaer_auto_1_membrane_3.373.373.129.0080.384435958.29958.103189.071.4%2K.AAQDVTKPK.S1
*rpal_wt_anaer_auto_1_membrane_2c.409.409.139.73350.6432961044.761045.181233.080.0%2K.AAQDVTKPKS.-1

URPA2604277489.7%155169265.9RPA2604 peptidyl prolyl cis-trans isomerase 2961628:2962095 forward MW:16926
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_cleared_full.1798.1798.273.95620.7100651845.831846.051236.076.7%3M.ADNDNILILETTQGTVK.I2
*rpal_wt_anaer_auto_1_cleared_4.1918.1918.137.6810.671461846.061846.05182.065.4%7M.ADNDNILILETTQGTVK.I1
*rpal_wt_anaer_auto_1_pellet_2.896.896.235.77190.5181921617.331619.891104.042.3%4K.IEMRPDLAPNHVAR.I2
*rpal_wt_anaer_auto_1_crude_3c.864.864.126.66550.4032741619.421619.89117.050.0%1K.IEMRPDLAPNHVAR.I1
*rpal_wt_anaer_auto_1_crude_full.864.864.370.45170.5795221620.061619.891246.066.7%2K.IEMRPDLAPNHVAR.I3
*rpal_wt_anaer_auto_1_crude_2c.1556.1556.129.17110.4508061340.021340.481212.064.7%2R.EGFYDGIVFHR.V1
*rpal_wt_anaer_auto_1_cleared_full.1530.1530.239.34720.5257681340.71340.481120.063.2%3R.EGFYDGIVFHR.V2
*rpal_wt_anaer_auto_1_crude_3.1474.1474.280.32880.7603032114.172114.431248.066.7%6R.VIEGFMAQTGCPQGTGMGGSGK.K2
*rpal_wt_anaer_auto_1_crude_3.1238.1238.256.12610.6786292242.592242.61232.052.4%4R.VIEGFMAQTGCPQGTGMGGSGKK.L2
*rpal_wt_anaer_auto_1_cleared_2.1359.1359.366.70920.3970922243.462242.61236.060.3%2R.VIEGFMAQTGCPQGTGMGGSGKK.L3
*rpal_wt_anaer_auto_1_cleared_1.913.913.365.03570.5159741413.931411.61203.070.3%1K.LKAEFNAEPHVR.G3
*rpal_wt_anaer_auto_1_cleared_1c.725.725.241.13050.4802471171.031170.271180.068.4%2K.AEFNAEPHVR.G2
*rpal_wt_anaer_auto_1_cleared_1.775.775.349.29750.4992851171.641170.271185.071.4%1K.AEFNAEPHVR.G3
*rpal_wt_anaer_auto_1_crude_2.477.477.125.56060.203912693.55691.829180.072.7%1R.GVASMAR.A1
*rpal_wt_anaer_auto_1_cleared_2c.2441.2441.267.21440.6805222080.142077.19194.069.7%4R.AANPDSGDSQFFICFDDAR.F2
*rpal_wt_anaer_auto_1_cleared_full.1290.1290.355.22070.5373041385.781385.611166.067.6%1R.FLDKQYTVWGK.V3
*rpal_wt_anaer_auto_1_pellet_4.1312.1312.140.65320.5129951387.121385.611232.070.6%6R.FLDKQYTVWGK.V1
*rpal_wt_anaer_auto_1_cleared_full.1285.1285.259.81190.5336961387.541385.611111.085.0%6R.FLDKQYTVWGK.V2
*rpal_wt_anaer_auto_1_cleared_full.784.784.131.6470.3985911133.511134.31216.075.0%2K.VIEGMENVDK.I1
*rpal_wt_anaer_auto_1_cleared_1c.831.831.236.86060.5529621135.161134.31176.066.7%1K.VIEGMENVDK.I2
*rpal_wt_anaer_auto_1_cleared_1.1185.1185.258.42490.6671951375.531375.631152.081.8%3K.VIEGMENVDKIK.R2
*rpal_wt_anaer_auto_1_cleared_4.1047.1047.136.04010.4603961376.671375.631135.068.4%1K.VIEGMENVDKIK.R1
*rpal_wt_anaer_auto_1_cleared_1c.951.951.254.69940.5775491531.761531.82151.076.2%3K.VIEGMENVDKIKR.G2
*rpal_wt_anaer_auto_1_crude_3.1084.1084.345.97880.3091842838.72838.341212.047.1%1K.VIEGMENVDKIKRGEPVKDPDKIVK.A3
*rpal_wt_anaer_auto_1_cleared_4.528.528.140.29230.6067641480.61481.741196.070.0%3K.RGEPVKDPDKIVK.A1
*rpal_wt_anaer_auto_1_cleared_4.572.572.138.28640.4725461325.481325.551234.064.7%2R.GEPVKDPDKIVK.A1
*rpal_wt_anaer_auto_1_cleared_1c.635.635.242.92260.5753591327.21325.551121.061.9%2R.GEPVKDPDKIVK.A2

URPA160051189.7%7883915.3RPA1600 BolA-like protein 1779811:1780047 forward MW:8390
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_membrane_2.1346.1346.130.68140.334766821.11819.9971241.081.8%2R.DIEAMIK.A1
*rpal_wt_anaer_auto_1_membrane_3.3839.3839.371.50990.4966933177.473176.47122.054.2%4K.AAIPDAEVTIRDLAGDGDHYAATVISETFR.G3
*rpal_wt_anaer_auto_1_membrane_2c.3762.3762.349.7190.2736683362.273361.691164.044.4%1K.AAIPDAEVTIRDLAGDGDHYAATVISETFRGK.S3
*rpal_wt_anaer_auto_1_membrane_3.2723.2723.243.59940.552682040.42039.171149.045.7%2R.DLAGDGDHYAATVISETFR.G2
*rpal_wt_anaer_auto_1_cleared_3c.3345.3345.241.63110.5627313304.013302.7810.033.3%2R.VQQHQIVYQSLQGQMGGVLHALALQTGVPEA.-2

URPA3501146289.1%92101838.6RPA3501 conserved unknown protein 3951527:3951805 forward MW:10182
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_cleared_2c.3233.3233.382.73070.5707073064.253063.511154.068.0%2R.SIVVAGHKTSVSLEEAFWNGMKEISSVR.D3
*rpal_wt_anaer_auto_1_pellet_3c.2634.2634.149.09620.7270971600.121599.8145.090.0%4K.TSVSLEEAFWNGMK.E1
*rpal_wt_anaer_auto_1_pellet_1c.2550.2550.232.63730.4524061602.191599.81102.044.0%1K.TSVSLEEAFWNGMK.E2
*rpal_wt_anaer_auto_1_pellet_3.3585.3585.258.9210.7193142271.212271.561235.054.3%8K.TSVSLEEAFWNGMKEISSVR.D2
*rpal_wt_anaer_auto_1_pellet_full.3179.3179.376.26720.6247922271.862271.561254.062.7%7K.TSVSLEEAFWNGMKEISSVR.D3
*rpal_wt_anaer_auto_1_pellet_2.2932.2932.233.42340.4348121680.121679.851231.040.0%2R.DMTLSELVGEIDSNR.Q2
*rpal_wt_anaer_auto_1_pellet_3c.3054.3054.128.72450.4350921680.21679.851130.052.4%2R.DMTLSELVGEIDSNR.Q1
*rpal_wt_anaer_auto_1_crude_2c.2744.2744.240.2650.40912734.22735.01132.043.2%3R.DMTLSELVGEIDSNRQQGNLSSAIR.L2
*rpal_wt_anaer_auto_1_crude_3.2819.2819.392.56820.6436232735.72735.01179.063.2%5R.DMTLSELVGEIDSNRQQGNLSSAIR.L3
*rpal_wt_anaer_auto_1_cleared_1.2813.2813.251.47660.4261981074.751073.281236.086.7%10R.LFVLDYFR.S2
*rpal_wt_anaer_auto_1_crude_2c.698.698.133.99090.5079331371.751372.521203.070.0%6R.ALQAQQQAVADTK.T1
*rpal_wt_anaer_auto_1_cleared_1.755.755.280.1570.7400041371.781372.521231.087.0%6R.ALQAQQQAVADTK.T2
*rpal_wt_anaer_auto_1_cleared_3.1057.1057.260.77280.6536612198.972199.381204.055.3%3R.ALQAQQQAVADTKTESSLTAH.-2
*rpal_wt_anaer_auto_1_crude_1c.1024.1024.368.0720.5704612199.912199.38175.056.9%3R.ALQAQQQAVADTKTESSLTAH.-3

URPA440410049588.1%596667147.5RPA4404 putative periplasmic binding ABC transporter protein, probable sugar binding 4960215:4962005 reverse MW:66714
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_pellet_2c.2601.2601.363.31580.4723693240.613239.651242.055.6%1K.KWIDEEFQPSTLSKEEQLKELQWFAK.A3
*rpal_wt_anaer_auto_1_pellet_3c.1781.1781.140.17450.5993631579.831580.731226.070.0%6K.WIDEEFQPSTLSK.E1
*rpal_wt_anaer_auto_1_cleared_full.1635.1635.258.76920.6211961580.911580.731241.075.0%4K.WIDEEFQPSTLSK.E2
*rpal_wt_anaer_auto_1_cleared_3.1863.1863.260.60790.6333432209.142208.431148.062.5%6K.WIDEEFQPSTLSKEEQLK.E2
*rpal_wt_anaer_auto_1_crude_2.1778.1778.352.46140.3774262209.462208.431152.054.5%1K.WIDEEFQPSTLSKEEQLK.E3
*rpal_wt_anaer_auto_1_crude_full.2374.2374.238.41110.5623763110.783111.48164.034.1%2K.WIDEEFQPSTLSKEEQLKELQWFAK.A2
*rpal_wt_anaer_auto_1_pellet_2c.2733.2733.351.01530.3829673112.343111.481224.050.0%3K.WIDEEFQPSTLSKEEQLKELQWFAK.A3
*rpal_wt_anaer_auto_1_pellet_4.1852.1852.138.13580.5530971549.71549.771153.077.8%6K.EEQLKELQWFAK.A1
*rpal_wt_anaer_auto_1_cleared_1c.1881.1881.256.84870.6173931550.731549.771164.077.3%7K.EEQLKELQWFAK.A2
*rpal_wt_anaer_auto_1_cleared_2c.1439.1439.136.50370.348406921.72922.0711180.090.0%3K.ELQWFAK.A1
*rpal_wt_anaer_auto_1_crude_3c.2267.2267.266.79680.6593132781.42782.1135.055.8%12K.AAEPFKGMDINVVSETITTHEYEAK.T2
*rpal_wt_anaer_auto_1_pellet_2c.2385.2385.3107.8480.6502042783.842782.11173.069.4%10K.AAEPFKGMDINVVSETITTHEYEAK.T3
*rpal_wt_anaer_auto_1_pellet_3.2411.2411.367.10010.467373195.243195.62144.061.0%1K.AAEPFKGMDINVVSETITTHEYEAKTLAK.A3
*rpal_wt_anaer_auto_1_pellet_3.1955.1955.264.71920.6969862138.542138.361205.067.6%7K.GMDINVVSETITTHEYEAK.T2
*rpal_wt_anaer_auto_1_cleared_2.1993.1993.349.4870.2825132139.852138.361232.048.4%1K.GMDINVVSETITTHEYEAK.T3
*rpal_wt_anaer_auto_1_crude_3.1076.1076.136.35450.352971966.77966.1231177.078.6%7K.AFSEITGIK.L1
*rpal_wt_anaer_auto_1_cleared_1c.1223.1223.239.45730.380267966.9966.1231137.070.6%3K.AFSEITGIK.L2
*rpal_wt_anaer_auto_1_pellet_1.1486.1486.241.77450.5932451210.411207.461216.065.0%1K.AFSEITGIKLK.H2
*rpal_wt_anaer_auto_1_crude_2c.1853.1853.261.92160.6962212570.412570.95165.056.1%8K.AFSEITGIKLKHDLIQEGDVVEK.L2
*rpal_wt_anaer_auto_1_pellet_2.1863.1863.374.75830.5766282571.312570.95136.058.0%3K.AFSEITGIKLKHDLIQEGDVVEK.L3
*rpal_wt_anaer_auto_1_crude_3.2525.2525.363.41260.4829863573.733573.1114.053.8%1K.AFSEITGIKLKHDLIQEGDVVEKLQTQMQSGK.N3
*rpal_wt_anaer_auto_1_pellet_2.886.886.274.0020.7135661623.471623.851121.084.6%9K.LKHDLIQEGDVVEK.L2
*rpal_wt_anaer_auto_1_cleared_4.909.909.154.26730.6821031624.321623.851211.081.8%9K.LKHDLIQEGDVVEK.L1
*rpal_wt_anaer_auto_1_cleared_1.1032.1032.369.57630.5649781624.821623.851218.064.4%4K.LKHDLIQEGDVVEK.L3
*rpal_wt_anaer_auto_1_crude_4.1751.1751.250.78820.5852072627.312626.0111.051.2%1K.LKHDLIQEGDVVEKLQTQMQSGK.N2
*rpal_wt_anaer_auto_1_crude_2c.920.920.149.75280.6114851382.791382.511230.088.9%5K.HDLIQEGDVVEK.L1
*rpal_wt_anaer_auto_1_pellet_1.969.969.267.06590.675071383.641382.51129.086.4%7K.HDLIQEGDVVEK.L2
*rpal_wt_anaer_auto_1_cleared_2.1960.1960.350.72430.388212384.922384.67118.044.4%1K.HDLIQEGDVVEKLQTQMQSGK.N3
*rpal_wt_anaer_auto_1_crude_3.448.448.130.54440.5083851020.641021.181200.078.6%6K.LQTQMQSGK.N1
*rpal_wt_anaer_auto_1_cleared_full.2256.2256.394.12830.6601643124.23125.451239.069.9%7K.LQTQMQSGKNVYDGWINDSDLIGTHFR.Y3
*rpal_wt_anaer_auto_1_cleared_3c.2405.2405.246.29310.6011743125.833125.451166.036.2%6K.LQTQMQSGKNVYDGWINDSDLIGTHFR.Y2
*rpal_wt_anaer_auto_1_cleared_2c.2470.2470.280.08230.7400272125.012123.291234.078.8%9K.NVYDGWINDSDLIGTHFR.Y2
*rpal_wt_anaer_auto_1_cleared_1c.2489.2489.354.77220.3941182125.382123.291176.053.4%6K.NVYDGWINDSDLIGTHFR.Y3
*rpal_wt_anaer_auto_1_cleared_2.1733.1733.230.28760.4154741736.471734.921136.042.9%1R.YGQTIALSDYMTGEGK.D2
*rpal_wt_anaer_auto_1_cleared_full.2955.2955.252.25780.6092973408.043409.821143.037.0%10R.YGQTIALSDYMTGEGKDVTDPMLDINDFIGK.S2
*rpal_wt_anaer_auto_1_pellet_full.2863.2863.389.2120.555343408.163409.821105.067.1%14R.YGQTIALSDYMTGEGKDVTDPMLDINDFIGK.S3
*rpal_wt_anaer_auto_1_crude_4.2830.2830.136.47380.4891921693.991693.911132.063.6%2K.DVTDPMLDINDFIGK.S1
*rpal_wt_anaer_auto_1_pellet_3.370.370.125.66480.38778995.42995.1211193.071.4%1K.SFTTAPDKK.M1
*rpal_wt_anaer_auto_1_cleared_full.2864.2864.382.9070.6350272121.612121.431247.068.5%3K.MYQLPDQQFANLYWFR.Y3
*rpal_wt_anaer_auto_1_crude_3.3084.3084.289.59050.7026862122.222121.431158.082.8%9K.MYQLPDQQFANLYWFR.Y2
*rpal_wt_anaer_auto_1_pellet_1.1709.1709.239.6730.5891991347.921349.441224.066.7%3R.YDWFTNPDYK.A2
*rpal_wt_anaer_auto_1_pellet_2c.1797.1797.145.58090.6880491348.381349.441183.087.5%7R.YDWFTNPDYK.A1
*rpal_wt_anaer_auto_1_crude_4.1332.1332.133.88350.5686041548.581548.691192.073.7%1R.YDWFTNPDYKAK.F1
*rpal_wt_anaer_auto_1_cleared_2.1414.1414.239.04330.5250761551.511548.691240.054.5%3R.YDWFTNPDYKAK.F2
*rpal_wt_anaer_auto_1_crude_4.4301.4301.350.51430.397273871.023868.29176.045.1%1K.AKYGYDLGVPVNWSAYEDIAEFFTNDIKEINGVK.V3
*rpal_wt_anaer_auto_1_cleared_3c.4295.4295.232.19930.4141393028.853028.31240.032.6%3K.YGYDLGVPVNWSAYEDIAEFFTNDIK.E2
*rpal_wt_anaer_auto_1_cleared_full.4013.4013.351.35490.3188033669.293669.041136.044.3%3K.YGYDLGVPVNWSAYEDIAEFFTNDIKEINGVK.V3
*rpal_wt_anaer_auto_1_pellet_2c.1117.1117.246.98180.6035272011.052010.281195.051.6%3K.VYGHMDYGKKDPSLGWR.F2
*rpal_wt_anaer_auto_1_crude_3c.1842.1842.149.76330.7156381513.611513.671170.077.3%9R.FTDAWLSMAGNGDK.G1
*rpal_wt_anaer_auto_1_cleared_2.1887.1887.263.38850.7150081514.381513.671211.073.1%3R.FTDAWLSMAGNGDK.G2
*rpal_wt_anaer_auto_1_pellet_3c.3120.3120.263.84210.6464233017.723018.381161.049.0%13R.FTDAWLSMAGNGDKGLPNGLPVDEWGIR.M2
*rpal_wt_anaer_auto_1_cleared_3.2991.2991.369.8380.4984113019.473018.381213.053.2%6R.FTDAWLSMAGNGDKGLPNGLPVDEWGIR.M3
*rpal_wt_anaer_auto_1_cleared_1c.2293.2293.248.5390.5927441523.241523.73172.072.0%3K.GLPNGLPVDEWGIR.M2
*rpal_wt_anaer_auto_1_crude_4.2238.2238.132.26680.5366411525.21523.731137.052.4%4K.GLPNGLPVDEWGIR.M1
*rpal_wt_anaer_auto_1_pellet_full.595.595.245.87730.5641571423.191421.64173.062.5%5R.MEGCRPVGSSIER.G2
*rpal_wt_anaer_auto_1_crude_4.1411.1411.138.07050.53891449.481449.61148.065.2%17R.GGDTNGPAAVYSIVK.Y1
*rpal_wt_anaer_auto_1_cleared_full.1418.1418.263.64730.6219491450.21449.61240.074.1%8R.GGDTNGPAAVYSIVK.Y2
*rpal_wt_anaer_auto_1_pellet_3.987.987.128.51190.398704983.85984.2061181.072.7%2K.YLDWMKK.Y1
*rpal_wt_anaer_auto_1_cleared_3c.3785.3785.348.84030.3882495532.715533.31120.054.3%1K.YAPPQAQGMTFSESGPVPAQGNVAQQMFWYTAFTADMVKPGLPVMNADGTPK.W3
*rpal_wt_anaer_auto_1_crude_2c.775.775.137.11730.6050551244.781245.451244.070.6%2R.MAPSPHGAYWK.E1
*rpal_wt_anaer_auto_1_crude_4.807.807.143.69770.5821611690.051690.991194.068.2%5R.MAPSPHGAYWKEGMK.L1
*rpal_wt_anaer_auto_1_cleared_1c.869.869.240.24150.5999011690.561690.9912.059.3%2R.MAPSPHGAYWKEGMK.L2
*rpal_wt_anaer_auto_1_cleared_1c.1541.1541.252.81540.6395841348.771351.541172.073.9%9K.LGYQDVGSGTLLK.S2
*rpal_wt_anaer_auto_1_crude_full.1378.1378.145.03330.5414331350.561351.541113.080.0%9K.LGYQDVGSGTLLK.S1
*rpal_wt_anaer_auto_1_pellet_4.2593.2593.143.70160.6037561570.221569.891114.075.0%5R.KAAWLYLQFITSK.T1
*rpal_wt_anaer_auto_1_crude_1c.2446.2446.254.15240.6450981572.281569.891149.073.9%3R.KAAWLYLQFITSK.T2
*rpal_wt_anaer_auto_1_cleared_3c.3007.3007.138.88730.5941481442.611441.711198.077.8%1K.AAWLYLQFITSK.T1
*rpal_wt_anaer_auto_1_pellet_1.1144.1144.245.95550.3504281030.231030.221241.070.6%7K.SHVGLTFIR.E2
*rpal_wt_anaer_auto_1_crude_2c.1094.1094.137.00870.4343281032.31030.221112.085.7%5K.SHVGLTFIR.E1
*rpal_wt_anaer_auto_1_cleared_2c.778.778.138.40030.478447894.2892.9411178.090.9%4R.ESDIWDK.S1
*rpal_wt_anaer_auto_1_crude_3c.1208.1208.125.56690.4724551514.21513.61168.050.0%1R.ESDIWDKSFTER.A1
*rpal_wt_anaer_auto_1_cleared_2c.1893.1893.130.82140.4632851068.511068.26184.071.4%1K.LGGLIEFYR.S1
*rpal_wt_anaer_auto_1_pellet_full.1668.1668.256.15210.5943411069.631068.261232.088.2%8K.LGGLIEFYR.S2
*rpal_wt_anaer_auto_1_cleared_full.1500.1500.136.41550.5803331715.631716.89185.062.5%11R.VQWSPTGNNIPDYPK.L1
*rpal_wt_anaer_auto_1_pellet_2.1525.1525.266.25670.7153651718.471716.891225.074.1%9R.VQWSPTGNNIPDYPK.L2
*rpal_wt_anaer_auto_1_cleared_4.3414.3414.236.76130.4901843542.833543.921232.028.6%3R.VQWSPTGNNIPDYPKLAQLWWQNIGDASSGAK.T2
*rpal_wt_anaer_auto_1_crude_full.3084.3084.366.65970.5052423543.493543.921209.053.2%6R.VQWSPTGNNIPDYPKLAQLWWQNIGDASSGAK.T3
*rpal_wt_anaer_auto_1_cleared_4.2287.2287.147.7070.6884821845.851846.05156.076.0%9K.LAQLWWQNIGDASSGAK.T1
*rpal_wt_anaer_auto_1_pellet_3.2285.2285.273.96770.7558521848.061846.051221.073.3%13K.LAQLWWQNIGDASSGAK.T2
*rpal_wt_anaer_auto_1_crude_3c.2099.2099.128.34610.5561261973.71975.19134.051.7%3K.TPQAAMDSLAAAQDSVLER.L1
*rpal_wt_anaer_auto_1_cleared_2c.2118.2118.286.07550.7484311975.271975.191236.077.1%19K.TPQAAMDSLAAAQDSVLER.L2
*rpal_wt_anaer_auto_1_pellet_full.1860.1860.390.29230.6135831977.221975.191178.065.6%10K.TPQAAMDSLAAAQDSVLER.L3
*rpal_wt_anaer_auto_1_cleared_3.2748.2748.235.31770.4765092346.122345.64144.041.0%1K.TPQAAMDSLAAAQDSVLERLEK.S2
*rpal_wt_anaer_auto_1_cleared_2.2790.2790.360.57040.4979532348.12345.641210.050.0%3K.TPQAAMDSLAAAQDSVLERLEK.S3
*rpal_wt_anaer_auto_1_pellet_2c.367.367.132.07010.4570181017.41019.17175.062.5%1K.SKVQGDCGPK.L1
*rpal_wt_anaer_auto_1_cleared_1.386.386.241.02540.3525081019.01019.171184.063.2%1K.SKVQGDCGPK.L2
*rpal_wt_anaer_auto_1_pellet_3c.450.450.128.45940.3544981502.491502.781104.059.1%4K.SKVQGDCGPKLNKK.E1
*rpal_wt_anaer_auto_1_cleared_2.402.402.242.80130.5590251502.951502.78181.057.7%1K.SKVQGDCGPKLNKK.E2
*rpal_wt_anaer_auto_1_pellet_4.996.996.249.56390.5623932645.032645.0110.052.5%2K.SKVQGDCGPKLNKKETAEYWYAK.A2
*rpal_wt_anaer_auto_1_cleared_2.853.853.257.24250.4527561642.861644.87136.081.8%1K.LNKKETAEYWYAK.A2
*rpal_wt_anaer_auto_1_cleared_4.854.854.137.07180.5487541643.851644.871104.065.0%4K.LNKKETAEYWYAK.A1
*rpal_wt_anaer_auto_1_cleared_3.962.962.138.48050.6095551161.561161.261138.084.6%7K.ETAEYWYAK.A1
*rpal_wt_anaer_auto_1_crude_2c.478.478.131.74730.4289281198.691199.311194.064.7%1K.AEKDGNIAPQR.K1
*rpal_wt_anaer_auto_1_crude_4.495.495.127.37830.1786411327.341327.48170.052.6%2K.AEKDGNIAPQRK.L1
*rpal_wt_anaer_auto_1_crude_2.950.950.363.0960.5360342164.12163.481249.050.0%1R.KLANEKPKGETVDYDTLIK.S3
*rpal_wt_anaer_auto_1_cleared_3.1045.1045.261.11070.6634062164.652163.48170.071.0%5R.KLANEKPKGETVDYDTLIK.S2
*rpal_wt_anaer_auto_1_crude_full.1039.1039.269.76420.7196462035.872035.31156.075.0%9K.LANEKPKGETVDYDTLIK.S2
*rpal_wt_anaer_auto_1_pellet_full.1042.1042.378.37830.6188742037.292035.31255.060.0%7K.LANEKPKGETVDYDTLIK.S3
*rpal_wt_anaer_auto_1_pellet_2c.1501.1501.130.5670.5032291253.731254.381174.070.6%1K.GETVDYDTLIK.S1
*rpal_wt_anaer_auto_1_pellet_2.749.749.125.00340.272807883.81884.0231208.066.7%1K.SWPATPPK.R1

URPA05314622588.0%392405536.8RPA0531 beta-ketothiolase, acetoacetyl-CoA thiolase 590894:592072 forward MW:40553
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_pellet_3.917.917.134.54120.3829981132.631132.261212.070.6%6M.SDDVVIVSAAR.T1
*rpal_wt_anaer_auto_1_pellet_2.2172.2172.363.9780.5447012343.612344.631141.047.9%6R.TAVGSFNGAFANTPAHELGAVAIK.A3
*rpal_wt_anaer_auto_1_pellet_3.2215.2215.255.34580.6800642343.82344.631209.052.4%12R.TAVGSFNGAFANTPAHELGAVAIK.A2
*rpal_wt_anaer_auto_1_pellet_full.3292.3292.275.51230.5895732708.62709.061248.056.5%17R.GGIDPAQVSEVIMGQILTAGQGQNPAR.Q2
*rpal_wt_anaer_auto_1_crude_full.3393.3393.3102.5720.6589412709.662709.061186.061.1%10R.GGIDPAQVSEVIMGQILTAGQGQNPAR.Q3
*rpal_wt_anaer_auto_1_pellet_full.2638.2638.255.58460.6051532583.072582.941130.054.3%5R.QASIAAGIPVDSPAWGINQLCGSGLR.S2
*rpal_wt_anaer_auto_1_pellet_full.2643.2643.359.71710.4749492584.252582.941196.055.4%1R.QASIAAGIPVDSPAWGINQLCGSGLR.S3
*rpal_wt_anaer_auto_1_pellet_3.2868.2868.364.70590.4423553682.813683.181215.054.3%2R.SVALGYQALMNGDSDIVIAGGQESMSMAPHAQYLR.G3
*rpal_wt_anaer_auto_1_crude_full.2441.2441.268.20940.562161308.471307.621254.090.0%9K.MGAVELVDTMLK.D2
*rpal_wt_anaer_auto_1_pellet_3c.4419.4419.237.07650.5046083628.113628.1180.024.6%4K.MGAVELVDTMLKDGLWDAFNGYHMGNTAENVAR.Q2
*rpal_wt_anaer_auto_1_pellet_2c.4350.4350.393.59070.5712713630.493628.11242.065.9%13K.MGAVELVDTMLKDGLWDAFNGYHMGNTAENVAR.Q3
*rpal_wt_anaer_auto_1_pellet_2c.2416.2416.264.67630.7261272338.572339.511110.061.1%5K.DGLWDAFNGYHMGNTAENVAR.Q2
*rpal_wt_anaer_auto_1_pellet_2.2277.2277.371.66080.5502922340.352339.511169.060.0%1K.DGLWDAFNGYHMGNTAENVAR.Q3
*rpal_wt_anaer_auto_1_pellet_3c.849.849.153.54780.6152331494.781494.56125.085.0%8R.DQQDEFAVASQQK.A1
*rpal_wt_anaer_auto_1_pellet_2.793.793.279.45240.640421496.471494.561251.087.5%5R.DQQDEFAVASQQK.A2
*rpal_wt_anaer_auto_1_pellet_2c.968.968.261.53220.666772093.262093.22173.064.7%2R.DQQDEFAVASQQKAEAAQK.A2
*rpal_wt_anaer_auto_1_crude_4.1113.1113.145.740.5586691546.31545.861204.076.2%4K.AGKFKDEIVPVTIK.T1
*rpal_wt_anaer_auto_1_pellet_1c.1268.1268.250.43180.541471546.631545.861237.064.0%3K.AGKFKDEIVPVTIK.T2
*rpal_wt_anaer_auto_1_pellet_1.1218.1218.364.45370.5054641547.491545.861152.065.2%2K.AGKFKDEIVPVTIK.T3
*rpal_wt_anaer_auto_1_crude_3.1243.1243.141.58260.4283381288.721289.561223.066.7%9K.FKDEIVPVTIK.T1
*rpal_wt_anaer_auto_1_crude_full.1224.1224.254.27190.6134891290.551289.561222.075.0%7K.FKDEIVPVTIK.T2
*rpal_wt_anaer_auto_1_crude_4.901.901.149.99050.6713041507.851507.641204.085.0%6R.KGDIVVDTDEYPR.H1
*rpal_wt_anaer_auto_1_pellet_1c.1020.1020.278.6260.7113521508.31507.641252.087.0%7R.KGDIVVDTDEYPR.H2
*rpal_wt_anaer_auto_1_pellet_full.859.859.363.96810.5659881509.631507.641110.069.2%1R.KGDIVVDTDEYPR.H3
*rpal_wt_anaer_auto_1_pellet_full.469.469.141.12420.5442631028.491029.211210.080.0%7R.HGATLEAMAK.L1
*rpal_wt_anaer_auto_1_pellet_1.533.533.260.53360.6075011029.211029.211180.084.2%3R.HGATLEAMAK.L2
*rpal_wt_anaer_auto_1_pellet_2c.2151.2151.389.55530.5672993092.283092.541115.067.0%7K.LKPAFEKDGTVTAGSASGINDGAAAVVLMTAK.Q3
*rpal_wt_anaer_auto_1_pellet_3c.2139.2139.263.52950.563283093.693092.54149.042.1%9K.LKPAFEKDGTVTAGSASGINDGAAAVVLMTAK.Q2
*rpal_wt_anaer_auto_1_pellet_3.2253.2253.258.5520.7089122278.82278.55160.054.5%1K.DGTVTAGSASGINDGAAAVVLMTAK.Q2
*rpal_wt_anaer_auto_1_pellet_1.427.427.236.09040.5129981340.831339.63135.052.4%1K.QAEKLGKKPLAR.I2
*rpal_wt_anaer_auto_1_pellet_1.409.409.231.07550.293971882.88883.1261194.066.7%1K.LGKKPLAR.I2
*rpal_wt_anaer_auto_1_crude_full.1056.1056.264.78050.5908991259.331257.431226.081.8%6R.IVSWGQAGVDPK.I2
*rpal_wt_anaer_auto_1_pellet_2c.850.850.133.24930.3991841086.691086.3167.068.8%7K.IMGSGPIPASR.A1
*rpal_wt_anaer_auto_1_pellet_1.837.837.244.79710.4152281087.751086.31236.065.0%5K.IMGSGPIPASR.A2
*rpal_wt_anaer_auto_1_pellet_3c.3774.3774.241.53690.4519913567.43567.92123.032.2%2K.AGWSVGDLDLIEANEAFAAQACAVNKDLGWDTSK.V2
*rpal_wt_anaer_auto_1_pellet_3.3696.3696.350.62230.3097153568.993567.921201.045.9%2K.AGWSVGDLDLIEANEAFAAQACAVNKDLGWDTSK.V3
*rpal_wt_anaer_auto_1_pellet_2c.2006.2006.376.42350.5652712735.562735.031220.058.7%1K.DLGWDTSKVNVNGGAIAIGHPIGASGAR.V3
*rpal_wt_anaer_auto_1_pellet_4.1933.1933.263.57470.7060392737.132735.031117.050.0%1K.DLGWDTSKVNVNGGAIAIGHPIGASGAR.V2
*rpal_wt_anaer_auto_1_pellet_full.1104.1104.268.5330.6007341831.61832.071246.069.4%4K.VNVNGGAIAIGHPIGASGAR.V2
*rpal_wt_anaer_auto_1_pellet_4.1224.1224.135.59860.4881121832.521832.07120.053.3%2K.VNVNGGAIAIGHPIGASGAR.V1
*rpal_wt_anaer_auto_1_pellet_full.1452.1452.261.55520.7386131312.161311.631236.085.0%6R.VLVTLLHEMQK.R2
*rpal_wt_anaer_auto_1_pellet_4.1622.1622.144.59440.6278231312.211311.631228.082.4%4R.VLVTLLHEMQK.R1
*rpal_wt_anaer_auto_1_pellet_full.1458.1458.345.91680.4071061314.461311.631228.059.5%1R.VLVTLLHEMQK.R3
*rpal_wt_anaer_auto_1_pellet_4.1456.1456.135.18540.5065791466.531467.82176.072.2%4R.VLVTLLHEMQKR.D1
*rpal_wt_anaer_auto_1_crude_2.1317.1317.255.38720.6113021468.681467.821200.072.7%5R.VLVTLLHEMQKR.D2
*rpal_wt_anaer_auto_1_pellet_full.1302.1302.346.4130.3266371469.081467.821180.056.4%1R.VLVTLLHEMQKR.D3

URPA3297109118887.8%450483067.7RPA3297 possible branched-chain amino acid transport system substrate-binding protein 3717617:3718969 reverse MW:48306
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_crude_2.2302.2302.3104.8190.7056822688.782688.971219.070.8%11K.GKEVVFGFNVPQSGAYADEGMDELK.A3
*rpal_wt_anaer_auto_1_cleared_full.2229.2229.284.18940.7433942689.392688.971162.062.2%7K.GKEVVFGFNVPQSGAYADEGMDELK.A2
*rpal_wt_anaer_auto_1_crude_full.2523.2523.266.82010.6970673462.13462.911112.042.9%13K.GKEVVFGFNVPQSGAYADEGMDELKAYQLAVK.H2
*rpal_wt_anaer_auto_1_pellet_3.2825.2825.3102.0960.5487143464.433462.911234.076.2%19K.GKEVVFGFNVPQSGAYADEGMDELKAYQLAVK.H3
*rpal_wt_anaer_auto_1_cleared_3c.2950.2950.349.04480.3290244673.554672.251131.051.2%2K.GKEVVFGFNVPQSGAYADEGMDELKAYQLAVKHLNGEGDGGMLK.T3
*rpal_wt_anaer_auto_1_crude_2c.2624.2624.258.84250.6347442504.962503.751144.056.1%4K.EVVFGFNVPQSGAYADEGMDELK.A2
*rpal_wt_anaer_auto_1_cleared_full.2838.2838.249.05520.6598243276.013277.681152.035.8%13K.EVVFGFNVPQSGAYADEGMDELKAYQLAVK.H2
*rpal_wt_anaer_auto_1_cleared_2c.3078.3078.367.3710.4171083276.933277.68181.063.3%12K.EVVFGFNVPQSGAYADEGMDELKAYQLAVK.H3
*rpal_wt_anaer_auto_1_cleared_1.803.803.244.6980.355582792.96792.9541171.084.6%5K.AYQLAVK.H2
*rpal_wt_anaer_auto_1_cleared_2.709.709.125.90640.141081795.09792.9541192.075.0%1K.AYQLAVK.H1
*rpal_wt_anaer_auto_1_cleared_3.1247.1247.245.48450.5838192003.262002.31164.050.0%1K.AYQLAVKHLNGEGDGGMLK.T2
*rpal_wt_anaer_auto_1_crude_3.640.640.146.40220.6207031227.761228.371116.075.0%17K.HLNGEGDGGMLK.T1
*rpal_wt_anaer_auto_1_pellet_1.557.557.256.93160.6732241228.441228.371185.077.3%10K.HLNGEGDGGMLK.T2
*rpal_wt_anaer_auto_1_cleared_full.608.608.362.70680.4697751228.851228.371248.068.3%2K.HLNGEGDGGMLK.T3
*rpal_wt_anaer_auto_1_cleared_3.1587.1587.380.62830.5852912739.382737.261192.061.8%2K.HLNGEGDGGMLKTMKPLALKGNGVLGK.K3
*rpal_wt_anaer_auto_1_crude_2c.743.743.126.01920.198273901.51902.1891240.066.7%1K.TMKPLALK.G1
*rpal_wt_anaer_auto_1_pellet_full.600.600.239.66740.320845902.62902.1891193.080.0%4K.TMKPLALK.G2
*rpal_wt_anaer_auto_1_pellet_2.1038.1038.256.04150.5682931527.521527.921147.070.4%13K.TMKPLALKGNGVLGK.K2
*rpal_wt_anaer_auto_1_crude_full.964.964.364.76820.4799931528.331527.921106.064.6%12K.TMKPLALKGNGVLGK.K3
*rpal_wt_anaer_auto_1_cleared_4.1092.1092.150.92010.4890031529.941527.92122.073.9%16K.TMKPLALKGNGVLGK.K1
*rpal_wt_anaer_auto_1_pellet_full.824.824.253.17720.5575151656.221656.091208.065.5%7K.TMKPLALKGNGVLGKK.V2
*rpal_wt_anaer_auto_1_cleared_4.912.912.149.72940.585081657.11656.091128.070.8%8K.TMKPLALKGNGVLGKK.V1
*rpal_wt_anaer_auto_1_cleared_full.894.894.360.62790.5229471658.971656.091232.065.4%8K.TMKPLALKGNGVLGKK.V3
*rpal_wt_anaer_auto_1_pellet_4.548.548.156.56290.7165991311.81311.481183.088.9%10K.KVTFVSGDTQTK.A1
*rpal_wt_anaer_auto_1_pellet_full.452.452.270.72430.7455271312.071311.481238.086.4%9K.KVTFVSGDTQTK.A2
*rpal_wt_anaer_auto_1_cleared_1.607.607.357.05430.5198291313.121311.481218.065.7%1K.KVTFVSGDTQTK.A3
*rpal_wt_anaer_auto_1_cleared_2c.678.678.283.0510.7260791854.671853.041233.080.0%10K.KVTFVSGDTQTKADQAR.A2
*rpal_wt_anaer_auto_1_crude_3c.672.672.145.59760.673181855.741853.041112.073.1%8K.KVTFVSGDTQTKADQAR.A1
*rpal_wt_anaer_auto_1_crude_1c.670.670.389.37020.6154031855.771853.041219.066.1%5K.KVTFVSGDTQTKADQAR.A3
*rpal_wt_anaer_auto_1_cleared_2c.713.713.148.63950.4689751182.81183.31187.083.3%12K.VTFVSGDTQTK.A1
*rpal_wt_anaer_auto_1_pellet_1c.787.787.250.06210.6148521184.841183.31248.075.0%7K.VTFVSGDTQTK.A2
*rpal_wt_anaer_auto_1_crude_4.736.736.136.97090.6453511725.021724.871148.064.0%4K.VTFVSGDTQTKADQAR.A1
*rpal_wt_anaer_auto_1_cleared_1.810.810.358.69780.5194931725.111724.871241.058.5%3K.VTFVSGDTQTKADQAR.A3
*rpal_wt_anaer_auto_1_crude_full.728.728.270.86470.708141725.761724.871197.082.1%9K.VTFVSGDTQTKADQAR.A2
*rpal_wt_anaer_auto_1_crude_4.4256.4256.347.02660.3331075043.215042.75170.051.1%1R.MIEKDGAIMITGGSSSAEAVAVQSLCQDVGVIFMAGLTHSNDTTGKDKR.A3
*rpal_wt_anaer_auto_1_pellet_4.4631.4631.358.19960.4741894543.14541.11226.048.9%6K.DGAIMITGGSSSAEAVAVQSLCQDVGVIFMAGLTHSNDTTGKDKR.A3
*rpal_wt_anaer_auto_1_pellet_1c.653.653.131.52150.152816616.1613.694112.0100.0%1R.AYGFR.H1
*rpal_wt_anaer_auto_1_cleared_2c.3030.3030.383.86540.492313209.863209.661248.061.2%6R.AYGFRHFFNAYMSGVALGPVLAEAYGKDR.A3
*rpal_wt_anaer_auto_1_cleared_full.2674.2674.290.02240.767472342.942343.711231.072.5%13R.HFFNAYMSGVALGPVLAEAYGK.D2
*rpal_wt_anaer_auto_1_crude_full.2381.2381.3111.6240.6709132615.922614.991158.070.3%29R.HFFNAYMSGVALGPVLAEAYGKDR.A3
*rpal_wt_anaer_auto_1_crude_4.2640.2640.290.97740.7494362617.042614.991157.068.2%19R.HFFNAYMSGVALGPVLAEAYGKDR.A2
*rpal_wt_anaer_auto_1_cleared_full.1899.1899.380.6510.583252934.352934.17158.059.2%5R.AAYHLTADYTWGWTQEESMKDATEK.Q3
*rpal_wt_anaer_auto_1_pellet_3c.2052.2052.257.70710.6449522936.712934.171182.050.0%6R.AAYHLTADYTWGWTQEESMKDATEK.Q2
*rpal_wt_anaer_auto_1_cleared_full.2013.2013.379.50670.5665553434.913433.741172.063.9%3R.AAYHLTADYTWGWTQEESMKDATEKQGWK.T3
*rpal_wt_anaer_auto_1_pellet_4.2146.2146.254.48320.6955873435.163433.741236.037.3%5R.AAYHLTADYTWGWTQEESMKDATEKQGWK.T2
*rpal_wt_anaer_auto_1_crude_3.3420.3420.374.58120.504733503.873503.01171.061.6%3K.AVRTPLGAADFSQYITPVLNSGADVLILNHYGK.D3
*rpal_wt_anaer_auto_1_crude_3c.4766.4766.345.27990.3213555178.625177.941210.052.4%2K.AVRTPLGAADFSQYITPVLNSGADVLILNHYGKDMINSLTQAVQFGLR.D3
*rpal_wt_anaer_auto_1_crude_3c.3686.3686.274.07760.7400423174.163176.6169.051.9%19R.TPLGAADFSQYITPVLNSGADVLILNHYGK.D2
*rpal_wt_anaer_auto_1_pellet_2c.3700.3700.3106.6480.6571263175.933176.6123.064.6%36R.TPLGAADFSQYITPVLNSGADVLILNHYGK.D3
*rpal_wt_anaer_auto_1_pellet_4.4911.4911.363.18640.4615664852.924851.54168.063.1%11R.TPLGAADFSQYITPVLNSGADVLILNHYGKDMINSLTQAVQFGLR.D3
*rpal_wt_anaer_auto_1_cleared_4.4612.4612.348.90640.3386045093.725094.8148.049.4%3R.TPLGAADFSQYITPVLNSGADVLILNHYGKDMINSLTQAVQFGLRDK.M3
*rpal_wt_anaer_auto_1_cleared_2.3207.3207.274.47030.6812581693.741693.961253.078.6%9K.DMINSLTQAVQFGLR.D2
*rpal_wt_anaer_auto_1_crude_3c.3271.3271.140.44820.6292811694.071693.961130.069.6%8K.DMINSLTQAVQFGLR.D1
*rpal_wt_anaer_auto_1_cleared_1c.3188.3188.384.29850.6371991694.21693.961239.064.6%3K.DMINSLTQAVQFGLR.D3
*rpal_wt_anaer_auto_1_crude_3.2953.2953.262.6810.663271937.511937.231198.070.0%10K.DMINSLTQAVQFGLRDK.M2
*rpal_wt_anaer_auto_1_cleared_full.2764.2764.348.54420.2513571938.091937.231160.050.0%3K.DMINSLTQAVQFGLRDK.M3
*rpal_wt_anaer_auto_1_cleared_4.3253.3253.230.05610.3671673108.853109.681164.030.0%1R.DKMANGKKFEIVVPLFSELMAQGAGDAIK.G2
*rpal_wt_anaer_auto_1_crude_3.3154.3154.364.94440.4697223110.993109.681249.051.4%4R.DKMANGKKFEIVVPLFSELMAQGAGDAIK.G3
*rpal_wt_anaer_auto_1_cleared_full.3065.3065.378.0740.4856512866.612866.421207.057.5%5K.MANGKKFEIVVPLFSELMAQGAGDAIK.G3
*rpal_wt_anaer_auto_1_cleared_full.3059.3059.254.22620.58632867.292866.421163.046.8%8K.MANGKKFEIVVPLFSELMAQGAGDAIK.G2
*rpal_wt_anaer_auto_1_crude_full.3313.3313.285.79950.6767072364.392364.811153.072.5%24K.KFEIVVPLFSELMAQGAGDAIK.G2
*rpal_wt_anaer_auto_1_cleared_1c.3588.3588.375.06120.516842367.732364.811175.058.2%11K.KFEIVVPLFSELMAQGAGDAIK.G3
*rpal_wt_anaer_auto_1_cleared_3c.4335.4335.250.09750.5636013656.643657.23132.036.7%5K.KFEIVVPLFSELMAQGAGDAIKGIYGTANWDWK.L2
*rpal_wt_anaer_auto_1_crude_2c.4253.4253.375.51960.5276423659.613657.231129.060.2%9K.KFEIVVPLFSELMAQGAGDAIKGIYGTANWDWK.L3
*rpal_wt_anaer_auto_1_pellet_full.3597.3597.399.21590.6300382236.442236.641185.067.6%9K.FEIVVPLFSELMAQGAGDAIK.G3
*rpal_wt_anaer_auto_1_pellet_2c.4110.4110.293.93860.6770082237.522236.641155.076.3%19K.FEIVVPLFSELMAQGAGDAIK.G2
*rpal_wt_anaer_auto_1_cleared_full.4165.4165.367.2860.3960423529.473529.05142.055.2%3K.FEIVVPLFSELMAQGAGDAIKGIYGTANWDWK.L3
*rpal_wt_anaer_auto_1_cleared_4.4610.4610.235.41790.4502893531.163529.05188.031.6%2K.FEIVVPLFSELMAQGAGDAIKGIYGTANWDWK.L2
*rpal_wt_anaer_auto_1_cleared_full.1679.1679.135.5540.604341310.461311.441201.070.6%10K.GIYGTANWDWK.L1
*rpal_wt_anaer_auto_1_cleared_1.1947.1947.260.63830.6790031311.831311.44171.084.2%6K.GIYGTANWDWK.L2
*rpal_wt_anaer_auto_1_cleared_full.2456.2456.264.30.6827092445.782446.681240.056.4%16K.GIYGTANWDWKLEDAATSAFTK.S2
*rpal_wt_anaer_auto_1_cleared_full.2473.2473.355.76440.531142447.022446.681227.041.8%1K.GIYGTANWDWKLEDAATSAFTK.S3
*rpal_wt_anaer_auto_1_pellet_2c.945.945.143.36450.596941153.661154.261228.083.3%12K.LEDAATSAFTK.S1
*rpal_wt_anaer_auto_1_crude_full.863.863.268.94370.6681611154.511154.261222.090.0%9K.LEDAATSAFTK.S2
*rpal_wt_anaer_auto_1_cleared_full.2958.2958.271.23070.7321373149.03150.5142.048.1%203K.SFGAAYGTPPSQAAQTCYVQAILYADAVER.A2
*rpal_wt_anaer_auto_1_cleared_3.4866.4866.362.74010.5432713150.413150.51251.041.6%52K.SFGAAYGTPPSQAAQTCYVQAILYADAVER.A3
*rpal_wt_anaer_auto_1_cleared_full.424.424.132.370.5254821.59821.9091202.083.3%7R.AGTFNPSK.V1
*rpal_wt_anaer_auto_1_cleared_1.460.460.231.15050.389429822.36821.909144.066.7%1R.AGTFNPSK.V2
*rpal_wt_anaer_auto_1_cleared_1c.3628.3628.381.50570.530072540.042540.84153.062.3%14R.AGTFNPSKVIAALEGFEFDGLGNGK.T3
*rpal_wt_anaer_auto_1_cleared_3.3615.3615.276.38930.6677532541.412540.841244.059.1%18R.AGTFNPSKVIAALEGFEFDGLGNGK.T2
*rpal_wt_anaer_auto_1_cleared_full.3294.3294.391.65770.5217923074.763074.461124.067.5%4R.AGTFNPSKVIAALEGFEFDGLGNGKTLYR.A3
*rpal_wt_anaer_auto_1_crude_3c.3677.3677.247.75630.4362423075.343074.461163.036.5%4R.AGTFNPSKVIAALEGFEFDGLGNGKTLYR.A2
*rpal_wt_anaer_auto_1_pellet_1.2609.2609.348.20530.4520021735.891737.951246.046.4%1K.VIAALEGFEFDGLGNGK.T3
*rpal_wt_anaer_auto_1_pellet_4.2681.2681.159.4940.5654941736.71737.95151.084.0%41K.VIAALEGFEFDGLGNGK.T1
*rpal_wt_anaer_auto_1_cleared_2.2652.2652.296.43780.7431031739.01737.951223.090.0%31K.VIAALEGFEFDGLGNGK.T2
*rpal_wt_anaer_auto_1_cleared_2c.2643.2643.263.24640.6785972270.942271.581187.057.9%4K.VIAALEGFEFDGLGNGKTLYR.A2
*rpal_wt_anaer_auto_1_cleared_2.2672.2672.365.63710.4795812274.512271.581189.053.1%3K.VIAALEGFEFDGLGNGKTLYR.A3
2rpal_wt_anaer_auto_1_pellet_1c.502.502.125.31710.187032553.37552.65119.0100.0%1K.TLYR.A1
*rpal_wt_anaer_auto_1_cleared_2.1147.1147.275.96610.6289361759.171759.041115.075.0%23R.AADHQCFKDVLVVQGK.E2
*rpal_wt_anaer_auto_1_pellet_1.1148.1148.385.17130.5951451761.771759.041255.068.8%15R.AADHQCFKDVLVVQGK.E3
*rpal_wt_anaer_auto_1_crude_4.1060.1060.151.76530.5370681761.871759.041180.083.3%23R.AADHQCFKDVLVVQGK.E1
*rpal_wt_anaer_auto_1_crude_3c.1594.1594.236.33660.4685583330.73329.8912.035.3%1R.AADHQCFKDVLVVQGKEKPKDKFDLLEVK.K2
*rpal_wt_anaer_auto_1_crude_3.1533.1533.362.67260.392953331.513329.89112.057.1%1R.AADHQCFKDVLVVQGKEKPKDKFDLLEVK.K3
*rpal_wt_anaer_auto_1_crude_3c.1412.1412.233.17210.4826473456.863458.0614.032.1%1R.AADHQCFKDVLVVQGKEKPKDKFDLLEVKK.I2
*rpal_wt_anaer_auto_1_cleared_2c.1516.1516.348.86190.335893458.523458.0614.053.8%2R.AADHQCFKDVLVVQGKEKPKDKFDLLEVKK.I3
*rpal_wt_anaer_auto_1_crude_full.956.956.142.46630.521841588.621589.871147.080.0%12K.EKPKDKFDLLEVK.K1
*rpal_wt_anaer_auto_1_cleared_1c.1101.1101.248.40390.4894321590.781589.87112.066.7%9K.EKPKDKFDLLEVK.K2
*rpal_wt_anaer_auto_1_pellet_4.871.871.146.03150.4631481718.011718.051145.071.4%13K.EKPKDKFDLLEVKK.I1
*rpal_wt_anaer_auto_1_crude_1c.800.800.252.21050.608011718.191718.0510.065.4%8K.EKPKDKFDLLEVKK.I2
*rpal_wt_anaer_auto_1_pellet_full.777.777.352.0310.4301631718.591718.051133.055.6%5K.EKPKDKFDLLEVKK.I3
*rpal_wt_anaer_auto_1_crude_2c.1071.1071.128.69150.2572541237.011235.471134.062.5%1K.DKFDLLEVKK.I1
*rpal_wt_anaer_auto_1_crude_full.1775.1775.267.6980.6399952293.72294.611203.064.1%9K.KIVPASQVTYDPSIFGGELGSK.D2
*rpal_wt_anaer_auto_1_crude_2.1867.1867.393.490.6788982296.732294.611243.064.3%8K.KIVPASQVTYDPSIFGGELGSK.D3
*rpal_wt_anaer_auto_1_crude_full.1578.1578.386.11980.6265692608.762608.951185.062.5%10K.KIVPASQVTYDPSIFGGELGSKDAK.A3
*rpal_wt_anaer_auto_1_cleared_4.1792.1792.252.23240.6328982609.732608.951192.045.5%10K.KIVPASQVTYDPSIFGGELGSKDAK.A2
*rpal_wt_anaer_auto_1_cleared_full.2078.2078.267.47480.7307222165.572166.441116.066.7%11K.IVPASQVTYDPSIFGGELGSK.D2
*rpal_wt_anaer_auto_1_pellet_full.1942.1942.388.09590.6822512167.672166.441166.064.1%6K.IVPASQVTYDPSIFGGELGSK.D3
*rpal_wt_anaer_auto_1_cleared_2.1997.1997.351.89950.3541942480.892480.78184.043.7%6K.IVPASQVTYDPSIFGGELGSKDAK.A3
*rpal_wt_anaer_auto_1_cleared_full.1848.1848.260.00010.6780772481.142480.781136.057.1%9K.IVPASQVTYDPSIFGGELGSKDAK.A2

URPA21648743786.5%547577955.5groEL2 chaperonin GroEL2, cpn60 2437219:2438862 reverse MW:57796
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_pellet_1c.1880.1880.247.10320.4359731402.421400.731206.062.5%1R.MLRGVDILANAVK.V2
*rpal_wt_anaer_auto_1_pellet_full.1208.1208.136.59430.39587999.481000.18176.073.3%5R.GVDILANAVK.V1
*rpal_wt_anaer_auto_1_pellet_1.1368.1368.248.73530.5538411000.981000.181248.073.7%2R.GVDILANAVK.V2
*rpal_wt_anaer_auto_1_pellet_1c.2390.2390.233.96920.4861291596.041595.921116.044.8%1R.GVDILANAVKVTLGPK.G2
rpal_wt_anaer_auto_1_pellet_1.450.450.129.13780.212068617.17614.7631220.080.0%5K.VTLGPK.G11
*rpal_wt_anaer_auto_1_pellet_1c.580.580.137.2210.245267687.71687.8151183.0100.0%1R.NVVLDK.S1
rpal_wt_anaer_auto_1_pellet_1.442.442.127.53160.245325635.65634.71315.080.0%1K.SFGAPR.I11
rpal_wt_anaer_auto_1_crude_2c.623.623.132.28380.3613641032.331032.231240.062.5%2R.ITKDGVTVAK.D11
*rpal_wt_anaer_auto_1_pellet_3c.2080.2080.261.42680.6755083024.183025.471107.045.8%4R.ITKDGVTVAKDIELDDKFENMGAQMVR.E2
*rpal_wt_anaer_auto_1_pellet_full.1794.1794.392.14760.5845253027.253025.471240.069.4%6R.ITKDGVTVAKDIELDDKFENMGAQMVR.E3
rpal_wt_anaer_auto_1_pellet_2.388.388.126.08260.320179690.48689.7871132.081.8%1K.DGVTVAK.D11
*rpal_wt_anaer_auto_1_pellet_2c.2301.2301.274.67430.6881482683.382683.04199.055.8%3K.DGVTVAKDIELDDKFENMGAQMVR.E2
*rpal_wt_anaer_auto_1_pellet_3.2213.2213.387.0520.6149262684.272683.041191.060.9%6K.DGVTVAKDIELDDKFENMGAQMVR.E3
*rpal_wt_anaer_auto_1_pellet_3.2050.2050.276.00140.6294912013.132012.271230.073.3%8K.DIELDDKFENMGAQMVR.E2
*rpal_wt_anaer_auto_1_pellet_full.1819.1819.364.43540.5313632013.72012.271206.054.5%1K.DIELDDKFENMGAQMVR.E3
*rpal_wt_anaer_auto_1_pellet_full.1910.1910.272.53540.5990051989.811990.181246.061.1%6K.SADAAGDGTTTATVLAQAIVR.E2
*rpal_wt_anaer_auto_1_pellet_1.2141.2141.346.070.2952311990.431990.18170.041.8%1K.SADAAGDGTTTATVLAQAIVR.E3
*rpal_wt_anaer_auto_1_pellet_3c.2205.2205.126.39160.4108391990.51990.181196.048.4%2K.SADAAGDGTTTATVLAQAIVR.E1
rpal_wt_anaer_auto_1_pellet_1.1338.1338.260.26520.6950961217.971218.481183.072.7%6K.AVAAGMNPMDLK.R22
rpal_wt_anaer_auto_1_cleared_2c.1348.1348.142.57860.6008611218.061218.481188.072.2%12K.AVAAGMNPMDLK.R11
rpal_wt_anaer_auto_1_pellet_2c.1137.1137.130.85180.4090751373.71374.67160.068.4%4K.AVAAGMNPMDLKR.G11
rpal_wt_anaer_auto_1_pellet_full.973.973.347.99790.4437591374.31374.671242.051.2%1K.AVAAGMNPMDLKR.G33
rpal_wt_anaer_auto_1_pellet_full.977.977.257.91240.6230131375.691374.671177.078.3%9K.AVAAGMNPMDLKR.G22
*rpal_wt_anaer_auto_1_pellet_1c.3277.3277.255.28130.6237931671.821668.981234.062.1%4K.RGIDLAVEAVVADLVK.N2
*rpal_wt_anaer_auto_1_pellet_3c.3944.3944.150.76730.6109761512.611512.791221.078.3%10R.GIDLAVEAVVADLVK.N1
*rpal_wt_anaer_auto_1_pellet_2.3834.3834.277.27420.6172591513.361512.791237.077.8%31R.GIDLAVEAVVADLVK.N2
*rpal_wt_anaer_auto_1_pellet_1.3669.3669.380.29180.5561191514.421512.791253.071.4%2R.GIDLAVEAVVADLVK.N3
*rpal_wt_anaer_auto_1_pellet_4.1321.1321.234.4360.4323472750.622747.9814.031.2%1K.NSKKVTSNDEIAQVGTISANGDAEIGK.F2
*rpal_wt_anaer_auto_1_pellet_2c.1543.1543.261.97460.6296732418.822418.621240.057.1%2K.KVTSNDEIAQVGTISANGDAEIGK.F2
*rpal_wt_anaer_auto_1_pellet_3c.3269.3269.235.47350.4411973196.493195.58173.034.5%1K.KVTSNDEIAQVGTISANGDAEIGKFLADAMK.K2
*rpal_wt_anaer_auto_1_pellet_3.3181.3181.377.14820.5059313198.353195.581115.057.5%5K.KVTSNDEIAQVGTISANGDAEIGKFLADAMK.K3
*rpal_wt_anaer_auto_1_pellet_2c.3056.3056.351.94310.2985153323.753323.7510.052.3%2K.KVTSNDEIAQVGTISANGDAEIGKFLADAMKK.V3
*rpal_wt_anaer_auto_1_pellet_full.543.543.238.88540.429879924.06924.1521152.075.0%2K.FLADAMKK.V2
*rpal_wt_anaer_auto_1_pellet_3.565.565.131.5990.439846924.32924.1521212.071.4%2K.FLADAMKK.V1
*rpal_wt_anaer_auto_1_pellet_1c.904.904.260.17450.6161911473.51473.671236.073.1%1K.KVGNEGVITVEEAK.S2
*rpal_wt_anaer_auto_1_pellet_4.841.841.140.85540.521371473.651473.671124.066.7%4K.KVGNEGVITVEEAK.S1
*rpal_wt_anaer_auto_1_crude_2c.934.934.134.60360.5675021344.611345.491194.070.0%9K.VGNEGVITVEEAK.S1
*rpal_wt_anaer_auto_1_pellet_1.982.982.253.67150.6269061347.71345.491193.073.9%8K.VGNEGVITVEEAK.S2
*rpal_wt_anaer_auto_1_pellet_4.2889.2889.134.05140.2677691869.471869.061148.060.0%5K.SLETELDVVEGMQFDR.G1
*rpal_wt_anaer_auto_1_pellet_full.2503.2503.248.13350.2117421870.931869.061247.053.6%1K.SLETELDVVEGMQFDR.G2
*rpal_wt_anaer_auto_1_crude_3c.1551.1551.143.04490.5829031474.781475.641185.075.0%9R.GYISPYFVTNADK.M1
*rpal_wt_anaer_auto_1_pellet_full.1443.1443.263.35440.6968261475.981475.641211.075.0%7R.GYISPYFVTNADK.M2
*rpal_wt_anaer_auto_1_pellet_1c.1722.1722.253.58160.6672011764.161763.031145.063.0%3R.GYISPYFVTNADKMR.V2
*rpal_wt_anaer_auto_1_pellet_1c.2267.2267.257.95390.5678391568.911569.751255.066.7%3R.VEFDDAYILINEK.K2
*rpal_wt_anaer_auto_1_crude_3c.2308.2308.145.42570.5819861569.661569.751123.080.0%16R.VEFDDAYILINEK.K1
*rpal_wt_anaer_auto_1_pellet_3c.1999.1999.129.16940.4871411698.331697.93134.059.1%2R.VEFDDAYILINEKK.L1
*rpal_wt_anaer_auto_1_pellet_1c.1958.1958.240.11690.5136741699.251697.931172.056.0%3R.VEFDDAYILINEKK.L2
*rpal_wt_anaer_auto_1_pellet_3c.5352.5352.359.17510.4902084372.044370.131112.052.3%2K.KLSNLNELLPLLEAVVQTGKPLVIVAEDVEGEALATLVVNR.L3
*rpal_wt_anaer_auto_1_pellet_1.835.835.236.11040.4278931187.441188.371244.052.2%1K.VAAVKAPGFGDR.R2
*rpal_wt_anaer_auto_1_pellet_full.2815.2815.280.8660.721122385.92386.821221.062.5%6R.KAMLQDIAILTGGQAISEDLGIK.M2
*rpal_wt_anaer_auto_1_pellet_full.3173.3173.277.89240.5897792259.162258.641241.064.1%13K.AMLQDIAILTGGQAISEDLGIK.M2
*rpal_wt_anaer_auto_1_crude_2c.1703.1703.137.30360.5453311291.831292.571144.076.5%10K.MENVTLQMLGR.A1
*rpal_wt_anaer_auto_1_crude_1c.1639.1639.270.45380.6601761293.521292.571255.085.0%9K.MENVTLQMLGR.A2
*rpal_wt_anaer_auto_1_crude_3c.761.761.136.8750.5879861820.921819.13115.068.0%2K.KVMIDKENTTIVNGAGK.K1
*rpal_wt_anaer_auto_1_pellet_3.787.787.250.33850.6431881821.391819.131136.063.3%1K.KVMIDKENTTIVNGAGK.K2
*rpal_wt_anaer_auto_1_pellet_2c.742.742.250.54830.5056151949.51947.3115.057.6%1K.KVMIDKENTTIVNGAGKK.A2
*rpal_wt_anaer_auto_1_pellet_3c.939.939.134.84550.5118251690.611690.96144.065.2%2K.VMIDKENTTIVNGAGK.K1
*rpal_wt_anaer_auto_1_pellet_full.828.828.268.42580.5722051691.021690.961211.075.0%2K.VMIDKENTTIVNGAGK.K2
*rpal_wt_anaer_auto_1_pellet_full.720.720.249.69910.510141818.611819.13196.061.3%2K.VMIDKENTTIVNGAGKK.A2
*rpal_wt_anaer_auto_1_pellet_1.824.824.353.6560.3819181819.621819.131191.054.0%1K.VMIDKENTTIVNGAGKK.A3
*rpal_wt_anaer_auto_1_pellet_full.332.332.126.25580.0961349558.54558.6991177.087.5%1R.VAQIK.A1
*rpal_wt_anaer_auto_1_pellet_2.670.670.239.11090.5925941427.981428.4510.066.7%1K.AQIEETTSDYDR.E2
*rpal_wt_anaer_auto_1_crude_3c.691.691.126.41760.4157041685.141685.74169.047.6%1K.AQIEETTSDYDREK.L1
*rpal_wt_anaer_auto_1_pellet_2.590.590.250.39540.5802061686.351685.741174.064.0%4K.AQIEETTSDYDREK.L2
*rpal_wt_anaer_auto_1_pellet_3.840.840.234.38490.4016382212.922212.341132.041.9%1K.AQIEETTSDYDREKLQER.L2
rpal_wt_anaer_auto_1_pellet_1.914.914.245.9270.541744856.12856.0571242.082.4%1K.LAGGVAVIR.V22
rpal_wt_anaer_auto_1_membrane_3.531.531.133.27910.394398988.77989.1141176.073.3%5R.VGGATEVEVK.E11
rpal_wt_anaer_auto_1_cleared_1.608.608.230.95430.311033988.8989.1141100.057.9%1R.VGGATEVEVK.E22
*rpal_wt_anaer_auto_1_pellet_1.495.495.235.98050.4346131274.261274.421153.057.1%1R.VGGATEVEVKER.K2
*rpal_wt_anaer_auto_1_crude_4.586.586.125.5210.4315431415.91415.57168.055.6%1R.KDRVDDAMHATR.A1
*rpal_wt_anaer_auto_1_pellet_2.1976.1976.269.46910.6079471607.881608.881212.077.4%10R.AAVEEGIVPGGGVALLR.A2
*rpal_wt_anaer_auto_1_pellet_1.2024.2024.361.09250.4664731608.931608.881240.060.0%1R.AAVEEGIVPGGGVALLR.A3
*rpal_wt_anaer_auto_1_membrane_3c.2306.2306.140.50250.4540261611.21608.881146.066.7%15R.AAVEEGIVPGGGVALLR.A1
*rpal_wt_anaer_auto_1_pellet_2c.485.485.133.69190.336588973.93974.1461178.071.4%3R.ASEQLKGLK.T1
*rpal_wt_anaer_auto_1_pellet_1c.588.588.235.29240.276609975.41974.1461137.058.8%1R.ASEQLKGLK.T2
*rpal_wt_anaer_auto_1_pellet_full.435.435.230.84560.29767928.44930.09615.060.0%1K.TGVEIVRR.A2
*rpal_wt_anaer_auto_1_pellet_2.1996.1996.369.42290.502312611.262610.841239.058.5%1K.VLEKEQYAFGFDSQSGEYGDLVK.K3
*rpal_wt_anaer_auto_1_pellet_4.2061.2061.265.2590.7316282612.332610.841170.057.5%1K.VLEKEQYAFGFDSQSGEYGDLVK.K2
*rpal_wt_anaer_auto_1_pellet_full.1599.1599.378.3130.5362032738.172739.011180.061.4%4K.VLEKEQYAFGFDSQSGEYGDLVKK.G3
*rpal_wt_anaer_auto_1_pellet_2c.1880.1880.253.1860.6518912739.262739.011227.047.6%1K.VLEKEQYAFGFDSQSGEYGDLVKK.G2
*rpal_wt_anaer_auto_1_crude_1c.626.626.130.06950.358366743.62743.8791242.081.8%4K.GIIDPTK.V1
*rpal_wt_anaer_auto_1_pellet_full.999.999.234.78190.4638021098.351098.331160.063.2%1K.GIIDPTKVVR.T2
*rpal_wt_anaer_auto_1_crude_full.4528.4528.278.76670.7666172541.372542.011223.060.5%24R.TAIQNAASVAALLITTEAMIAELPK.K2
*rpal_wt_anaer_auto_1_pellet_full.4472.4472.381.30060.6440362541.562542.011220.053.4%69R.TAIQNAASVAALLITTEAMIAELPK.K3
*rpal_wt_anaer_auto_1_pellet_full.4037.4037.377.33670.5483854233.014232.96142.053.9%8R.TAIQNAASVAALLITTEAMIAELPKKGGAGAGGMPPGGGMGGMDF.-3
*rpal_wt_anaer_auto_1_pellet_3c.1700.1700.129.42510.5248381710.441709.971168.053.3%2K.KGGAGAGGMPPGGGMGGMDF.-1
*rpal_wt_anaer_auto_1_pellet_2.1612.1612.234.79310.5258281711.761709.971194.041.7%1K.KGGAGAGGMPPGGGMGGMDF.-2
Similarities: RPA1140(12:75)

URPA20477646186.5%334364739.0dctP1 TrapT family, dctP subunit, C4-dicarboxylate periplasmic binding protein 2305049:2306053 forward MW:36473
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_crude_full.715.715.248.21280.4849581197.571197.381187.070.0%7K.FSHVVAPNTPK.G2
*rpal_wt_anaer_auto_1_cleared_1c.731.731.358.11420.4311221198.861197.381171.073.5%3K.FSHVVAPNTPK.G3
*rpal_wt_anaer_auto_1_cleared_2c.709.709.143.39180.5214421199.151197.381236.072.2%14K.FSHVVAPNTPK.G1
*rpal_wt_anaer_auto_1_cleared_3c.1015.1015.146.19990.3718751438.971438.691184.078.9%9K.GMAADKFKELAEK.Y1
*rpal_wt_anaer_auto_1_cleared_full.983.983.256.98910.5887461439.571438.691161.073.9%6K.GMAADKFKELAEK.Y2
*rpal_wt_anaer_auto_1_cleared_1c.1043.1043.352.06070.3606941440.891438.691154.068.4%3K.GMAADKFKELAEK.Y3
*rpal_wt_anaer_auto_1_cleared_full.1551.1551.265.60930.6954032003.042003.2810.067.7%6K.GMAADKFKELAEKYTDGK.V2
*rpal_wt_anaer_auto_1_crude_full.1456.1456.382.20930.6492492005.032003.281199.070.9%4K.GMAADKFKELAEKYTDGK.V3
*rpal_wt_anaer_auto_1_cleared_2c.1691.1691.248.35860.5120952231.442230.5912.057.1%3K.GMAADKFKELAEKYTDGKVK.V2
*rpal_wt_anaer_auto_1_crude_2.1555.1555.345.55820.3181182232.162230.5917.041.9%2K.GMAADKFKELAEKYTDGKVK.V3
*rpal_wt_anaer_auto_1_cleared_3c.2716.2716.368.57120.5264574456.534455.17189.059.3%3K.YTDGKVKVEVYPNSQLFKDKEELDALKLGAVQMLAPSISK.F3
*rpal_wt_anaer_auto_1_cleared_3c.1507.1507.126.78150.4554861553.091551.831101.055.0%1K.VKVEVYPNSQLFK.D1
*rpal_wt_anaer_auto_1_crude_2.1718.1718.356.43150.4493152594.692593.981216.055.4%1K.VKVEVYPNSQLFKDKEELDALK.L3
*rpal_wt_anaer_auto_1_pellet_4.1834.1834.258.80070.6236252595.32593.981130.055.3%11K.VKVEVYPNSQLFKDKEELDALK.L2
*rpal_wt_anaer_auto_1_crude_4.2756.2756.375.10960.4748463893.273890.581207.059.8%11K.VKVEVYPNSQLFKDKEELDALKLGAVQMLAPSISK.F3
*rpal_wt_anaer_auto_1_crude_3.1770.1770.245.3190.6002742366.452366.6716.052.9%5K.VEVYPNSQLFKDKEELDALK.L2
*rpal_wt_anaer_auto_1_cleared_1c.1900.1900.348.01960.3787252368.672366.671152.047.5%1K.VEVYPNSQLFKDKEELDALK.L3
*rpal_wt_anaer_auto_1_cleared_full.2684.2684.381.76180.509773662.823663.271167.058.8%8K.VEVYPNSQLFKDKEELDALKLGAVQMLAPSISK.F3
*rpal_wt_anaer_auto_1_pellet_2c.673.673.128.2650.3255621062.051061.181195.064.3%1K.DKEELDALK.L1
*rpal_wt_anaer_auto_1_pellet_1c.2460.2460.356.02240.4126062358.372357.771184.050.7%1K.DKEELDALKLGAVQMLAPSISK.F3
*rpal_wt_anaer_auto_1_crude_3.2388.2388.279.05780.6562642358.832357.771187.062.5%8K.DKEELDALKLGAVQMLAPSISK.F2
*rpal_wt_anaer_auto_1_crude_full.1484.1484.143.19160.3117411314.551315.621228.078.9%8K.LGAVQMLAPSISK.F1
*rpal_wt_anaer_auto_1_cleared_1.1812.1812.267.6480.4974591315.711315.621254.082.6%8K.LGAVQMLAPSISK.F2
*rpal_wt_anaer_auto_1_crude_2c.4013.4013.288.42370.718372779.912779.251240.063.4%26K.FGPAGVKEFEVFDLPYILPDIAALR.K2
*rpal_wt_anaer_auto_1_pellet_2c.4203.4203.371.31180.4341922780.932779.251220.056.7%12K.FGPAGVKEFEVFDLPYILPDIAALR.K3
*rpal_wt_anaer_auto_1_cleared_full.3390.3390.269.01070.6344232906.952907.431210.052.3%14K.FGPAGVKEFEVFDLPYILPDIAALRK.V2
*rpal_wt_anaer_auto_1_crude_2c.3593.3593.395.26380.5956112907.832907.431241.069.1%15K.FGPAGVKEFEVFDLPYILPDIAALRK.V3
*rpal_wt_anaer_auto_1_cleared_2c.4164.4164.255.71310.6665542123.332122.471189.059.4%7K.EFEVFDLPYILPDIAALR.K2
*rpal_wt_anaer_auto_1_cleared_1c.4123.4123.353.14320.4304222125.222122.471187.046.4%1K.EFEVFDLPYILPDIAALR.K3
*rpal_wt_anaer_auto_1_cleared_3.3748.3748.255.47730.6364462249.112250.641205.055.9%8K.EFEVFDLPYILPDIAALRK.V2
*rpal_wt_anaer_auto_1_cleared_1c.3728.3728.358.39120.4827952251.522250.641118.052.6%5K.EFEVFDLPYILPDIAALRK.V3
*rpal_wt_anaer_auto_1_crude_full.494.494.135.16410.353787970.64971.1461109.073.3%6R.KVTNGPVGAK.L1
*rpal_wt_anaer_auto_1_cleared_full.386.386.242.19420.450121971.45971.1461176.068.4%2R.KVTNGPVGAK.L2
*rpal_wt_anaer_auto_1_cleared_1c.433.433.125.90390.493547842.5842.9711112.064.3%2K.VTNGPVGAK.L1
*rpal_wt_anaer_auto_1_cleared_1c.463.463.129.69920.360309575.39575.6831249.087.5%5K.LLDSK.G1
*rpal_wt_anaer_auto_1_crude_full.1924.1924.147.76060.6766461459.431460.65131.084.2%12K.GMTGLAYWDNGFK.I1
*rpal_wt_anaer_auto_1_cleared_2.2147.2147.260.21950.7174041461.471460.651227.078.3%10K.GMTGLAYWDNGFK.I2
*rpal_wt_anaer_auto_1_crude_3.2100.2100.241.99340.5153952235.842233.6214.051.5%2K.GMTGLAYWDNGFKIMSANKK.L2
*rpal_wt_anaer_auto_1_cleared_2c.759.759.135.20420.4883911076.771077.271252.073.3%1K.KLIAPEDYK.G1
*rpal_wt_anaer_auto_1_cleared_full.813.813.129.03740.361513948.5949.0921197.076.9%6K.LIAPEDYK.G1
*rpal_wt_anaer_auto_1_cleared_1.930.930.233.57950.397132950.16949.0921216.060.0%3K.LIAPEDYK.G2
*rpal_wt_anaer_auto_1_pellet_full.718.718.138.49260.388004848.57848.9781139.0100.0%9K.VLDAQFR.A1
*rpal_wt_anaer_auto_1_pellet_1.822.822.246.60530.390278850.5848.9781203.084.6%7K.VLDAQFR.A2
*rpal_wt_anaer_auto_1_crude_2c.3833.3833.365.74880.4199333973.263970.451137.051.6%5R.ALGAIPQVLAFSEVYQALQTGVVDGQENTPSNMYTQK.M3
*rpal_wt_anaer_auto_1_cleared_1c.414.414.135.74540.352468771.46771.9151250.090.0%3K.MHEVQK.Y1
*rpal_wt_anaer_auto_1_cleared_2c.1570.1570.255.35920.6479742013.712014.291188.059.4%3K.YTTVTNHGYIGYAVIVNK.Q2
*rpal_wt_anaer_auto_1_crude_1.1388.1388.353.4610.4093262015.022014.29162.054.4%1K.YTTVTNHGYIGYAVIVNK.Q3
*rpal_wt_anaer_auto_1_cleared_3.2778.2778.357.27880.4371253300.063299.711107.047.4%1K.YTTVTNHGYIGYAVIVNKQFWDGIPADVR.A3
*rpal_wt_anaer_auto_1_crude_full.1706.1706.246.50250.6037631306.01304.451144.075.0%10K.QFWDGIPADVR.A2
*rpal_wt_anaer_auto_1_cleared_full.353.353.126.7990.0819881574.58574.6551118.087.5%1R.AQLDK.A1
*rpal_wt_anaer_auto_1_cleared_3.1710.1710.382.25340.535243486.233485.881211.062.8%4R.AQLDKAMKEATEFGNSQSQKENAEALEEMKK.S3
*rpal_wt_anaer_auto_1_cleared_3c.1300.1300.265.36920.7363882802.062802.071248.048.9%3K.AMKEATEFGNSQSQKENAEALEEMK.K2
*rpal_wt_anaer_auto_1_cleared_2c.1163.1163.373.82780.5857982930.42930.241212.059.5%8K.AMKEATEFGNSQSQKENAEALEEMKK.S3
*rpal_wt_anaer_auto_1_crude_full.1055.1055.248.33460.492072930.92930.24119.042.6%6K.AMKEATEFGNSQSQKENAEALEEMKK.S2
*rpal_wt_anaer_auto_1_cleared_3.1280.1280.251.07650.6315212470.672471.621154.048.7%2K.EATEFGNSQSQKENAEALEEMK.K2
*rpal_wt_anaer_auto_1_cleared_3.1093.1093.247.39130.5988652598.362599.791144.048.8%8K.EATEFGNSQSQKENAEALEEMKK.S2
*rpal_wt_anaer_auto_1_cleared_full.1081.1081.357.27130.3491442600.912599.791176.054.3%7K.EATEFGNSQSQKENAEALEEMKK.S3
*rpal_wt_anaer_auto_1_cleared_3.1473.1473.247.32890.4735862131.072131.51231.048.4%1K.KSGKTEIITLTPEQNLAMR.K2
*rpal_wt_anaer_auto_1_cleared_full.1618.1618.260.77670.5492752002.942003.331248.065.6%9K.SGKTEIITLTPEQNLAMR.K2
*rpal_wt_anaer_auto_1_cleared_full.1608.1608.362.64290.4225222005.212003.331232.058.6%3K.SGKTEIITLTPEQNLAMR.K3
*rpal_wt_anaer_auto_1_cleared_3.1400.1400.264.03930.5792042131.382131.51211.063.6%8K.SGKTEIITLTPEQNLAMRK.A2
*rpal_wt_anaer_auto_1_cleared_full.1369.1369.390.86350.6364072134.192131.51206.062.3%5K.SGKTEIITLTPEQNLAMRK.A3
*rpal_wt_anaer_auto_1_cleared_full.1849.1849.248.44590.176581730.961731.021201.059.3%8K.TEIITLTPEQNLAMR.K2
*rpal_wt_anaer_auto_1_crude_3c.1922.1922.131.79390.5092141731.591731.02112.060.9%4K.TEIITLTPEQNLAMR.K1
*rpal_wt_anaer_auto_1_crude_2c.1574.1574.244.26540.4805361859.241859.21196.058.6%9K.TEIITLTPEQNLAMRK.A2
*rpal_wt_anaer_auto_1_cleared_1c.1660.1660.345.12190.2114961860.031859.21118.047.2%1K.TEIITLTPEQNLAMRK.A3
*rpal_wt_anaer_auto_1_cleared_2c.826.826.150.27240.5782871378.681379.58197.080.0%5R.KAMAPVYDDVGGR.V1
*rpal_wt_anaer_auto_1_cleared_1.911.911.375.76280.5494771379.41379.581214.069.8%1R.KAMAPVYDDVGGR.V3
*rpal_wt_anaer_auto_1_cleared_1c.845.845.259.84750.6326931380.571379.581188.070.8%5R.KAMAPVYDDVGGR.V2
*rpal_wt_anaer_auto_1_cleared_full.969.969.135.40650.5719911250.531251.411214.072.2%8K.AMAPVYDDVGGR.V1
*rpal_wt_anaer_auto_1_cleared_full.968.968.259.32010.6361171251.111251.41153.073.9%8K.AMAPVYDDVGGR.V2
*rpal_wt_anaer_auto_1_crude_3.1753.1753.128.70730.267907963.45963.1621177.075.0%3K.ALIEEFIK.E1
*rpal_wt_anaer_auto_1_cleared_1c.1888.1888.249.44530.476199964.13963.1621177.086.7%6K.ALIEEFIK.E2
*rpal_wt_anaer_auto_1_pellet_4.1857.1857.158.54860.6955421676.121676.911133.087.0%13K.ALIEEFIKESGGGPTK.-1
*rpal_wt_anaer_auto_1_crude_1c.1765.1765.269.37080.6681011676.551676.911238.079.3%15K.ALIEEFIKESGGGPTK.-2
*rpal_wt_anaer_auto_1_crude_full.1659.1659.373.22030.6177481677.231676.911218.066.7%10K.ALIEEFIKESGGGPTK.-3

URPA32527456886.1%396433375.8tufA, EF-Tu elongation factor Tu 3659926:3661116 reverse MW:43337
URPA32837456886.1%396433375.8tuf, EF-Tu elongation factor Tu 3702061:3703251 reverse MW:43337
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
rpal_wt_anaer_auto_1_crude_3c.659.659.133.87850.4072731815.361815.071144.061.5%6R.TKPHCNIGTIGHVDHGK.T1
rpal_wt_anaer_auto_1_crude_3.653.653.256.47270.6828171815.661815.07138.066.7%5R.TKPHCNIGTIGHVDHGK.T2
rpal_wt_anaer_auto_1_crude_3.990.990.361.06080.4713582702.862702.11178.055.3%3R.TKPHCNIGTIGHVDHGKTSLTAAITK.V3
rpal_wt_anaer_auto_1_crude_4.1035.1035.243.64760.5857712703.422702.111144.039.1%5R.TKPHCNIGTIGHVDHGKTSLTAAITK.V2
rpal_wt_anaer_auto_1_crude_2c.868.868.132.77440.411864906.89906.068113.078.6%8K.TSLTAAITK.V1
rpal_wt_anaer_auto_1_cleared_1.982.982.246.9280.618597906.99906.0681198.082.4%1K.TSLTAAITK.V2
rpal_wt_anaer_auto_1_cleared_1.1326.1326.386.89450.6612081820.911819.971208.072.5%5R.GITISTAHVEYETQNR.H3
rpal_wt_anaer_auto_1_crude_2c.1133.1133.267.10730.7169881821.651819.971246.075.9%12R.GITISTAHVEYETQNR.H2
rpal_wt_anaer_auto_1_crude_3c.1116.1116.156.42530.7203171822.711819.97134.079.2%15R.GITISTAHVEYETQNR.H1
rpal_wt_anaer_auto_1_crude_3.1245.1245.374.93430.587833513.43513.831170.060.3%4R.GITISTAHVEYETQNRHYAHVDCPGHADYVK.N3
rpal_wt_anaer_auto_1_crude_3c.712.712.155.96130.7104821711.721712.891216.083.3%10R.HYAHVDCPGHADYVK.N1
rpal_wt_anaer_auto_1_cleared_2.708.708.267.78070.7095011713.331712.891235.075.0%9R.HYAHVDCPGHADYVK.N2
rpal_wt_anaer_auto_1_pellet_full.604.604.397.73540.6600531714.061712.891245.084.8%5R.HYAHVDCPGHADYVK.N3
rpal_wt_anaer_auto_1_cleared_4.3369.3369.244.1630.5706612719.772717.1619.038.8%21K.NMITGAAQMDGAILVVSAADGPMPQTR.E2
rpal_wt_anaer_auto_1_cleared_full.669.669.135.90050.441169851.66852.0251204.091.7%10R.EHILLAR.Q1
rpal_wt_anaer_auto_1_pellet_1.617.617.237.68840.541283853.69852.025151.071.4%7R.EHILLAR.Q2
rpal_wt_anaer_auto_1_crude_4.2715.2715.139.71410.5967751384.21384.71120.078.9%13R.QVGVPALVVFLNK.C1
rpal_wt_anaer_auto_1_crude_full.2474.2474.249.06620.5326191386.271384.71184.066.7%22R.QVGVPALVVFLNK.C2
rpal_wt_anaer_auto_1_cleared_full.4176.4176.372.50720.469173503.33502.151165.056.2%2R.QVGVPALVVFLNKCDMVDDPELLELVEMEVR.E3
rpal_wt_anaer_auto_1_pellet_3.3505.3505.293.07790.751782137.312136.471250.081.2%12K.CDMVDDPELLELVEMEVR.E2
rpal_wt_anaer_auto_1_cleared_1.495.495.130.98250.178188589.65589.711186.087.5%5R.ELLSK.Y1
rpal_wt_anaer_auto_1_crude_3c.2242.2242.140.05080.6176961949.341950.24186.061.5%7R.ELLSKYDFPGDDIPIVK.G1
rpal_wt_anaer_auto_1_cleared_3.2255.2255.269.25780.6479431950.861950.241199.073.3%12R.ELLSKYDFPGDDIPIVK.G2
rpal_wt_anaer_auto_1_cleared_1.2442.2442.349.27070.4389041953.171950.241137.048.3%2R.ELLSKYDFPGDDIPIVK.G3
rpal_wt_anaer_auto_1_cleared_3c.2775.2775.244.9380.570013177.843178.561120.036.5%2R.ELLSKYDFPGDDIPIVKGSALAALENSDAK.L2
rpal_wt_anaer_auto_1_cleared_2c.2763.2763.364.42830.4024773180.423178.561223.051.2%3R.ELLSKYDFPGDDIPIVKGSALAALENSDAK.L3
rpal_wt_anaer_auto_1_crude_full.1828.1828.143.56130.6284591378.511379.551189.078.9%23K.YDFPGDDIPIVK.G1
rpal_wt_anaer_auto_1_crude_1c.1914.1914.262.79160.7272761380.721379.551151.081.8%27K.YDFPGDDIPIVK.G2
rpal_wt_anaer_auto_1_crude_2.2647.2647.352.32050.4013382608.462607.881160.049.4%1K.YDFPGDDIPIVKGSALAALENSDAK.L3
rpal_wt_anaer_auto_1_crude_4.2705.2705.247.75070.5734452608.852607.88135.046.7%4K.YDFPGDDIPIVKGSALAALENSDAK.L2
rpal_wt_anaer_auto_1_crude_2c.3446.3446.351.84470.4250543858.783857.381128.046.7%1K.YDFPGDDIPIVKGSALAALENSDAKLGHDAILELMR.Q3
rpal_wt_anaer_auto_1_cleared_2c.1143.1143.151.75080.633761246.61247.351111.078.9%17K.GSALAALENSDAK.L1
rpal_wt_anaer_auto_1_cleared_1c.1158.1158.274.26590.6905031247.241247.351255.087.0%12K.GSALAALENSDAK.L2
rpal_wt_anaer_auto_1_cleared_3.2987.2987.281.32930.6954232496.632496.851185.064.3%8K.GSALAALENSDAKLGHDAILELMR.Q2
rpal_wt_anaer_auto_1_cleared_2.3017.3017.386.75240.6735872497.472496.851154.065.3%9K.GSALAALENSDAKLGHDAILELMR.Q3
rpal_wt_anaer_auto_1_crude_2c.1708.1708.155.8750.5580171267.941268.521182.094.1%16K.LGHDAILELMR.Q1
rpal_wt_anaer_auto_1_cleared_1c.1795.1795.356.57010.3779171268.61268.521214.064.7%7K.LGHDAILELMR.Q3
rpal_wt_anaer_auto_1_cleared_1c.1793.1793.263.00030.5850121268.741268.521125.084.2%11K.LGHDAILELMR.Q2
rpal_wt_anaer_auto_1_crude_3c.3446.3446.236.46880.4615753446.073445.92117.028.8%5R.QVDAYIPQPERPIDQPFLMPVEDVFSISGR.G2
rpal_wt_anaer_auto_1_cleared_3.3360.3360.371.77750.5181753446.383445.921165.060.0%17R.QVDAYIPQPERPIDQPFLMPVEDVFSISGR.G3
rpal_wt_anaer_auto_1_cleared_full.379.379.236.08680.258843690.09689.791117.069.2%1R.GTVVTGR.V2
rpal_wt_anaer_auto_1_crude_1c.1846.1846.366.67480.5461552084.672084.421135.061.0%5R.GILKVGDEIEIVGIRDTQK.T3
rpal_wt_anaer_auto_1_crude_3.1835.1835.260.60180.7271012086.432084.421242.060.6%3R.GILKVGDEIEIVGIRDTQK.T2
rpal_wt_anaer_auto_1_cleared_1.1810.1810.270.6960.5483311200.361200.381255.089.5%7K.VGDEIEIVGIR.D2
rpal_wt_anaer_auto_1_cleared_3.1630.1630.141.50960.4503251202.991200.381135.076.5%10K.VGDEIEIVGIR.D1
rpal_wt_anaer_auto_1_pellet_1c.1404.1404.263.73550.6678651672.751672.881243.070.4%12K.VGDEIEIVGIRDTQK.T2
rpal_wt_anaer_auto_1_cleared_1.1520.1520.360.16070.4680981673.251672.881172.060.4%7K.VGDEIEIVGIRDTQK.T3
rpal_wt_anaer_auto_1_pellet_3c.1380.1380.137.72590.499371673.691672.88124.065.2%8K.VGDEIEIVGIRDTQK.T1
rpal_wt_anaer_auto_1_cleared_3.2195.2195.367.26010.492872800.672799.21209.052.8%3K.VGDEIEIVGIRDTQKTTCTGVEMFR.K3
rpal_wt_anaer_auto_1_crude_3.1888.1888.368.87340.4874292929.172927.371214.056.8%2K.VGDEIEIVGIRDTQKTTCTGVEMFRK.L3
rpal_wt_anaer_auto_1_crude_full.1086.1086.125.54190.4220561144.531145.34116.056.2%1K.TTCTGVEMFR.K1
rpal_wt_anaer_auto_1_cleared_full.1158.1158.257.57970.6343991146.441145.341209.084.2%5K.TTCTGVEMFR.K2
rpal_wt_anaer_auto_1_cleared_1.1020.1020.236.31360.5516831274.531273.521150.060.0%2K.TTCTGVEMFRK.L2
rpal_wt_anaer_auto_1_cleared_full.1738.1738.295.84050.7126831783.091783.041252.090.3%13R.KLLDQGQAGDNIGALLR.G2
rpal_wt_anaer_auto_1_cleared_1c.1868.1868.374.58270.535171783.181783.041194.060.7%4R.KLLDQGQAGDNIGALLR.G3
rpal_wt_anaer_auto_1_cleared_3c.1837.1837.143.2580.5383811785.721783.041161.069.2%9R.KLLDQGQAGDNIGALLR.G1
rpal_wt_anaer_auto_1_cleared_4.2084.2084.132.86760.4260491653.781654.861160.057.7%5K.LLDQGQAGDNIGALLR.G1
rpal_wt_anaer_auto_1_cleared_1c.2108.2108.289.66530.7338881654.611654.861241.089.7%15K.LLDQGQAGDNIGALLR.G2
rpal_wt_anaer_auto_1_cleared_1.2266.2266.358.35850.5297171655.611654.861231.056.6%1K.LLDQGQAGDNIGALLR.G3
rpal_wt_anaer_auto_1_cleared_4.675.675.233.27020.4593092652.712651.07133.040.5%1R.GTKREDVERGQVLCKPGSVKPHTK.F2
rpal_wt_anaer_auto_1_cleared_2.685.685.357.06510.4937362211.282208.551142.064.3%1R.EDVERGQVLCKPGSVKPHTK.F3
rpal_wt_anaer_auto_1_crude_3c.572.572.148.82890.6834891578.081579.911100.078.3%8R.GQVLCKPGSVKPHTK.F1
rpal_wt_anaer_auto_1_pellet_1.492.492.348.89940.3355771580.041579.911216.052.2%1R.GQVLCKPGSVKPHTK.F3
rpal_wt_anaer_auto_1_crude_1c.560.560.254.19650.6338661582.131579.911154.070.4%5R.GQVLCKPGSVKPHTK.F2
rpal_wt_anaer_auto_1_crude_2c.1214.1214.140.13570.520951183.631184.421240.075.0%16K.FKAEAYILTK.E1
rpal_wt_anaer_auto_1_crude_1.1073.1073.359.84360.4990091184.081184.421234.069.7%3K.FKAEAYILTK.E3
rpal_wt_anaer_auto_1_cleared_1.1338.1338.259.8220.6207371185.911184.421172.088.9%6K.FKAEAYILTK.E2
rpal_wt_anaer_auto_1_cleared_3c.1167.1167.127.4220.4379371711.281712.94198.060.0%1K.FKAEAYILTKEEGGR.H1
rpal_wt_anaer_auto_1_cleared_1c.1201.1201.354.98180.5037431715.291712.941172.060.5%1K.FKAEAYILTKEEGGR.H3
rpal_wt_anaer_auto_1_cleared_2c.834.834.133.58410.41433911.18909.0711216.083.3%2K.AEAYILTK.E1
rpal_wt_anaer_auto_1_cleared_full.3175.3175.385.5710.5721684106.884105.811146.067.0%33R.TTDVTGVVHLPEGTEMVMPGDNIAMEVHLIVPIAMEEK.L3
rpal_wt_anaer_auto_1_pellet_3c.3549.3549.378.33990.6023764378.04375.151172.059.5%5R.TTDVTGVVHLPEGTEMVMPGDNIAMEVHLIVPIAMEEKLR.F3
rpal_wt_anaer_auto_1_pellet_1c.703.703.125.64340.14851506.69506.6261106.087.5%2R.FAIR.E1
rpal_wt_anaer_auto_1_cleared_1.2666.2666.241.05250.6118431099.541100.31249.059.1%6R.TVGAGVVAAIIE.-2

URPA1428266585.6%257278138.2RPA1428 possible lipoprotein 1582970:1583743 forward MW:27813
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_cleared_4.1572.1572.140.2510.4725751605.261605.881226.058.3%4R.VGVTAGPHAEILDVVK.K1
*rpal_wt_anaer_auto_1_cleared_1c.1608.1608.258.39050.6786621606.251605.881164.069.0%3R.VGVTAGPHAEILDVVK.K2
*rpal_wt_anaer_auto_1_cleared_4.1330.1330.136.69330.4163181732.661734.051199.062.5%3R.VGVTAGPHAEILDVVKK.V1
*rpal_wt_anaer_auto_1_cleared_2.1343.1343.256.20240.5934941736.151734.051220.064.5%3R.VGVTAGPHAEILDVVKK.V2
*rpal_wt_anaer_auto_1_cleared_3.2238.2238.259.57590.6562352435.092432.781161.059.0%2R.GLDVKPVEFTDYVVPNQALAQK.E2
*rpal_wt_anaer_auto_1_cleared_2c.2598.2598.357.61380.4642524118.624119.621100.047.0%1R.GLDVKPVEFTDYVVPNQALAQKELEANSFQHEPYLK.A3
*rpal_wt_anaer_auto_1_cleared_3c.2517.2517.354.34480.4756114617.744617.22174.051.2%2R.GLDVKPVEFTDYVVPNQALAQKELEANSFQHEPYLKAQVAK.T3
*rpal_wt_anaer_auto_1_crude_full.1060.1060.233.20190.3260871535.11534.75185.044.4%1K.VANTIASPQGVYSVK.V2
*rpal_wt_anaer_auto_1_cleared_4.1150.1150.133.05850.5433641537.141534.751156.056.5%2K.VANTIASPQGVYSVK.V1
*rpal_wt_anaer_auto_1_cleared_3.1300.1300.263.78870.6293452155.772154.391217.064.1%4K.ALADLKQGATVAIANDPSNGAR.G2
*rpal_wt_anaer_auto_1_crude_2.700.700.234.21060.4227731544.741542.651139.044.8%1K.QGATVAIANDPSNGAR.G2
*rpal_wt_anaer_auto_1_cleared_2c.2293.2293.145.72710.5246911275.941276.611217.073.7%4R.GLQILALHGLIK.L1
*rpal_wt_anaer_auto_1_cleared_1c.2314.2314.256.41710.5653591277.361276.611237.071.4%7R.GLQILALHGLIK.L2
*rpal_wt_anaer_auto_1_cleared_1.2478.2478.350.32960.4690981277.431276.611164.059.5%1R.GLQILALHGLIK.L3
*rpal_wt_anaer_auto_1_cleared_1.1927.1927.351.48050.3224791898.471899.151237.050.0%1K.LKDGVGATATVADIIDNPK.K3
*rpal_wt_anaer_auto_1_cleared_4.1753.1753.135.63820.50551898.951899.151200.051.7%2K.LKDGVGATATVADIIDNPK.K1
*rpal_wt_anaer_auto_1_cleared_3.1730.1730.290.7780.6820691900.761899.151223.082.4%3K.LKDGVGATATVADIIDNPK.K2
*rpal_wt_anaer_auto_1_cleared_3.1643.1643.265.54090.6769282269.582268.661171.057.5%1K.LKDGVGATATVADIIDNPKKLK.F2
*rpal_wt_anaer_auto_1_crude_3.1554.1554.144.24940.4142721258.721259.451202.083.3%4K.FVELDAAQLPR.S1
*rpal_wt_anaer_auto_1_cleared_1.1825.1825.271.48680.6604061260.21259.451253.085.0%6K.FVELDAAQLPR.S2
*rpal_wt_anaer_auto_1_cleared_full.2270.2270.345.35570.2885223089.913088.41162.047.4%1R.SLQDVDLVSINNNYAVQAGLDPSKDALAR.E3
*rpal_wt_anaer_auto_1_crude_4.2423.2423.235.69710.4246483091.03088.41128.030.8%2R.SLQDVDLVSINNNYAVQAGLDPSKDALAR.E2
*rpal_wt_anaer_auto_1_cleared_1c.2486.2486.251.45590.5485731597.981596.831240.065.4%2R.ENVEGPWVNIIAVR.E2
*rpal_wt_anaer_auto_1_cleared_full.2020.2020.347.570.3085772851.952852.221163.050.8%1R.ENVEGPWVNIIAVREEDKDKPWVK.Q3
*rpal_wt_anaer_auto_1_cleared_full.1609.1609.245.10660.6368182146.692147.4132.053.1%3K.QLIDAYHSDPVKQFVETR.F2
*rpal_wt_anaer_auto_1_cleared_3.1825.1825.125.03350.3352271082.951083.271148.061.5%1R.FKGTYIPAW.-1

URPA3600175485.6%160188505.2bfr bacterioferritin 4064442:4064924 reverse MW:18850
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_pellet_2c.3625.3625.345.35460.1948673641.193640.2118.050.0%1-.MKGDAKVIEYLNRGLRSELTAINQYWLHYR.L3
*rpal_wt_anaer_auto_1_pellet_1.865.865.231.94850.49227907.3907.0581219.069.2%1K.VIEYLNR.G2
*rpal_wt_anaer_auto_1_pellet_1c.2642.2642.345.55150.3806092121.722121.41130.051.0%1R.GLRSELTAINQYWLHYR.L3
*rpal_wt_anaer_auto_1_pellet_2c.1971.1971.142.29040.5488981385.831386.631236.072.2%4R.LLDNWGLKDLAK.T1
*rpal_wt_anaer_auto_1_pellet_1c.1908.1908.251.86780.587711386.691386.631184.072.7%8R.LLDNWGLKDLAK.T2
*rpal_wt_anaer_auto_1_pellet_4.1203.1203.126.53420.4972151900.911902.141138.054.2%1R.KESIEEMVHADKLTDR.I1
*rpal_wt_anaer_auto_1_pellet_2c.1276.1276.260.7420.623561904.031902.141212.072.4%3R.KESIEEMVHADKLTDR.I2
*rpal_wt_anaer_auto_1_pellet_4.1487.1487.129.52440.3613961773.951773.961160.055.0%1K.ESIEEMVHADKLTDR.I1
*rpal_wt_anaer_auto_1_pellet_1c.1544.1544.239.83190.4939781774.831773.961141.056.0%2K.ESIEEMVHADKLTDR.I2
*rpal_wt_anaer_auto_1_crude_full.3348.3348.276.5910.5508871988.541989.391220.080.0%12R.IIFLDGFPNMQVLDPLR.I2
*rpal_wt_anaer_auto_1_pellet_4.3738.3738.125.13810.5002961992.111989.391128.050.0%1R.IIFLDGFPNMQVLDPLR.I1
*rpal_wt_anaer_auto_1_pellet_2.1991.1991.354.09260.431972205.832205.461125.048.3%2R.ALYQEAATYCHSVKDYVSR.D3
*rpal_wt_anaer_auto_1_pellet_2c.2126.2126.276.23010.7504162206.562205.461241.070.6%2R.ALYQEAATYCHSVKDYVSR.D2
*rpal_wt_anaer_auto_1_pellet_3c.3895.3895.265.10460.6863833229.293229.591140.043.5%4R.DLFEQLMKDEEHHIDFLETQLDLVNR.I2
*rpal_wt_anaer_auto_1_crude_3.3773.3773.393.03490.5785193229.93229.591222.066.7%7R.DLFEQLMKDEEHHIDFLETQLDLVNR.I3
*rpal_wt_anaer_auto_1_crude_2c.1308.1308.258.05070.5705342005.342004.171156.065.5%3R.IGVELYQQHHIGELDHD.-2
*rpal_wt_anaer_auto_1_pellet_1c.1408.1408.346.78820.3775052005.562004.171236.047.9%1R.IGVELYQQHHIGELDHD.-3

URPA42683011184.5%161173965.6RPA4268 peroxiredoxin-like protein 4816864:4817349 forward MW:17396
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_crude_1c.1120.1120.244.60.5052851616.551616.861192.060.0%6M.TIKVGDRLPDAQFR.V2
*rpal_wt_anaer_auto_1_cleared_3.926.926.125.96930.3834181273.651274.421162.052.9%2K.VGDRLPDAQFR.V1
*rpal_wt_anaer_auto_1_cleared_1c.980.980.236.95240.4321691274.231274.421196.052.6%4K.VGDRLPDAQFR.V2
*rpal_wt_anaer_auto_1_cleared_1.1067.1067.363.23970.5022371275.511274.421183.076.5%1K.VGDRLPDAQFR.V3
*rpal_wt_anaer_auto_1_cleared_3.700.700.136.48540.429641106.931106.291177.075.0%7R.VMTEDGVQVK.T1
*rpal_wt_anaer_auto_1_pellet_1.692.692.232.93210.4582341108.011106.291130.061.1%1R.VMTEDGVQVK.T2
*rpal_wt_anaer_auto_1_cleared_3.621.621.134.91220.487461024.691025.151174.078.6%1K.TTDDIFKGK.K1
*rpal_wt_anaer_auto_1_cleared_1.703.703.233.74250.3724291026.031025.151142.058.8%1K.TTDDIFKGK.K2
*rpal_wt_anaer_auto_1_crude_3.549.549.144.20040.6084761152.661153.321199.086.7%3K.TTDDIFKGKK.V1
*rpal_wt_anaer_auto_1_cleared_1.541.541.242.27610.6374411153.091153.321188.066.7%1K.TTDDIFKGKK.V2
*rpal_wt_anaer_auto_1_cleared_3c.1436.1436.138.01040.6093251763.791764.11168.061.5%3K.KVALFAVPGAYTGTCHK.M1
*rpal_wt_anaer_auto_1_crude_1c.1326.1326.237.16750.412891766.11764.11160.048.4%1K.KVALFAVPGAYTGTCHK.M2
*rpal_wt_anaer_auto_1_cleared_1.1600.1600.354.09110.3381261766.651764.11192.059.6%3K.KVALFAVPGAYTGTCHK.M3
*rpal_wt_anaer_auto_1_crude_2.1532.1532.254.82460.482151636.791635.931178.066.7%5K.VALFAVPGAYTGTCHK.M2
*rpal_wt_anaer_auto_1_cleared_full.1598.1598.349.74790.4507391637.021635.931226.044.7%2K.VALFAVPGAYTGTCHK.M3
*rpal_wt_anaer_auto_1_cleared_4.1677.1677.135.53730.4283981638.281635.931160.058.3%5K.VALFAVPGAYTGTCHK.M1
*rpal_wt_anaer_auto_1_cleared_1c.2574.2574.241.68570.5689841636.841637.021184.053.8%1K.MHLPSIFLNAYAMK.D2
*rpal_wt_anaer_auto_1_crude_3c.2557.2557.147.56020.6351021638.431637.021228.077.3%9K.MHLPSIFLNAYAMK.D1
*rpal_wt_anaer_auto_1_cleared_3c.2252.2252.140.03630.539851879.281880.28155.068.2%2K.MHLPSIFLNAYAMKDK.G1
*rpal_wt_anaer_auto_1_cleared_2c.2256.2256.236.56760.4762931881.641880.281161.050.0%2K.MHLPSIFLNAYAMKDK.G2
*rpal_wt_anaer_auto_1_cleared_1c.2281.2281.366.26370.5536431882.431880.281206.060.8%4K.MHLPSIFLNAYAMKDK.G3
*rpal_wt_anaer_auto_1_cleared_2.1615.1615.359.68610.5532762228.352228.341221.051.7%1R.DTDQRNEAIFLGDGNADFTK.A3
*rpal_wt_anaer_auto_1_cleared_3.1583.1583.266.37290.7309622229.12228.341182.063.9%4R.DTDQRNEAIFLGDGNADFTK.A2
*rpal_wt_anaer_auto_1_crude_4.1672.1672.137.90570.5580371611.91612.74190.065.2%6R.NEAIFLGDGNADFTK.A1
*rpal_wt_anaer_auto_1_cleared_1c.1734.1734.274.40740.7533161612.11612.741206.078.6%2R.NEAIFLGDGNADFTK.A2
*rpal_wt_anaer_auto_1_cleared_2.1927.1927.278.12860.7565781600.091599.831251.079.3%7K.AIGMEMDGSGFGLGTR.S2
*rpal_wt_anaer_auto_1_crude_4.1886.1886.131.24350.5349821601.941599.831152.058.3%2K.AIGMEMDGSGFGLGTR.S1
*rpal_wt_anaer_auto_1_crude_3.1114.1114.144.68590.6592861228.751226.441168.082.4%8R.YSMVVEDGVVK.T1
*rpal_wt_anaer_auto_1_cleared_1.1362.1362.260.40770.686751228.941226.441236.085.0%6R.YSMVVEDGVVK.T2
*rpal_wt_anaer_auto_1_cleared_full.2474.2474.264.62150.6987322351.512352.651168.060.0%11K.TLNLEPNPGKVEVSGGDTLLGQL.-2

URPA40503411284.2%265299856.4RPA4050 unknown protein 4582156:4582953 forward MW:29985
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_pellet_1c.1560.1560.128.14850.102279875.43876.1051166.075.0%1R.EMLEILK.K1
*rpal_wt_anaer_auto_1_pellet_1.1494.1494.239.50870.0806835877.55876.1051164.078.6%1R.EMLEILK.K2
*rpal_wt_anaer_auto_1_pellet_2c.1158.1158.133.11670.2782431005.371004.281176.083.3%1R.EMLEILKK.L1
*rpal_wt_anaer_auto_1_pellet_2c.697.697.127.87080.3926581250.071250.44120.064.7%1K.LRQEYGAVSVK.A1
*rpal_wt_anaer_auto_1_pellet_1.654.654.254.62360.5483841250.991250.441232.080.0%1K.LRQEYGAVSVK.A2
*rpal_wt_anaer_auto_1_cleared_2.1287.1287.245.19970.4905541737.811737.861193.063.0%8K.AEFEAEGTRTDELLR.L2
*rpal_wt_anaer_auto_1_pellet_3c.1789.1789.128.04980.3614111489.881490.72144.047.6%3K.IGGCEAVRDLIESK.Q1
*rpal_wt_anaer_auto_1_pellet_full.1542.1542.254.54080.5179351490.491490.721230.064.0%8K.IGGCEAVRDLIESK.Q2
*rpal_wt_anaer_auto_1_pellet_full.1543.1543.350.15920.3956661491.891490.721195.058.1%2K.IGGCEAVRDLIESK.Q3
*rpal_wt_anaer_auto_1_cleared_3.2772.2772.232.01690.3610412172.772172.551170.035.3%3K.QFGTEYIIAPMVETPYALK.K2
*rpal_wt_anaer_auto_1_crude_full.2203.2203.244.99110.4060652301.752300.721200.050.0%5K.QFGTEYIIAPMVETPYALKK.F2
*rpal_wt_anaer_auto_1_crude_1c.481.481.127.98860.154259607.41607.7281249.087.5%1K.FIEAK.N1
*rpal_wt_anaer_auto_1_pellet_3c.4047.4047.234.07270.4032473570.043569.971141.025.5%3K.VYTQEQKEDTSFLFNLETITAFNNIDDMIK.V2
*rpal_wt_anaer_auto_1_pellet_full.1292.1292.370.60640.4994691497.871497.71254.063.8%3K.VGIGHDGVQGVVFGR.V3
*rpal_wt_anaer_auto_1_cleared_3c.1435.1435.151.68670.6124941497.961497.71141.069.6%7K.VGIGHDGVQGVVFGR.V1
*rpal_wt_anaer_auto_1_pellet_1c.1497.1497.273.12280.6590411499.021497.71243.077.8%8K.VGIGHDGVQGVVFGR.V2
*rpal_wt_anaer_auto_1_crude_3.513.513.130.43260.5032271189.941189.231196.061.1%2R.VDFAGSHGQDR.S1
*rpal_wt_anaer_auto_1_crude_4.1645.1645.140.38760.576631510.881510.681205.076.2%9R.SVIDSADVTNYVVK.T1
*rpal_wt_anaer_auto_1_cleared_full.1588.1588.278.51610.7240581511.091510.681236.088.0%8R.SVIDSADVTNYVVK.T2
*rpal_wt_anaer_auto_1_crude_3.1841.1841.258.43690.654861942.431940.161129.065.6%1R.SVIDSADVTNYVVKTAEK.C2
*rpal_wt_anaer_auto_1_pellet_2c.2612.2612.261.19870.6011192498.312496.931230.052.4%2K.CKANNLELVVGGAVGIDSLPELKR.I2
*rpal_wt_anaer_auto_1_pellet_2.2469.2469.361.18950.4401952498.412496.931116.056.3%1K.CKANNLELVVGGAVGIDSLPELKR.I3
*rpal_wt_anaer_auto_1_pellet_2c.2823.2823.250.54330.6103222266.132265.621104.048.7%1K.ANNLELVVGGAVGIDSLPELKR.I2
*rpal_wt_anaer_auto_1_pellet_1.588.588.241.58880.407376896.57897.066198.073.3%1R.IASVHLTR.F2
*rpal_wt_anaer_auto_1_crude_3.663.663.127.90960.303526898.49897.066170.069.2%3R.IASVHLTR.F1
*rpal_wt_anaer_auto_1_pellet_4.1159.1159.146.55670.5776231388.341388.611196.075.0%7R.KVIFGADALSNPR.M1
*rpal_wt_anaer_auto_1_crude_2.1052.1052.282.35710.6376681391.081388.611230.087.5%7R.KVIFGADALSNPR.M2
*rpal_wt_anaer_auto_1_pellet_2c.1512.1512.126.09330.2857711259.661260.441201.057.9%1K.VIFGADALSNPR.M1
*rpal_wt_anaer_auto_1_pellet_1.1441.1441.252.340.6058041263.031260.441118.072.7%4K.VIFGADALSNPR.M2
*rpal_wt_anaer_auto_1_cleared_4.2762.2762.137.26650.652021441.821441.67164.076.5%4R.NTVYFELQWLK.N1
*rpal_wt_anaer_auto_1_pellet_2.2722.2722.233.32680.5147421442.251441.6714.060.0%1R.NTVYFELQWLK.N2
*rpal_wt_anaer_auto_1_pellet_3c.1080.1080.136.01660.5668551488.351487.521133.066.7%2R.DYYGEIQGEDAAR.I1
*rpal_wt_anaer_auto_1_pellet_3.505.505.127.23160.243394904.36905.1061198.072.7%1R.IEMLDKR.W1
*rpal_wt_anaer_auto_1_pellet_1.555.555.237.74460.297232904.94905.1061244.069.2%1R.IEMLDKR.W2

URPA3056198182.9%140152196.8RPA3056 nucleoside-diphosphate-kinase 3458619:3459041 reverse MW:15219
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_pellet_2c.1222.1222.142.32690.559291377.691378.57152.078.9%5R.TFSILKPDATER.N1
*rpal_wt_anaer_auto_1_crude_full.1038.1038.246.40540.6039661378.351378.571226.063.6%7R.TFSILKPDATER.N2
*rpal_wt_anaer_auto_1_crude_3.2198.2198.140.18540.5480271256.691257.47145.073.7%9R.NITGAINALIEK.A1
*rpal_wt_anaer_auto_1_pellet_1.2253.2253.270.19020.7090451257.771257.471177.086.4%8R.NITGAINALIEK.A2
*rpal_wt_anaer_auto_1_cleared_2c.825.825.141.5450.4787511308.641309.421177.082.4%5R.DQAETFYAVHK.E1
*rpal_wt_anaer_auto_1_cleared_1c.839.839.263.44550.4891471309.731309.421244.080.0%1R.DQAETFYAVHK.E2
*rpal_wt_anaer_auto_1_cleared_3c.4378.4378.346.85820.2593344526.114526.171250.039.8%3R.DQAETFYAVHKERPFFGELVDFMISGPVVVQVLEGEGAIAK.Y3
*rpal_wt_anaer_auto_1_cleared_full.4191.4191.387.34590.5300213235.253235.771170.063.3%4K.ERPFFGELVDFMISGPVVVQVLEGEGAIAK.Y3
*rpal_wt_anaer_auto_1_cleared_4.4635.4635.243.55190.5612823238.023235.771206.038.5%3K.ERPFFGELVDFMISGPVVVQVLEGEGAIAK.Y2
*rpal_wt_anaer_auto_1_crude_2c.689.689.129.75040.306541339.661340.51144.068.4%3K.YRDVMGATDPSK.A1
*rpal_wt_anaer_auto_1_cleared_1.722.722.264.34830.7020711340.451340.51160.081.8%6K.YRDVMGATDPSK.A2
*rpal_wt_anaer_auto_1_cleared_1.1126.1126.356.18080.3849592025.482025.251221.052.5%2K.YRDVMGATDPSKAADGTIR.K3
*rpal_wt_anaer_auto_1_cleared_2c.998.998.245.54010.6398892028.222025.251200.047.2%3K.YRDVMGATDPSKAADGTIR.K2
*rpal_wt_anaer_auto_1_cleared_2.875.875.347.63550.3302942156.132153.421194.050.8%1K.YRDVMGATDPSKAADGTIRK.L3
*rpal_wt_anaer_auto_1_cleared_2c.610.610.134.85180.5095351021.471021.141235.075.0%1R.DVMGATDPSK.A1
*rpal_wt_anaer_auto_1_cleared_4.557.557.158.06040.7303551673.991673.731156.073.1%8K.SIGENSVHGSDAAETAK.I1
*rpal_wt_anaer_auto_1_cleared_1c.623.623.269.4120.6953621674.221673.731203.076.7%8K.SIGENSVHGSDAAETAK.I2
*rpal_wt_anaer_auto_1_cleared_full.2924.2924.356.4650.3532193178.733179.431176.051.9%2K.SIGENSVHGSDAAETAKIEIAQFFSGNEIVG.-3
*rpal_wt_anaer_auto_1_cleared_3c.3117.3117.128.25520.4886681525.431524.711224.065.0%2K.IEIAQFFSGNEIVG.-1

URPA4137153582.5%143155125.6RPA4137 conserved unknown protein 4679131:4679562 reverse MW:15512
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_membrane_2c.3185.3185.258.51980.672892233.512234.471232.064.7%3M.ADSSDPFSTVLPFQLPEQVR.A2
*rpal_wt_anaer_auto_1_membrane_full.1958.1958.276.36880.7552132210.52210.45144.073.0%3K.LKDVAETQNGTIEAVFTSASK.G2
*rpal_wt_anaer_auto_1_membrane_1c.1403.1403.130.87840.138158755.16754.9041176.090.0%3K.VFDFVK.T1
*rpal_wt_anaer_auto_1_membrane_full.2467.2467.143.54150.6539141757.591758.931136.072.0%3K.TNTSASFDFAQSLIGAK.T1
*rpal_wt_anaer_auto_1_membrane_full.2468.2468.275.71320.7084541759.841758.931228.080.0%2K.TNTSASFDFAQSLIGAK.T2
*rpal_wt_anaer_auto_1_membrane_4.2643.2643.129.98180.4298641628.811628.891232.055.0%1K.TLPDVMELWTSHAK.K1
*rpal_wt_anaer_auto_1_membrane_1c.2708.2708.241.71220.594551629.511628.89162.054.2%3K.TLPDVMELWTSHAK.K2
*rpal_wt_anaer_auto_1_membrane_2c.557.557.141.22230.559921260.51261.461188.072.2%2K.KQIETLTAQTK.E1
*rpal_wt_anaer_auto_1_membrane_2c.737.737.137.38470.504067961.94962.0891148.084.6%3K.ELTELTQK.V1
*rpal_wt_anaer_auto_1_membrane_full.650.650.237.11440.48565962.68962.0891192.066.7%2K.ELTELTQK.V2
*rpal_wt_anaer_auto_1_membrane_2c.828.828.125.39520.2539731057.891057.23120.066.7%1K.VAAETVEPIK.A1
*rpal_wt_anaer_auto_1_membrane_1c.798.798.255.3290.446141529.221528.751197.070.4%4K.VAAETVEPIKANASK.I2
*rpal_wt_anaer_auto_1_membrane_4.750.750.140.88820.5839731529.361528.75181.077.3%2K.VAAETVEPIKANASK.I1
*rpal_wt_anaer_auto_1_membrane_1.769.769.352.50040.4360061529.781528.751180.054.3%2K.VAAETVEPIKANASK.I3
*rpal_wt_anaer_auto_1_membrane_full.515.515.131.3530.319347647.0646.8081252.088.9%1K.IFKPAA.-1

URPA2874369982.2%427450015.2eno enolase 3250857:3252140 reverse MW:45001
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_pellet_full.1324.1324.132.49140.243421957.76958.1471149.078.6%3M.TAIVDIIGR.E1
*rpal_wt_anaer_auto_1_pellet_full.1323.1323.255.04780.502834957.92958.1471252.082.4%1M.TAIVDIIGR.E2
*rpal_wt_anaer_auto_1_pellet_1.2742.2742.362.68330.5677331672.71671.941189.051.9%1M.TAIVDIIGREILDSR.G3
*rpal_wt_anaer_auto_1_pellet_2.938.938.272.39090.5629991724.761723.88185.071.9%3R.AAVPSGASTGAHEAVELR.D2
*rpal_wt_anaer_auto_1_pellet_1.997.997.348.15320.3678071726.51723.881153.048.2%1R.AAVPSGASTGAHEAVELR.D3
*rpal_wt_anaer_auto_1_pellet_2c.921.921.238.37510.464892368.082366.551161.041.9%2R.AAVPSGASTGAHEAVELRDGDKAR.Y2
*rpal_wt_anaer_auto_1_crude_3.465.465.128.14060.335295894.58893.0741120.071.4%1R.YLGKGVQK.A1
*rpal_wt_anaer_auto_1_pellet_2c.3451.3451.370.16670.4552774164.734162.61173.060.5%1K.AVEAVNGELFDALGGMDAEQQVQIDQTMIELDGTPNKGR.I3
*rpal_wt_anaer_auto_1_pellet_2c.2226.2226.128.11910.3552431369.781369.65113.054.5%1R.IGANAILGVSLAAAK.A1
*rpal_wt_anaer_auto_1_pellet_4.1287.1287.127.96710.2831761329.21329.521136.066.7%4K.AAAASYDMPLYR.Y1
*rpal_wt_anaer_auto_1_pellet_full.1148.1148.251.99770.3023131329.231329.521249.066.7%5K.AAAASYDMPLYR.Y2
*rpal_wt_anaer_auto_1_pellet_full.3637.3637.345.79570.4133644327.334329.091180.045.3%2R.TLPVPMMNIVNGGVHADNPIDFQEFMIMPVGAPTFADALR.C3
*rpal_wt_anaer_auto_1_pellet_3.4087.4087.370.40220.4705113354.733357.731170.049.4%3K.KAGHNTNVGDEGGFAPNLPSADAALDFVMAAIGK.A3
*rpal_wt_anaer_auto_1_pellet_4.4132.4132.241.42030.4714333358.513357.731212.032.2%5K.KAGHNTNVGDEGGFAPNLPSADAALDFVMAAIGK.A2
*rpal_wt_anaer_auto_1_pellet_3c.4384.4384.267.36320.6734313228.043229.551198.043.1%9K.AGHNTNVGDEGGFAPNLPSADAALDFVMAAIGK.A2
*rpal_wt_anaer_auto_1_pellet_2c.4315.4315.398.65230.5738863229.03229.551227.064.4%6K.AGHNTNVGDEGGFAPNLPSADAALDFVMAAIGK.A3
*rpal_wt_anaer_auto_1_pellet_full.3638.3638.245.77090.5891911862.091860.1611.056.2%1K.AGGDVMLALDCAATEFFK.D2
*rpal_wt_anaer_auto_1_pellet_3c.4071.4071.230.11570.3604473030.693030.361160.029.2%1K.AGGDVMLALDCAATEFFKDGSYVYGGENK.T2
*rpal_wt_anaer_auto_1_pellet_3.3971.3971.354.07220.3561853032.613030.361124.048.0%2K.AGGDVMLALDCAATEFFKDGSYVYGGENK.T3
*rpal_wt_anaer_auto_1_pellet_full.1043.1043.235.89780.373496921.05921.0851205.068.8%2K.YLADLVAR.Y2
*rpal_wt_anaer_auto_1_pellet_3.1121.1121.130.8420.304283921.13921.0851141.076.9%3K.YLADLVAR.Y1
*rpal_wt_anaer_auto_1_pellet_2c.4108.4108.352.01190.4046674047.764047.55175.048.8%2K.YLADLVARYPIVSIEDGMSEDDMDGWKELTDLIGSK.C3
*rpal_wt_anaer_auto_1_crude_full.3246.3246.391.1740.6140683145.793145.49189.063.9%7R.YPIVSIEDGMSEDDMDGWKELTDLIGSK.C3
*rpal_wt_anaer_auto_1_pellet_full.3192.3192.258.79070.6644163145.893145.491184.044.9%4R.YPIVSIEDGMSEDDMDGWKELTDLIGSK.C2
*rpal_wt_anaer_auto_1_pellet_3c.2237.2237.128.59370.467461681.661680.921193.056.5%1K.CQLVGDDLFVTNVTR.L1
*rpal_wt_anaer_auto_1_pellet_2c.3467.3467.259.71910.6377242766.92767.261150.053.3%2R.ANSILIKVNQIGTLTETLAAVEMAHK.A2
*rpal_wt_anaer_auto_1_pellet_3.3388.3388.372.77950.5942792767.32767.261254.063.2%2R.ANSILIKVNQIGTLTETLAAVEMAHK.A3
*rpal_wt_anaer_auto_1_pellet_3.2585.2585.265.51920.6139942028.942027.351183.064.7%6K.VNQIGTLTETLAAVEMAHK.A2
*rpal_wt_anaer_auto_1_pellet_1c.2567.2567.362.34490.4771652029.82027.351115.054.0%2K.VNQIGTLTETLAAVEMAHK.A3
*rpal_wt_anaer_auto_1_pellet_1.577.577.237.05030.3587341092.881093.251212.061.1%2K.AGYTAVMSHR.S2
*rpal_wt_anaer_auto_1_pellet_2c.606.606.129.05350.4600241094.791093.25120.062.5%1K.AGYTAVMSHR.S1
*rpal_wt_anaer_auto_1_pellet_full.1899.1899.241.16790.4879772224.722224.41143.035.9%3R.SGETEDSTIADLAVATNCGQIK.T2
*rpal_wt_anaer_auto_1_pellet_4.2188.2188.239.6340.53032812.562810.071116.034.7%3R.SGETEDSTIADLAVATNCGQIKTGSLAR.A2
*rpal_wt_anaer_auto_1_pellet_1c.800.800.127.66270.326432808.06806.941129.080.0%1K.YNQLLR.I1
*rpal_wt_anaer_auto_1_pellet_4.581.581.144.76570.5953151524.771524.681174.077.3%3R.IEQELGAHAHYAGK.A1
*rpal_wt_anaer_auto_1_pellet_1c.693.693.262.97270.6931651526.081524.681210.076.0%3R.IEQELGAHAHYAGK.A2

URPA22005013181.7%498523957.1guaB inosine monophosphate dehydrogenase 2475578:2477074 forward MW:52395
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_crude_full.3504.3504.238.8640.5304323730.693731.241142.028.3%4M.ASVSASPQFIEALTFDDVLLKPGLSDVLPSEVDIR.S2
*rpal_wt_anaer_auto_1_pellet_full.3430.3430.370.16920.5342673730.823731.241147.054.7%3M.ASVSASPQFIEALTFDDVLLKPGLSDVLPSEVDIR.S3
*rpal_wt_anaer_auto_1_pellet_2c.3780.3780.281.56390.6232772098.732097.48183.077.1%12R.AIPLNIPIIASAMDTVTEAR.M2
*rpal_wt_anaer_auto_1_pellet_full.3305.3305.388.18770.5182392099.472097.48190.069.4%2R.AIPLNIPIIASAMDTVTEAR.M3
*rpal_wt_anaer_auto_1_pellet_full.1465.1465.265.49930.6853141596.361596.961122.069.0%3R.MAIAMAQAGGLGVIHR.N2
*rpal_wt_anaer_auto_1_pellet_1.1654.1654.356.87280.5097451598.541596.961173.050.0%3R.MAIAMAQAGGLGVIHR.N3
*rpal_wt_anaer_auto_1_pellet_full.873.873.265.17630.5536251333.171332.421210.086.4%2R.NFDPEGQAAQVR.Q2
*rpal_wt_anaer_auto_1_pellet_3c.1869.1869.146.55470.5716821934.281934.261192.073.1%4K.KFESGMVVNPLTISPDAK.L1
*rpal_wt_anaer_auto_1_crude_3.1704.1704.276.29590.6925811936.341934.261254.071.9%4K.KFESGMVVNPLTISPDAK.L2
*rpal_wt_anaer_auto_1_pellet_4.2082.2082.141.46980.3846121805.741806.09120.065.4%2K.FESGMVVNPLTISPDAK.L1
*rpal_wt_anaer_auto_1_pellet_3.2066.2066.245.270.5250281805.761806.09130.051.6%3K.FESGMVVNPLTISPDAK.L2
*rpal_wt_anaer_auto_1_pellet_2c.3068.3068.382.22910.6249312870.712871.291236.052.6%5K.LADALALMNQYGFSGIPVVTGAQGHGPGK.L3
*rpal_wt_anaer_auto_1_pellet_4.3017.3017.256.85820.6452282872.392871.291172.047.9%3K.LADALALMNQYGFSGIPVVTGAQGHGPGK.L2
*rpal_wt_anaer_auto_1_pellet_2c.3405.3405.375.16710.540483740.123738.351115.054.3%3K.LADALALMNQYGFSGIPVVTGAQGHGPGKLVGILTNR.D3
*rpal_wt_anaer_auto_1_pellet_1.1106.1106.230.46030.27724887.53886.0831194.060.0%1K.LVGILTNR.D2
*rpal_wt_anaer_auto_1_pellet_2c.2373.2373.254.99010.5914812488.882487.84145.053.8%2R.FATDPAQKVSELMTHENLVTVR.E2
*rpal_wt_anaer_auto_1_pellet_2.2242.2242.357.4660.4766262489.172487.84135.047.8%3R.FATDPAQKVSELMTHENLVTVR.E3
*rpal_wt_anaer_auto_1_pellet_full.1203.1203.260.7010.6173671629.131628.891230.076.0%4K.VSELMTHENLVTVR.E2
*rpal_wt_anaer_auto_1_pellet_1.1366.1366.348.010.4176091631.01628.891242.050.0%1K.VSELMTHENLVTVR.E3
*rpal_wt_anaer_auto_1_pellet_1.393.393.234.950.393737932.8932.1171112.069.2%1K.KLLHQHR.I2
*rpal_wt_anaer_auto_1_pellet_2c.1186.1186.130.46560.450191121.441121.281196.066.7%1K.LLVVDDQYR.C1
*rpal_wt_anaer_auto_1_pellet_1.1154.1154.248.77690.5860621121.821121.281245.082.4%2K.LLVVDDQYR.C2
*rpal_wt_anaer_auto_1_pellet_2c.411.411.136.85820.430509894.14894.0621241.084.6%3K.AVAHPLASK.D1
*rpal_wt_anaer_auto_1_pellet_3c.460.460.133.87430.5445721423.491421.61130.066.7%1K.AVAHPLASKDAQGR.L1
*rpal_wt_anaer_auto_1_pellet_4.686.686.129.49040.4387021382.51381.491144.054.5%1R.VAAATTVGEGGYER.T1
*rpal_wt_anaer_auto_1_pellet_1.683.683.270.29670.6843221382.851381.491173.084.0%3R.VAAATTVGEGGYER.T2
*rpal_wt_anaer_auto_1_pellet_2.1432.1432.246.01430.5655811742.461741.01133.056.7%1K.RISNQVQVIAGNIATR.D2
*rpal_wt_anaer_auto_1_pellet_3c.1651.1651.132.96040.517531584.921584.82132.065.2%4R.ISNQVQVIAGNIATR.D1
*rpal_wt_anaer_auto_1_crude_2.1505.1505.272.17110.6689911585.741584.821255.077.8%3R.ISNQVQVIAGNIATR.D2
*rpal_wt_anaer_auto_1_pellet_full.1339.1339.281.61490.5696521431.011431.541245.085.2%2R.DGAQALIDSGADAVK.V2
*rpal_wt_anaer_auto_1_pellet_4.1496.1496.153.29790.4019011433.421431.54181.082.6%4R.DGAQALIDSGADAVK.V1
*rpal_wt_anaer_auto_1_pellet_3.2435.2435.264.45570.6779292573.992573.891150.053.1%2R.DGAQALIDSGADAVKVGIGPGSICTTR.I2
*rpal_wt_anaer_auto_1_pellet_1c.2407.2407.354.62590.4423032576.572573.891236.048.8%1R.DGAQALIDSGADAVKVGIGPGSICTTR.I3
*rpal_wt_anaer_auto_1_pellet_1c.1198.1198.241.88640.6640531161.581161.371193.059.1%3K.VGIGPGSICTTR.I2
*rpal_wt_anaer_auto_1_pellet_3.3790.3790.269.75920.7037112085.432085.541145.073.0%7R.IVAGVGVPQLTAIMDAVQACK.K2
*rpal_wt_anaer_auto_1_crude_1.3391.3391.384.95020.6264762086.672085.541246.065.7%4R.IVAGVGVPQLTAIMDAVQACK.K3
*rpal_wt_anaer_auto_1_pellet_1c.1087.1087.250.71050.6131291284.861283.511190.062.5%1K.KADVPVIADGGIK.Y2
*rpal_wt_anaer_auto_1_pellet_2c.1511.1511.250.00580.5185662018.212018.321224.052.8%2K.KADVPVIADGGIKYSGDLAK.A2
*rpal_wt_anaer_auto_1_pellet_1.1451.1451.357.32270.3631492020.72018.321241.051.6%1K.KADVPVIADGGIKYSGDLAK.A3
*rpal_wt_anaer_auto_1_pellet_4.4848.4848.234.1090.5110563120.853118.54132.026.4%5K.ALAAGADIAMVGSLLAGTDETPGEVFLWQGR.S2
*rpal_wt_anaer_auto_1_pellet_1.1448.1448.357.59410.4726471886.281886.071195.060.9%1R.GSADRYFQQDIKDTLK.L3
*rpal_wt_anaer_auto_1_pellet_4.1427.1427.125.07720.3301211886.531886.07181.052.2%1R.GSADRYFQQDIKDTLK.L1
*rpal_wt_anaer_auto_1_crude_3c.1099.1099.128.45140.473261399.651399.591182.058.8%1R.YFQQDIKDTLK.L1
*rpal_wt_anaer_auto_1_pellet_3.2575.2575.361.67360.4088512886.522885.341116.053.1%1K.LVPEGIEGQVPYKGPVGNVVHQLAGGLR.A3
*rpal_wt_anaer_auto_1_pellet_3c.2644.2644.245.98970.6072842886.782885.341144.038.8%5K.LVPEGIEGQVPYKGPVGNVVHQLAGGLR.A2
*rpal_wt_anaer_auto_1_pellet_1c.639.639.136.15560.539371868.34868.0441191.071.4%1R.AAMGYVGAK.D1
*rpal_wt_anaer_auto_1_pellet_2c.596.596.128.90290.359006946.86947.0361217.066.7%2K.DLGEFHTK.A1
*rpal_wt_anaer_auto_1_pellet_2c.928.928.235.62640.3243771963.41963.211160.041.9%1R.ITGAGLRESHVHDVTITR.E2
*rpal_wt_anaer_auto_1_pellet_2c.502.502.134.77110.5296061293.821294.411185.086.7%1R.ESHVHDVTITR.E1
*rpal_wt_anaer_auto_1_pellet_2c.902.902.128.41260.462767920.45919.9671204.069.2%1R.ESPNYPGGV.-1

URPA01766832381.7%476507175.2atpD putative H+-transporting ATP synthase beta chain. 194774:196204 reverse MW:50717
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_pellet_3c.4470.4470.235.53620.213072878.52877.3615.035.4%1R.ITQVIGAVVDVQFEGHLPAILNAIETK.N2
*rpal_wt_anaer_auto_1_pellet_2c.2257.2257.257.44610.5991342208.882208.4412.060.0%6K.NGDNRLVLEVAQHLGESTVR.T2
*rpal_wt_anaer_auto_1_cleared_2.2199.2199.373.24110.5876672210.162208.441254.058.9%6K.NGDNRLVLEVAQHLGESTVR.T3
*rpal_wt_anaer_auto_1_membrane_3c.1978.1978.139.77770.5394611651.761651.9165.072.7%6R.LVLEVAQHLGESTVR.T1
*rpal_wt_anaer_auto_1_crude_1c.1621.1621.269.33260.6005831652.491651.91245.081.5%12R.LVLEVAQHLGESTVR.T2
*rpal_wt_anaer_auto_1_membrane_1c.1938.1938.367.46960.6158451653.051651.91186.062.5%4R.LVLEVAQHLGESTVR.T3
*rpal_wt_anaer_auto_1_membrane_1.1617.1617.270.94110.6875591306.481307.511222.086.4%6R.TIAMDTTEGLVR.G2
*rpal_wt_anaer_auto_1_membrane_full.1422.1422.130.16610.5160531306.631307.511145.057.9%4R.TIAMDTTEGLVR.G1
*rpal_wt_anaer_auto_1_membrane_full.2340.2340.369.32540.5421013372.593371.791216.056.3%2R.TIAMDTTEGLVRGQEVTDTGAPISVPVGAGTLGR.I3
*rpal_wt_anaer_auto_1_membrane_2c.1887.1887.274.7640.6322522082.232083.311240.067.5%14R.GQEVTDTGAPISVPVGAGTLGR.I2
*rpal_wt_anaer_auto_1_membrane_3c.1924.1924.133.46230.4510811739.431740.031224.058.3%2R.IMNVIGEPVDEQGPIK.S1
*rpal_wt_anaer_auto_1_membrane_2.1905.1905.251.78890.4632481740.521740.031195.060.0%3R.IMNVIGEPVDEQGPIK.S2
*rpal_wt_anaer_auto_1_membrane_2c.1907.1907.272.56930.695372282.762282.621176.068.4%7R.IMNVIGEPVDEQGPIKSEGLR.A2
*rpal_wt_anaer_auto_1_membrane_full.1813.1813.368.30960.5121682283.512282.621199.053.0%4R.IMNVIGEPVDEQGPIKSEGLR.A3
*rpal_wt_anaer_auto_1_cleared_2.2000.2000.371.8670.488822585.262586.86195.056.3%2R.AIHQEAPAYTDQSTEAEILVTGIK.V3
*rpal_wt_anaer_auto_1_pellet_3.1961.1961.279.71530.7675922587.12586.861148.064.3%13R.AIHQEAPAYTDQSTEAEILVTGIK.V2
*rpal_wt_anaer_auto_1_pellet_full.3745.3745.357.20010.1947993657.673657.16168.052.9%3R.AIHQEAPAYTDQSTEAEILVTGIKVVDLLAPYAK.G3
*rpal_wt_anaer_auto_1_pellet_3.1610.1610.139.72630.5982261088.451089.321211.081.2%11K.VVDLLAPYAK.G1
*rpal_wt_anaer_auto_1_membrane_full.1744.1744.251.07160.6673121089.741089.321242.083.3%7K.VVDLLAPYAK.G2
*rpal_wt_anaer_auto_1_pellet_1.1381.1381.239.69760.438291975.42976.1641211.070.6%1K.IGLFGGAGVGK.T2
*rpal_wt_anaer_auto_1_pellet_2c.1441.1441.138.53160.431861976.43976.1641169.086.7%3K.IGLFGGAGVGK.T1
*rpal_wt_anaer_auto_1_pellet_3c.3179.3179.135.47620.5779821483.931483.7513.070.0%6K.TVLIQELINNVAR.A1
*rpal_wt_anaer_auto_1_membrane_2.3265.3265.276.26060.6723351485.841483.751241.087.0%12K.TVLIQELINNVAR.A2
*rpal_wt_anaer_auto_1_pellet_4.1106.1106.141.33940.4850821407.781407.531100.071.4%6R.AHGGYSVFAGVGER.T1
*rpal_wt_anaer_auto_1_membrane_3.1735.1735.263.81380.6461712108.462109.26151.068.8%4R.TREGNDLYHEFIESGVNK.K2
*rpal_wt_anaer_auto_1_membrane_full.1502.1502.266.83010.6119132238.882237.431138.061.8%4R.TREGNDLYHEFIESGVNKK.G2
*rpal_wt_anaer_auto_1_membrane_full.1498.1498.377.78250.5024632239.912237.431122.060.7%3R.TREGNDLYHEFIESGVNKK.G3
*rpal_wt_anaer_auto_1_membrane_full.1348.1348.385.65830.5337872809.912810.011191.062.2%2R.TREGNDLYHEFIESGVNKKGGGEGSK.C3
*rpal_wt_anaer_auto_1_pellet_3c.1245.1245.252.44470.5950482811.012810.01196.045.7%5R.TREGNDLYHEFIESGVNKKGGGEGSK.C2
*rpal_wt_anaer_auto_1_membrane_3.1935.1935.234.09670.4952441852.251851.97170.044.8%2R.EGNDLYHEFIESGVNK.K2
*rpal_wt_anaer_auto_1_membrane_2c.1725.1725.243.24550.5464871981.821980.14167.053.3%1R.EGNDLYHEFIESGVNKK.G2
*rpal_wt_anaer_auto_1_membrane_3.1526.1526.239.00360.5153372551.92552.7211.040.5%1R.EGNDLYHEFIESGVNKKGGGEGSK.C2
*rpal_wt_anaer_auto_1_pellet_4.1727.1727.127.53950.2939491400.761400.62168.055.0%1R.VGLTGLTVAEHFR.D1
*rpal_wt_anaer_auto_1_pellet_1.1740.1740.349.07280.4519861401.441400.621232.052.5%1R.VGLTGLTVAEHFR.D3
*rpal_wt_anaer_auto_1_pellet_2.1682.1682.247.09490.3068681403.241400.621220.065.2%2R.VGLTGLTVAEHFR.D2
*rpal_wt_anaer_auto_1_pellet_3c.4335.4335.231.58690.4393283195.913195.611232.031.2%1R.VGLTGLTVAEHFRDQGQDVLFFVDNIFR.F2
*rpal_wt_anaer_auto_1_pellet_3.4240.4240.3100.6430.6644753197.993195.611123.064.8%5R.VGLTGLTVAEHFRDQGQDVLFFVDNIFR.F3
*rpal_wt_anaer_auto_1_pellet_3c.3954.3954.129.39540.5425641813.811814.01148.052.2%2R.DQGQDVLFFVDNIFR.F1
*rpal_wt_anaer_auto_1_pellet_full.3412.3412.261.30660.631551813.91814.011253.066.7%3R.DQGQDVLFFVDNIFR.F2
*rpal_wt_anaer_auto_1_crude_4.1911.1911.132.40230.512181437.911436.61172.059.1%6R.FTQAGSEVSALLGR.I1
*rpal_wt_anaer_auto_1_crude_1c.1849.1849.268.75090.7207771437.981436.611215.073.1%5R.FTQAGSEVSALLGR.I2
*rpal_wt_anaer_auto_1_membrane_2c.3432.3432.391.97450.5479793638.83637.111208.070.7%9R.FTQAGSEVSALLGRIPSAVGYQPTLATDMGALQER.I3
*rpal_wt_anaer_auto_1_crude_full.1958.1958.277.64710.7088282219.092219.521175.075.7%13R.IPSAVGYQPTLATDMGALQER.I2
*rpal_wt_anaer_auto_1_pellet_2.2097.2097.368.64140.5438212221.482219.521221.056.1%1R.IPSAVGYQPTLATDMGALQER.I3
*rpal_wt_anaer_auto_1_crude_full.1448.1448.251.51170.5840981491.811491.64161.064.0%9K.GIYPAVDPLDSTSR.M2
*rpal_wt_anaer_auto_1_cleared_3c.1577.1577.126.6190.3944291493.251491.641140.054.5%1K.GIYPAVDPLDSTSR.M1
*rpal_wt_anaer_auto_1_pellet_3c.1240.1240.133.26540.5986581779.181778.98136.060.9%2R.MLSASIVGEEHYNTAR.M1
*rpal_wt_anaer_auto_1_pellet_2c.1271.1271.258.10350.6447371779.821778.981201.067.9%11R.MLSASIVGEEHYNTAR.M2
*rpal_wt_anaer_auto_1_membrane_3.895.895.131.54460.301706987.88988.2391200.083.3%10R.MVQQILQK.Y1
*rpal_wt_anaer_auto_1_pellet_full.752.752.250.5770.485731988.68988.2391220.086.7%4R.MVQQILQK.Y2
*rpal_wt_anaer_auto_1_pellet_2c.3600.3600.357.3920.3842162951.692952.41192.051.3%4K.YKSLQDIIAILGMDELSEEDKLTVAR.A3
*rpal_wt_anaer_auto_1_membrane_2.3845.3845.345.3230.3449932661.052661.051249.042.9%1K.SLQDIIAILGMDELSEEDKLTVAR.A3
*rpal_wt_anaer_auto_1_pellet_4.3837.3837.272.14040.6978912663.22661.051167.059.5%10K.SLQDIIAILGMDELSEEDKLTVAR.A2
*rpal_wt_anaer_auto_1_membrane_full.2742.2742.351.61220.3324393362.483360.881113.044.7%2K.IERFLSQPFFVAEVFTGSPGKFVDLADTIK.G3
*rpal_wt_anaer_auto_1_pellet_1.3044.3044.349.41650.4181261958.241959.251182.046.2%1R.FLSQPFFVAEVFTGSPGK.F3
*rpal_wt_anaer_auto_1_crude_3c.3161.3161.134.56720.5664241959.91959.2514.061.5%4R.FLSQPFFVAEVFTGSPGK.F1
*rpal_wt_anaer_auto_1_pellet_3.3140.3140.286.40750.7127711960.561959.251155.081.2%9R.FLSQPFFVAEVFTGSPGK.F2
*rpal_wt_anaer_auto_1_pellet_full.3402.3402.345.20210.2029442963.292962.421193.042.3%1R.FLSQPFFVAEVFTGSPGKFVDLADTIK.G3
*rpal_wt_anaer_auto_1_pellet_3c.3936.3936.248.68120.6461432963.82962.421216.045.7%8R.FLSQPFFVAEVFTGSPGKFVDLADTIK.G2
*rpal_wt_anaer_auto_1_membrane_full.3798.3798.362.09810.5002993323.493322.831139.055.0%1R.FLSQPFFVAEVFTGSPGKFVDLADTIKGFR.A3
*rpal_wt_anaer_auto_1_membrane_3.1708.1708.147.20060.5841471021.491022.191233.085.7%5K.FVDLADTIK.G1
*rpal_wt_anaer_auto_1_membrane_1.1842.1842.251.40680.585651024.251022.191171.082.4%4K.FVDLADTIK.G2
*rpal_wt_anaer_auto_1_membrane_1.2508.2508.246.46050.6979461382.171382.61214.068.2%1K.FVDLADTIKGFR.A2
*rpal_wt_anaer_auto_1_pellet_3c.3766.3766.249.1850.6243473016.273015.431202.040.4%8R.AICEGKYDHLPEAAFYMVGTIEEAVEK.G2
*rpal_wt_anaer_auto_1_membrane_full.3592.3592.382.07870.564773016.583015.431183.060.8%7R.AICEGKYDHLPEAAFYMVGTIEEAVEK.G3
*rpal_wt_anaer_auto_1_membrane_3.3746.3746.369.55520.5295943200.63200.661149.053.3%2R.AICEGKYDHLPEAAFYMVGTIEEAVEKGK.K3
*rpal_wt_anaer_auto_1_membrane_full.3604.3604.262.13470.6384632412.672413.711142.057.9%4K.YDHLPEAAFYMVGTIEEAVEK.G2
*rpal_wt_anaer_auto_1_membrane_full.3602.3602.356.64530.4507422413.432413.711251.047.6%2K.YDHLPEAAFYMVGTIEEAVEK.G3

URPA40346830081.7%410449017.0RPA4034 ABC transporter, periplasmic branched chain amino acid binding protein 4563239:4564471 forward MW:44901
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_cleared_full.1823.1823.284.66020.6408181848.311848.061190.073.5%9K.IGYIDPLSGGGASVGEGGLK.T2
*rpal_wt_anaer_auto_1_crude_4.1902.1902.149.17170.6556351849.981848.061164.069.0%8K.IGYIDPLSGGGASVGEGGLK.T1
*rpal_wt_anaer_auto_1_crude_full.3131.3131.249.61330.6099693241.313242.61112.033.9%8K.IGYIDPLSGGGASVGEGGLKTFQYLADELNAK.G2
*rpal_wt_anaer_auto_1_cleared_full.3148.3148.394.45170.6335083241.993242.611116.065.2%8K.IGYIDPLSGGGASVGEGGLKTFQYLADELNAK.G3
*rpal_wt_anaer_auto_1_cleared_full.3310.3310.366.57070.507683768.343768.261155.054.3%7K.IGYIDPLSGGGASVGEGGLKTFQYLADELNAKGGILGK.K3
*rpal_wt_anaer_auto_1_crude_4.1781.1781.151.40690.5415851412.921413.571151.088.9%8K.TFQYLADELNAK.G1
*rpal_wt_anaer_auto_1_cleared_full.1723.1723.272.14140.4741471415.231413.571255.081.8%7K.TFQYLADELNAK.G2
*rpal_wt_anaer_auto_1_cleared_2c.2325.2325.248.54110.2747631942.061939.22184.056.2%1K.TFQYLADELNAKGGILGK.K2
*rpal_wt_anaer_auto_1_cleared_2c.898.898.132.0210.4494461154.931155.381226.062.5%1K.KVEIVPLDNK.T1
*rpal_wt_anaer_auto_1_cleared_2c.1478.1478.266.02120.6554642493.082493.861103.061.5%9K.KVEIVPLDNKTNPQESLIQAQK.A2
*rpal_wt_anaer_auto_1_cleared_full.1423.1423.385.48820.6219642493.712493.861189.075.4%7K.KVEIVPLDNKTNPQESLIQAQK.A3
*rpal_wt_anaer_auto_1_cleared_2.1680.1680.362.95990.4403182363.122365.691178.059.0%3K.VEIVPLDNKTNPQESLIQAQK.A3
*rpal_wt_anaer_auto_1_cleared_full.1591.1591.263.88730.6071942364.982365.691100.063.2%7K.VEIVPLDNKTNPQESLIQAQK.A2
*rpal_wt_anaer_auto_1_cleared_1.953.953.245.27970.49871357.511357.51192.068.2%1K.TNPQESLIQAQK.A2
*rpal_wt_anaer_auto_1_cleared_4.837.837.138.97330.5527811358.231357.511150.072.2%4K.TNPQESLIQAQK.A1
*rpal_wt_anaer_auto_1_cleared_1.486.486.238.1340.195521701.95701.8011207.076.9%2K.AIDAGVR.Y2
*rpal_wt_anaer_auto_1_cleared_full.2463.2463.284.76840.7381112017.542016.221198.079.4%11R.YVTQGNGSSVAGALSDFLTK.Y2
*rpal_wt_anaer_auto_1_cleared_4.2764.2764.238.54780.5663412579.862578.81249.034.9%1R.YVTQGNGSSVAGALSDFLTKYNER.N2
*rpal_wt_anaer_auto_1_cleared_2.2767.2767.351.01580.3372032581.282578.81136.044.2%1R.YVTQGNGSSVAGALSDFLTKYNER.N3
*rpal_wt_anaer_auto_1_cleared_4.3353.3353.348.46640.342985041.815042.571176.052.4%1R.YVTQGNGSSVAGALSDFLTKYNERNPGKEVLYFNYAAVDPVLTNEK.C3
*rpal_wt_anaer_auto_1_cleared_3c.2215.2215.264.47520.6963453046.433045.381129.047.8%7K.YNERNPGKEVLYFNYAAVDPVLTNEK.C2
*rpal_wt_anaer_auto_1_cleared_2c.2223.2223.376.12540.552623046.893045.381248.065.7%4K.YNERNPGKEVLYFNYAAVDPVLTNEK.C3
*rpal_wt_anaer_auto_1_cleared_2.2352.2352.381.15180.5442682483.462482.81254.061.2%3R.NPGKEVLYFNYAAVDPVLTNEK.C3
*rpal_wt_anaer_auto_1_crude_3.2254.2254.279.12770.6891872484.312482.81233.064.1%5R.NPGKEVLYFNYAAVDPVLTNEK.C2
*rpal_wt_anaer_auto_1_cleared_2c.2549.2549.237.0260.4843032088.632086.351246.043.8%1K.EVLYFNYAAVDPVLTNEK.C2
*rpal_wt_anaer_auto_1_cleared_1.757.757.230.6240.385306949.0949.008165.062.5%1R.WDANSDIK.M2
*rpal_wt_anaer_auto_1_cleared_2c.2304.2304.346.35190.3550922799.62799.24134.047.8%1R.WDANSDIKMEALTNYMKDVPSIKK.V3
*rpal_wt_anaer_auto_1_cleared_3.1290.1290.133.84050.5110471101.351101.331177.078.6%7K.MEALTNYMK.D1
*rpal_wt_anaer_auto_1_cleared_full.1265.1265.233.48060.3887181102.121101.331235.062.5%1K.MEALTNYMK.D2
*rpal_wt_anaer_auto_1_crude_3c.1692.1692.128.69870.3791869.441869.261152.058.3%1K.MEALTNYMKDVPSIKK.V1
*rpal_wt_anaer_auto_1_pellet_2c.1846.1846.247.54690.4531361870.711869.261170.058.6%4K.MEALTNYMKDVPSIKK.V2
*rpal_wt_anaer_auto_1_cleared_3.1632.1632.274.90960.6386461918.581918.161214.075.9%4K.KVYLINQDYSFGQSVR.T2
*rpal_wt_anaer_auto_1_cleared_3c.1937.1937.136.11710.4908311789.791789.991136.071.4%1K.VYLINQDYSFGQSVR.T1
*rpal_wt_anaer_auto_1_cleared_full.1838.1838.279.16010.5676851789.81789.991218.076.9%10K.VYLINQDYSFGQSVR.T2
*rpal_wt_anaer_auto_1_crude_3c.1711.1711.138.55020.5669461972.621973.321105.057.7%5K.KRPDIEIVGDELHPLLK.I1
*rpal_wt_anaer_auto_1_cleared_full.1710.1710.392.21430.6145071974.331973.321214.067.8%7K.KRPDIEIVGDELHPLLK.I3
*rpal_wt_anaer_auto_1_crude_2c.1718.1718.266.57030.68321976.191973.321131.071.0%8K.KRPDIEIVGDELHPLLK.I2
*rpal_wt_anaer_auto_1_cleared_1.2217.2217.384.66340.656741847.951845.151251.072.0%3K.RPDIEIVGDELHPLLK.I3
*rpal_wt_anaer_auto_1_crude_2c.1144.1144.133.24910.4788581110.491111.281214.075.0%10K.ISDFAPYVAK.I1
*rpal_wt_anaer_auto_1_cleared_full.1143.1143.260.99720.6464311111.841111.281246.088.9%8K.ISDFAPYVAK.I2
*rpal_wt_anaer_auto_1_cleared_1c.3118.3118.360.85060.3627892371.352371.741158.044.3%3K.IKASGADTVVTGNWGQDIALLLK.A3
*rpal_wt_anaer_auto_1_cleared_3.3123.3123.258.94630.5179972374.062371.741154.053.7%7K.IKASGADTVVTGNWGQDIALLLK.A2
*rpal_wt_anaer_auto_1_cleared_2c.3340.3340.278.15970.6004592129.92130.411217.069.4%5K.ASGADTVVTGNWGQDIALLLK.A2
*rpal_wt_anaer_auto_1_crude_3c.1957.1957.139.35740.678331862.051863.081205.058.6%6K.VSWYTYYAGGAGGPTAIK.Q1
*rpal_wt_anaer_auto_1_cleared_full.1876.1876.271.53040.6479541863.081863.081231.069.7%2K.VSWYTYYAGGAGGPTAIK.Q2
*rpal_wt_anaer_auto_1_cleared_full.2541.2541.367.37870.5005624227.24228.671103.060.0%6K.VSWYTYYAGGAGGPTAIKQTGLNHQVFQITEGFANVDHK.Q3
*rpal_wt_anaer_auto_1_cleared_3.2021.2021.232.38040.4731412383.742384.6110.040.5%1K.QTGLNHQVFQITEGFANVDHK.Q2
*rpal_wt_anaer_auto_1_cleared_full.1918.1918.354.5040.4298842385.872384.611196.054.0%2K.QTGLNHQVFQITEGFANVDHK.Q3
*rpal_wt_anaer_auto_1_cleared_4.1838.1838.128.60150.4156291348.21348.591152.058.8%2R.AKVDLSLWYPR.A1
*rpal_wt_anaer_auto_1_crude_1c.1721.1721.261.56150.6717931349.831348.591237.085.0%1R.AKVDLSLWYPR.A2
*rpal_wt_anaer_auto_1_cleared_1c.2161.2161.245.60670.5841311149.391149.331247.076.5%1K.VDLSLWYPR.A2
*rpal_wt_anaer_auto_1_cleared_2c.2131.2131.130.36020.4821051149.871149.331129.071.4%1K.VDLSLWYPR.A1
*rpal_wt_anaer_auto_1_cleared_1c.653.653.132.53850.408501838.33839.0031240.078.6%5R.MFAAAAEK.A1
*rpal_wt_anaer_auto_1_cleared_1.622.622.241.5360.533027838.96839.0031181.075.0%1R.MFAAAAEK.A2
*rpal_wt_anaer_auto_1_cleared_full.3019.3019.366.88930.2897913151.653148.671179.059.7%1K.AKSLDPVKVAQALEDMKFEVLDGGEGIMR.K3
*rpal_wt_anaer_auto_1_cleared_1.2735.2735.347.30240.472871645.291644.931108.055.3%1K.SLDPVKVAQALEDMK.F3
*rpal_wt_anaer_auto_1_cleared_2.2559.2559.269.9590.7306621646.481644.93126.081.5%7K.SLDPVKVAQALEDMK.F2
*rpal_wt_anaer_auto_1_pellet_full.3187.3187.398.7920.6596192950.492949.421126.066.7%8K.SLDPVKVAQALEDMKFEVLDGGEGIMR.K3
*rpal_wt_anaer_auto_1_cleared_3c.3560.3560.265.17320.6955412950.662949.42151.047.9%6K.SLDPVKVAQALEDMKFEVLDGGEGIMR.K2
*rpal_wt_anaer_auto_1_cleared_2c.2548.2548.277.59620.6948062311.372309.671243.064.9%4K.VAQALEDMKFEVLDGGEGIMR.K2
*rpal_wt_anaer_auto_1_crude_4.1731.1731.130.06690.4737741322.581323.511152.060.0%1K.FEVLDGGEGIMR.K1
*rpal_wt_anaer_auto_1_crude_1c.1672.1672.259.71550.6538861324.21323.511119.077.3%2K.FEVLDGGEGIMR.K2
*rpal_wt_anaer_auto_1_cleared_3.2695.2695.375.86130.573033161.593160.421174.062.2%5R.KDDHQFFQPIYISSFGDIPAGQFDEEK.T3
*rpal_wt_anaer_auto_1_pellet_3c.2799.2799.252.42720.6362143163.283160.421216.041.7%6R.KDDHQFFQPIYISSFGDIPAGQFDEEK.T2
*rpal_wt_anaer_auto_1_cleared_4.2968.2968.261.04890.6815493032.573032.25196.045.7%3K.DDHQFFQPIYISSFGDIPAGQFDEEK.T2
*rpal_wt_anaer_auto_1_cleared_1c.1028.1028.129.65710.186916734.73734.833193.088.9%1K.TGWGWK.Q1
*rpal_wt_anaer_auto_1_cleared_full.1189.1189.137.52270.4449971422.591423.691201.070.0%11K.IDTAQTMLPTTCK.M1
*rpal_wt_anaer_auto_1_crude_full.1123.1123.245.61660.4153161423.071423.691245.062.5%6K.IDTAQTMLPTTCK.M2

URPA4397409881.7%388420246.3RPA4397 possible substrate binding protein of ABC transporter system 4952405:4953571 forward MW:42024
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_cleared_1c.1054.1054.131.27240.394345777.66777.9831115.090.0%2K.IALIYGK.T1
*rpal_wt_anaer_auto_1_cleared_1.1146.1146.233.51970.189918778.29777.9831216.071.4%1K.IALIYGK.T2
*rpal_wt_anaer_auto_1_pellet_2c.843.843.132.43280.580983949.98950.08146.084.6%4K.TGPLEAYAK.Q1
*rpal_wt_anaer_auto_1_cleared_1.888.888.243.94040.65491951.5950.08157.082.4%2K.TGPLEAYAK.Q2
*rpal_wt_anaer_auto_1_cleared_full.1946.1946.238.8620.2544231673.631673.95160.051.9%1K.QTETGLMMGLEYATK.G2
*rpal_wt_anaer_auto_1_cleared_4.2062.2062.127.22520.4513361673.731673.9511.056.5%2K.QTETGLMMGLEYATK.G1
*rpal_wt_anaer_auto_1_crude_3c.732.732.150.54320.5788241915.371915.241168.069.2%1R.KIVVITKDDQSKPDLSK.A1
*rpal_wt_anaer_auto_1_pellet_2c.808.808.254.70360.6518951916.271915.24116.063.3%3R.KIVVITKDDQSKPDLSK.A2
*rpal_wt_anaer_auto_1_crude_2c.1189.1189.231.48520.2675831789.941787.061194.042.9%1K.IVVITKDDQSKPDLSK.A2
*rpal_wt_anaer_auto_1_cleared_3.2576.2576.378.0660.5882753549.453548.841240.056.5%1K.AALAEAYQDDGADIAIGTSSSAAALADLPVAEENKK.I3
*rpal_wt_anaer_auto_1_crude_2.1974.1974.258.0710.6807391697.261696.981174.069.0%5K.ILIVEPAVADQITGEK.W2
*rpal_wt_anaer_auto_1_crude_3c.2047.2047.150.91130.588491697.461696.981148.083.3%4K.ILIVEPAVADQITGEK.W1
*rpal_wt_anaer_auto_1_cleared_full.2103.2103.345.48780.2557762154.492153.49190.043.5%1K.ILIVEPAVADQITGEKWNR.Y3
*rpal_wt_anaer_auto_1_cleared_3.2226.2226.268.8040.7350792154.682153.491176.073.5%6K.ILIVEPAVADQITGEKWNR.Y2
*rpal_wt_anaer_auto_1_cleared_1c.1231.1231.269.14940.6548661474.891475.61223.080.8%6R.NSSQDAISNAVAIGK.Q2
*rpal_wt_anaer_auto_1_pellet_3c.1231.1231.131.65190.5716151475.01475.6138.063.6%7R.NSSQDAISNAVAIGK.Q1
*rpal_wt_anaer_auto_1_cleared_1c.2623.2623.243.32040.5270911713.821711.921216.050.0%1K.QGVTIATLAQDYAFGR.D2
*rpal_wt_anaer_auto_1_cleared_2c.1321.1321.131.7140.3877911219.921220.411194.070.6%1R.DGVAAFKEALAK.T1
*rpal_wt_anaer_auto_1_cleared_1.1458.1458.234.20890.3450271222.571220.41157.050.0%1R.DGVAAFKEALAK.T2
*rpal_wt_anaer_auto_1_cleared_3.1958.1958.256.47910.6992732533.042531.741148.054.8%6K.TGATLATEEYVPTTTTDFTAVGQR.L2
*rpal_wt_anaer_auto_1_cleared_2.1992.1992.360.27550.4655812534.312531.741224.052.2%1K.TGATLATEEYVPTTTTDFTAVGQR.L3
*rpal_wt_anaer_auto_1_pellet_1.672.672.237.24420.313371361.491360.64120.059.1%1R.LFDALKDKPGKK.I2
*rpal_wt_anaer_auto_1_pellet_1.667.667.346.16480.2785521361.751360.641161.050.0%1R.LFDALKDKPGKK.I3
*rpal_wt_anaer_auto_1_cleared_3c.3051.3051.139.93640.4805541627.021626.941173.069.6%1K.IIWVIWAGGGDPLTK.L1
*rpal_wt_anaer_auto_1_cleared_2.3018.3018.260.71930.5955171627.121626.941252.060.7%1K.IIWVIWAGGGDPLTK.L2
*rpal_wt_anaer_auto_1_crude_4.2796.2796.148.84930.6069321951.781952.261144.070.0%6R.YGIELSTGGNILPALAAYK.R1
*rpal_wt_anaer_auto_1_crude_2c.2691.2691.261.45450.6174411952.561952.261253.062.9%3R.YGIELSTGGNILPALAAYK.R2
*rpal_wt_anaer_auto_1_cleared_2c.2488.2488.232.7360.4619562108.72108.451136.032.4%1R.YGIELSTGGNILPALAAYKR.L2
*rpal_wt_anaer_auto_1_crude_2c.2545.2545.348.2910.2239883629.913628.11153.047.2%2K.RLPGMEGATYYYYDIPKNPINEWLVTEHQK.R3
*rpal_wt_anaer_auto_1_cleared_3.2762.2762.245.64160.5421392215.882215.511215.045.7%1K.STDTEKLIAAMEGMEFDTPK.G2
*rpal_wt_anaer_auto_1_pellet_2c.2628.2628.256.69050.6346392403.42400.73146.055.3%3K.STDTEKLIAAMEGMEFDTPKGK.M2
*rpal_wt_anaer_auto_1_cleared_full.2355.2355.363.7050.521142403.622400.7310.055.4%4K.STDTEKLIAAMEGMEFDTPKGK.M3
*rpal_wt_anaer_auto_1_crude_2.1134.1134.347.48030.3158172296.352296.6815.049.0%1K.MVFRKEDHQALQSMYHFK.V3
*rpal_wt_anaer_auto_1_cleared_4.910.910.129.54380.3813591762.111762.991232.057.1%1R.KEDHQALQSMYHFK.V1
*rpal_wt_anaer_auto_1_cleared_1c.2456.2456.256.89420.6926241748.861750.091145.065.5%3K.VKVDPAVAWAVLEPVR.E2
*rpal_wt_anaer_auto_1_cleared_1c.2653.2653.366.01810.5292652122.512120.541186.054.7%3K.VKVDPAVAWAVLEPVRELK.I3
*rpal_wt_anaer_auto_1_crude_3.2559.2559.250.92070.4993862122.532120.54138.050.0%2K.VKVDPAVAWAVLEPVRELK.I2
*rpal_wt_anaer_auto_1_cleared_2c.2744.2744.252.46640.5270191894.021893.24159.060.0%2K.VDPAVAWAVLEPVRELK.I2
*rpal_wt_anaer_auto_1_cleared_4.820.820.138.97760.4922751458.251457.78198.077.8%3K.IEEMNIPIKNKK.-1
*rpal_wt_anaer_auto_1_cleared_1c.858.858.245.80750.5093931458.261457.7810.063.6%2K.IEEMNIPIKNKK.-2

URPA1659329881.6%196230165.1RPA1659 conserved unknown protein 1843683:1844273 reverse MW:23016
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_crude_1c.1122.1122.270.37740.7030421495.41495.681217.086.4%6M.SRIIELLNDEHR.N2
*rpal_wt_anaer_auto_1_cleared_1.1366.1366.367.11310.4476641497.461495.681234.061.5%3M.SRIIELLNDEHR.N3
*rpal_wt_anaer_auto_1_cleared_1c.1426.1426.346.03270.3617341950.491950.21157.047.8%1M.SRIIELLNDEHRNIAR.L3
*rpal_wt_anaer_auto_1_cleared_1.1257.1257.233.83290.3798461252.271252.411108.055.6%2R.IIELLNDEHR.N2
*rpal_wt_anaer_auto_1_cleared_4.3347.3347.134.29930.4466771675.91676.911163.061.9%2R.LLDVLEQELSVFDR.R1
*rpal_wt_anaer_auto_1_cleared_1c.3304.3304.271.30370.6882341679.051676.911218.080.0%5R.LLDVLEQELSVFDR.R2
*rpal_wt_anaer_auto_1_cleared_1c.3040.3040.351.07080.4362431833.851833.11243.056.5%2R.LLDVLEQELSVFDRR.E3
*rpal_wt_anaer_auto_1_cleared_3.3040.3040.230.32980.2989531834.111833.1117.040.7%1R.LLDVLEQELSVFDRR.E2
*rpal_wt_anaer_auto_1_cleared_1c.3774.3774.350.96050.405832062.92061.34139.047.1%1R.ERPDYEIFQAIIQYFK.E3
*rpal_wt_anaer_auto_1_cleared_full.3495.3495.265.36810.7031112063.252061.34127.075.0%2R.ERPDYEIFQAIIQYFK.E2
*rpal_wt_anaer_auto_1_cleared_full.1416.1416.383.67520.6002992918.732919.271111.063.6%4R.ILKERNPAVAGTVGDIEKEHELEVDR.L3
*rpal_wt_anaer_auto_1_cleared_3c.1447.1447.238.750.4980052922.232919.271193.037.0%1R.ILKERNPAVAGTVGDIEKEHELEVDR.L2
*rpal_wt_anaer_auto_1_crude_2.1290.1290.356.35230.4165212565.32564.771106.050.7%1K.ERNPAVAGTVGDIEKEHELEVDR.L3
*rpal_wt_anaer_auto_1_cleared_full.1455.1455.279.09150.7300492278.742279.471214.075.7%8R.NPAVAGTVGDIEKEHELEVDR.L2
*rpal_wt_anaer_auto_1_crude_full.1354.1354.362.4170.3781342280.92279.471167.051.5%2R.NPAVAGTVGDIEKEHELEVDR.L3
*rpal_wt_anaer_auto_1_cleared_3c.2220.2220.230.36510.3995542926.982924.2418.034.0%1R.NPAVAGTVGDIEKEHELEVDRLANFAK.V2
*rpal_wt_anaer_auto_1_cleared_2c.2226.2226.367.12480.4595622927.012924.241196.052.8%1R.NPAVAGTVGDIEKEHELEVDRLANFAK.V3
*rpal_wt_anaer_auto_1_crude_4.1486.1486.135.40950.4497411468.621469.641224.070.0%7K.VVDDVLADQELPR.Q1
*rpal_wt_anaer_auto_1_crude_2.1427.1427.273.05270.5723071471.281469.641187.087.0%8K.VVDDVLADQELPR.Q2
*rpal_wt_anaer_auto_1_cleared_2.1547.1547.348.25870.3633962354.392352.611190.038.1%1K.VVDDVLADQELPRQTFHAAAR.D3
*rpal_wt_anaer_auto_1_cleared_4.2934.2934.249.50980.6156152967.932968.451164.045.5%1R.RHMLKEEQLLFPAALETLTPEDWAK.I2
*rpal_wt_anaer_auto_1_cleared_full.2704.2704.372.34140.5272942970.322968.451124.057.7%3R.RHMLKEEQLLFPAALETLTPEDWAK.I3
*rpal_wt_anaer_auto_1_cleared_full.2883.2883.272.29880.6918792812.132812.261195.055.8%11R.HMLKEEQLLFPAALETLTPEDWAK.I2
*rpal_wt_anaer_auto_1_crude_3.3063.3063.373.87190.5425762814.82812.261216.062.0%8R.HMLKEEQLLFPAALETLTPEDWAK.I3
*rpal_wt_anaer_auto_1_cleared_2c.3444.3444.234.87010.4075352305.162302.59164.038.9%1K.EEQLLFPAALETLTPEDWAK.I2
*rpal_wt_anaer_auto_1_crude_3c.737.737.131.4450.4834381825.431825.991212.054.2%2R.IDDRKDPMFDGETASK.F1
*rpal_wt_anaer_auto_1_cleared_1c.783.783.347.310.25781826.891825.99129.051.0%1R.IDDRKDPMFDGETASK.F3
*rpal_wt_anaer_auto_1_cleared_3.722.722.235.52080.4575711826.971825.991101.042.9%1R.IDDRKDPMFDGETASK.F2
*rpal_wt_anaer_auto_1_cleared_3.2652.2652.368.72480.4556593048.23046.43128.057.7%2R.IDDRKDPMFDGETASKFQNLYATILR.W3
*rpal_wt_anaer_auto_1_crude_2c.2043.2043.136.57190.4282391238.851239.46164.075.0%4K.FQNLYATILR.W1
*rpal_wt_anaer_auto_1_cleared_full.1961.1961.258.2540.5644471239.981239.461253.078.9%4K.FQNLYATILR.W2
*rpal_wt_anaer_auto_1_cleared_3.466.466.128.39280.4807631105.291106.14196.073.3%1R.WEQETAADR.S1

URPA47492111081.2%314324175.4etfA electron transfer flavoprotein alpha-subunit, (ETFLS) 5360445:5361389 reverse MW:32417
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_cleared_1c.936.936.362.0220.5581152076.322076.321213.058.9%2M.ATLLIAEHDNAHLKDATNK.A3
*rpal_wt_anaer_auto_1_crude_3.816.816.251.7920.5869842078.022076.3211.057.6%2M.ATLLIAEHDNAHLKDATNK.A2
*rpal_wt_anaer_auto_1_cleared_full.354.354.129.96520.167851716.7716.8131108.076.9%4K.AVADAAAK.L1
*rpal_wt_anaer_auto_1_cleared_3.4980.4980.357.97430.521453881.773880.43171.049.4%4K.VLLAEAPAYEHDLAEPLAALIVSLAGSYDAIVAPATSR.F3
*rpal_wt_anaer_auto_1_crude_3c.3202.3202.145.40360.5485951630.041630.01172.073.9%10R.VAALLDVMQVSEIIK.V1
*rpal_wt_anaer_auto_1_crude_1.2814.2814.367.74870.5438691630.531630.01237.068.8%1R.VAALLDVMQVSEIIK.V3
*rpal_wt_anaer_auto_1_cleared_2.3155.3155.260.37270.6036931631.921630.01219.066.7%11R.VAALLDVMQVSEIIK.V2
*rpal_wt_anaer_auto_1_crude_2c.1719.1719.254.87780.5547122291.322290.6318.054.1%9K.VVAPDTFERPIYAGNAIQTVK.S2
*rpal_wt_anaer_auto_1_cleared_1c.1799.1799.364.39620.4600012292.812290.631192.057.8%5K.VVAPDTFERPIYAGNAIQTVK.S3
*rpal_wt_anaer_auto_1_cleared_full.2890.2890.262.06350.6302693426.953428.691180.035.9%10R.TSTFQATGEGGSAAIETVAAAADPGLSSFVGEEVAK.S2
*rpal_wt_anaer_auto_1_crude_3.3126.3126.358.02720.3828813430.293428.691213.045.3%2R.TSTFQATGEGGSAAIETVAAAADPGLSSFVGEEVAK.S3
*rpal_wt_anaer_auto_1_cleared_3c.2990.2990.366.91890.4983554501.514499.851132.052.6%2R.TSTFQATGEGGSAAIETVAAAADPGLSSFVGEEVAKSDRPELSSAK.I3
*rpal_wt_anaer_auto_1_crude_1c.2329.2329.348.37440.2993032338.532337.64168.050.0%1R.ENFTKYIEPLADKLGAGVGASR.A3
*rpal_wt_anaer_auto_1_crude_full.1309.1309.263.27320.6379321718.051717.96131.065.6%8K.YIEPLADKLGAGVGASR.A2
*rpal_wt_anaer_auto_1_crude_4.1395.1395.126.53460.3742471718.291717.961208.048.1%2K.YIEPLADKLGAGVGASR.A1
*rpal_wt_anaer_auto_1_cleared_1.1621.1621.390.78190.6398791718.381717.961220.073.6%5K.YIEPLADKLGAGVGASR.A3
*rpal_wt_anaer_auto_1_crude_4.1377.1377.144.11870.6154491950.161949.091114.063.0%7R.AAVDAGYAPNDWQVGQTGK.V1
*rpal_wt_anaer_auto_1_pellet_3.1400.1400.266.57780.6152111950.411949.091217.072.7%7R.AAVDAGYAPNDWQVGQTGK.V2
*rpal_wt_anaer_auto_1_pellet_2c.3951.3951.239.90320.5225622668.612669.161135.040.0%2K.VVAPELYIAVGISGAIQHLAGMKDSK.V2
*rpal_wt_anaer_auto_1_cleared_full.4078.4078.372.11120.6139064149.354148.71199.050.6%7K.VIVAINKDEDAPIFQVADYGLVADLYQAVPELTEELGK.L3
*rpal_wt_anaer_auto_1_crude_3c.4851.4851.359.1820.3336624448.524447.081153.058.6%9K.VIVAINKDEDAPIFQVADYGLVADLYQAVPELTEELGKLGK.-3

URPA201282580.6%108112506.5RPA2012 conserved unknown protein 2265975:2266301 forward MW:11249
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_crude_4.985.985.139.78790.5454751485.911485.631228.066.7%6M.AGQVEDLTPQEVAK.G1
*rpal_wt_anaer_auto_1_cleared_2.1025.1025.258.3680.6368521485.991485.631243.076.0%3M.AGQVEDLTPQEVAK.G2
*rpal_wt_anaer_auto_1_cleared_3c.3112.3112.233.78760.4687463447.373446.921130.028.6%2R.YLLVDVREPNEVAVEAYPDAVVVPLSTFDPK.A2
*rpal_wt_anaer_auto_1_cleared_3.3095.3095.380.39180.5619863448.253446.921213.061.7%3R.YLLVDVREPNEVAVEAYPDAVVVPLSTFDPK.A3
*rpal_wt_anaer_auto_1_cleared_1c.1519.1519.234.38330.5085261573.681573.86119.044.4%1K.AIPDPAGKEVVFACR.S2
*rpal_wt_anaer_auto_1_cleared_1c.1610.1610.242.88270.5913921708.51708.941195.055.2%3R.SVTASMAAQAAGLPYNR.H2
*rpal_wt_anaer_auto_1_cleared_3c.1571.1571.139.86790.5720671711.261708.94136.070.8%3R.SVTASMAAQAAGLPYNR.H1
*rpal_wt_anaer_auto_1_cleared_2c.1418.1418.142.06160.3397141052.731052.261185.076.5%4R.HLAGGILGWK.A1

URPA1442268280.4%270288016.9RPA1442 possible uridine monophosphate kinase 1598614:1599426 reverse MW:28801
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_pellet_1.2058.2058.369.5730.491541580.981580.851253.064.4%2M.AHTPAELEALLMQR.S3
*rpal_wt_anaer_auto_1_pellet_1c.2083.2083.235.07380.495091582.871580.85165.056.0%1M.AHTPAELEALLMQR.S2
*rpal_wt_anaer_auto_1_crude_3c.2033.2033.141.09780.533351583.271580.85139.071.4%4M.AHTPAELEALLMQR.S1
*rpal_wt_anaer_auto_1_pellet_4.2212.2212.132.22420.6065381940.771942.111129.057.1%4R.SMSDPELLAATEAATDYR.I1
*rpal_wt_anaer_auto_1_pellet_full.1938.1938.282.22220.7396211942.611942.111255.075.8%4R.SMSDPELLAATEAATDYR.I2
*rpal_wt_anaer_auto_1_pellet_2c.1166.1166.131.6290.359569970.54970.1981169.071.4%4R.ILPDATVIK.I1
*rpal_wt_anaer_auto_1_pellet_full.568.568.232.28610.415742977.68977.12910.064.7%1K.IGGQSMIDR.G2
*rpal_wt_anaer_auto_1_pellet_2c.705.705.127.08620.331512979.31977.129136.064.3%2K.IGGQSMIDR.G1
*rpal_wt_anaer_auto_1_pellet_3c.2905.2905.132.75840.5209081518.871517.77185.061.9%1R.AAVYPLVEEIVSAR.K1
*rpal_wt_anaer_auto_1_pellet_1c.2757.2757.239.14370.4220731518.981517.771144.056.0%2R.AAVYPLVEEIVSAR.K2
*rpal_wt_anaer_auto_1_pellet_full.760.760.236.30690.521664961.37959.1351224.063.2%3K.LLIGTGAGTR.A2
*rpal_wt_anaer_auto_1_crude_4.4343.4343.369.2510.5356043937.043935.581253.051.1%3R.ARHLYSIAAGLNLPAGVLSQLGASVASQNAEMLGQLLAK.H3
*rpal_wt_anaer_auto_1_pellet_full.4022.4022.263.43550.7314423706.493708.321173.034.8%6R.HLYSIAAGLNLPAGVLSQLGASVASQNAEMLGQLLAK.H2
*rpal_wt_anaer_auto_1_pellet_full.4017.4017.366.22410.5191513707.363708.32125.052.6%3R.HLYSIAAGLNLPAGVLSQLGASVASQNAEMLGQLLAK.H3
*rpal_wt_anaer_auto_1_pellet_3.2086.2086.287.19160.772991885.061885.171215.082.4%4K.HGISSVGDAGLSAVPLYLK.E2
*rpal_wt_anaer_auto_1_pellet_4.2109.2109.153.22570.6490811885.531885.171165.073.3%2K.HGISSVGDAGLSAVPLYLK.E1
*rpal_wt_anaer_auto_1_pellet_3c.2054.2054.138.89050.6231211636.761637.91137.071.4%3R.TDAGCYLMAEQFGCK.A1
*rpal_wt_anaer_auto_1_pellet_2c.1165.1165.253.46660.7008362301.912302.61157.054.3%2K.AMIYVKDENGLYTENPKTSK.N2
*rpal_wt_anaer_auto_1_pellet_2c.3393.3393.252.17440.636832010.52009.41219.061.3%1K.AKGLHDSILEFPVLDLLK.S2
*rpal_wt_anaer_auto_1_pellet_4.3652.3652.147.24510.5155671811.081810.141104.075.0%9K.GLHDSILEFPVLDLLK.S1
*rpal_wt_anaer_auto_1_pellet_3.3613.3613.266.45250.6947291811.761810.141247.075.9%8K.GLHDSILEFPVLDLLK.S2
*rpal_wt_anaer_auto_1_crude_1.3241.3241.366.38990.6037821812.881810.141222.058.0%5K.GLHDSILEFPVLDLLK.S3
*rpal_wt_anaer_auto_1_crude_3.1396.1396.234.60750.487791987.741988.3166.046.9%1R.HVREVQVVNGLVPGNLTR.A2
*rpal_wt_anaer_auto_1_pellet_4.1803.1803.129.26990.4763941596.371595.84165.054.2%2R.EVQVVNGLVPGNLTR.A1
*rpal_wt_anaer_auto_1_pellet_full.1605.1605.257.79810.6793981597.571595.841199.074.1%3R.EVQVVNGLVPGNLTR.A2
*rpal_wt_anaer_auto_1_pellet_2c.1312.1312.134.6840.4877151366.581367.551104.057.1%2R.ALAGEHVGTIITAN.-1

URPA15601913580.0%140163015.6cbbS ribulose-bisphosphate carboxylase small chain 1733171:1733593 forward MW:16301
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_pellet_4.3886.3886.270.26080.6767543278.13275.771241.047.1%27-.MRLTQGCFSFLPDLTDEQIAAQVQYALSK.G2
*rpal_wt_anaer_auto_1_pellet_3.3810.3810.383.94390.5769853278.123275.771240.064.5%16-.MRLTQGCFSFLPDLTDEQIAAQVQYALSK.G3
*rpal_wt_anaer_auto_1_pellet_full.3512.3512.379.2770.5567712987.512988.391177.064.9%7R.LTQGCFSFLPDLTDEQIAAQVQYALSK.G3
*rpal_wt_anaer_auto_1_pellet_4.3996.3996.270.45950.6963722988.792988.39174.052.2%28R.LTQGCFSFLPDLTDEQIAAQVQYALSK.G2
*rpal_wt_anaer_auto_1_pellet_4.1902.1902.128.52110.4353551755.181754.91162.052.2%1K.GWAVNLEFTDDPHPR.N1
*rpal_wt_anaer_auto_1_crude_1.1692.1692.372.61170.5941771755.241754.91241.058.8%4K.GWAVNLEFTDDPHPR.N3
*rpal_wt_anaer_auto_1_pellet_full.1682.1682.263.12720.6662991756.861754.91241.070.4%9K.GWAVNLEFTDDPHPR.N2
*rpal_wt_anaer_auto_1_pellet_full.4038.4038.362.61680.4670143466.923467.031118.056.6%2R.NTYWDMWGLPMFDLQDAAGVMMELNECRK.I3
*rpal_wt_anaer_auto_1_pellet_4.4614.4614.238.89640.5271443467.163467.03196.032.7%1R.NTYWDMWGLPMFDLQDAAGVMMELNECRK.I2
*rpal_wt_anaer_auto_1_crude_1c.1241.1241.260.25810.6093651578.671578.681213.076.0%10R.LSAFDSSHGWESVR.L2
*rpal_wt_anaer_auto_1_crude_full.1199.1199.354.8660.273221580.681578.681216.065.9%2R.LSAFDSSHGWESVR.L3
*rpal_wt_anaer_auto_1_crude_3c.1262.1262.139.87030.5566421580.961578.681162.066.7%9R.LSAFDSSHGWESVR.L1
*rpal_wt_anaer_auto_1_pellet_1.1049.1049.241.42410.5628461073.791074.311224.075.0%4R.LSFIVNRPK.D2
*rpal_wt_anaer_auto_1_pellet_2c.1080.1080.130.41730.4363311073.931074.31120.078.6%2R.LSFIVNRPK.D1
*rpal_wt_anaer_auto_1_pellet_full.1222.1222.240.2740.4752571775.851776.051216.048.1%5R.LSFIVNRPKDEPGFR.L2
*rpal_wt_anaer_auto_1_pellet_4.1353.1353.126.47220.4056561776.061776.051128.054.5%1R.LSFIVNRPKDEPGFR.L1
*rpal_wt_anaer_auto_1_pellet_1.1383.1383.348.90710.4087121776.351776.051231.056.5%1R.LSFIVNRPKDEPGFR.L3
*rpal_wt_anaer_auto_1_crude_full.483.483.132.91410.4923851093.691094.171144.068.8%4R.AYSADKPEGR.R1
*rpal_wt_anaer_auto_1_pellet_1.369.369.244.25780.554891096.61094.171220.068.4%2R.AYSADKPEGR.R2

URPA2801246780.0%165155609.1RPA2801 Collagen triple helix repeat 3176255:3176752 reverse MW:15559
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_crude_1c.519.519.133.45140.123603717.48717.8411232.090.9%3R.LAIESGK.L1
*rpal_wt_anaer_auto_1_cleared_2c.1389.1389.143.18790.606351328.831329.621233.070.0%7R.LAIESGKLVITGK.T1
*rpal_wt_anaer_auto_1_crude_1.1233.1233.252.91650.6704341329.381329.621114.069.6%4R.LAIESGKLVITGK.T2
*rpal_wt_anaer_auto_1_cleared_1c.601.601.131.85080.269682631.36630.8061233.090.0%3K.LVITGK.T1
*rpal_wt_anaer_auto_1_pellet_2.613.613.231.42730.3084361621.361619.77118.041.4%1K.TTKAGQEVEVVGTGDK.A2
*rpal_wt_anaer_auto_1_cleared_full.599.599.241.88180.3411051818.011819.0210.046.9%1K.TTKAGQEVEVVGTGDKAK.S2
*rpal_wt_anaer_auto_1_crude_3c.637.637.139.21710.6076021818.931819.02196.066.7%2K.TTKAGQEVEVVGTGDKAK.S1
*rpal_wt_anaer_auto_1_pellet_3.523.523.147.18570.5803861287.791289.391247.070.0%5K.AGQEVEVVGTGDK.A1
*rpal_wt_anaer_auto_1_pellet_1c.628.628.262.11820.7011211488.051488.641245.074.1%3K.AGQEVEVVGTGDKAK.S2
*rpal_wt_anaer_auto_1_crude_3c.582.582.152.86260.6251741489.071488.641105.082.6%7K.AGQEVEVVGTGDKAK.S1
*rpal_wt_anaer_auto_1_pellet_4.1811.1811.149.4670.6871251501.91501.741153.076.2%3R.FKFSLSDVPETCK.L1
*rpal_wt_anaer_auto_1_pellet_2.1762.1762.261.07810.6273281503.551501.741237.075.0%2R.FKFSLSDVPETCK.L2
*rpal_wt_anaer_auto_1_crude_3c.2353.2353.127.71870.4832121969.961971.321137.053.8%1R.FKFSLSDVPETCKLDLK.S1
*rpal_wt_anaer_auto_1_pellet_2c.2483.2483.249.43840.6400091971.441971.321222.058.1%2R.FKFSLSDVPETCKLDLK.S2
*rpal_wt_anaer_auto_1_cleared_1c.2399.2399.359.35080.5191121972.051971.321183.055.4%3R.FKFSLSDVPETCKLDLK.S3
*rpal_wt_anaer_auto_1_pellet_1.1546.1546.243.04020.5378581224.991226.391241.070.0%3K.FSLSDVPETCK.L2
*rpal_wt_anaer_auto_1_crude_3c.2223.2223.127.26870.418231695.161695.971182.047.8%3K.FSLSDVPETCKLDLK.S1
*rpal_wt_anaer_auto_1_pellet_2.2189.2189.238.08490.5407791696.971695.971152.051.9%1K.FSLSDVPETCKLDLK.S2
*rpal_wt_anaer_auto_1_pellet_3c.2379.2379.125.7070.5683041690.711689.9311.052.0%1K.SGTETLTGLLVANCGPR.G1
*rpal_wt_anaer_auto_1_pellet_1c.2322.2322.257.49940.6085021691.451689.931219.061.3%6K.SGTETLTGLLVANCGPR.G2
*rpal_wt_anaer_auto_1_pellet_2c.2118.2118.241.45230.4613741971.981972.271248.045.7%1K.SGTETLTGLLVANCGPRGPK.G2
*rpal_wt_anaer_auto_1_pellet_4.1184.1184.357.14610.4598044514.394513.93197.048.7%2R.GPKGEAGAAGAPGPAGPAGPAGPAGPAGPKGDAGPAGPAGPAGPAGPSGATGPAGPK.G3
*rpal_wt_anaer_auto_1_pellet_4.1258.1258.345.79120.382034230.834231.5910.038.4%1K.GEAGAAGAPGPAGPAGPAGPAGPAGPKGDAGPAGPAGPAGPAGPSGATGPAGPK.G3
*rpal_wt_anaer_auto_1_cleared_3.876.876.359.78140.4485043066.883066.271232.046.6%2K.GDAGPAGPAGPAGPAGPSGATGPAGPKGEAGEAAPKN.-3

URPA05573916479.5%332345448.7cysK cysteine synthase, cytosolic O-acetylserine(thiol)lyase 618596:619594 forward MW:34544
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_crude_1c.442.442.125.9590.464371835.56835.9331128.064.3%1M.SSAATASIK.A1
*rpal_wt_anaer_auto_1_cleared_full.400.400.233.91580.3345791232.461232.39118.059.1%1K.AVAEAPAHRPGR.G2
*rpal_wt_anaer_auto_1_cleared_3.1780.1780.253.88760.6404131984.481983.191192.061.3%3R.GRVYESIADAYGDTPLVR.L2
*rpal_wt_anaer_auto_1_crude_4.1808.1808.129.28640.5162871769.211769.951166.058.3%5R.VYESIADAYGDTPLVR.L1
*rpal_wt_anaer_auto_1_cleared_1c.1855.1855.272.34470.6863121769.971769.951254.073.3%9R.VYESIADAYGDTPLVR.L2
*rpal_wt_anaer_auto_1_cleared_2c.568.568.133.43480.4296631289.921290.5115.064.7%6R.LNRLPQQHGVK.A1
*rpal_wt_anaer_auto_1_cleared_1.516.516.241.13180.5902781290.391290.51118.060.0%3R.LNRLPQQHGVK.A2
*rpal_wt_anaer_auto_1_cleared_1.521.521.349.42690.455041290.681290.511185.060.6%1R.LNRLPQQHGVK.A3
*rpal_wt_anaer_auto_1_cleared_3.1352.1352.129.16930.4856131254.871255.411232.058.8%2K.LEYFNPASSVK.D1
*rpal_wt_anaer_auto_1_cleared_1.1521.1521.250.03910.6421961255.521255.411146.075.0%2K.LEYFNPASSVK.D2
*rpal_wt_anaer_auto_1_pellet_full.1070.1070.246.83890.3051121529.11526.691148.066.7%3K.LEYFNPASSVKDR.I2
*rpal_wt_anaer_auto_1_cleared_1.1972.1972.349.54090.5230081535.431533.91236.058.1%1R.LKLVMPESMSIER.R3
*rpal_wt_anaer_auto_1_pellet_1c.1835.1835.235.1520.4272131536.441533.91214.045.8%3R.LKLVMPESMSIER.R2
*rpal_wt_anaer_auto_1_pellet_2c.1612.1612.125.97780.4382971292.541292.561100.052.9%1K.LVMPESMSIER.R1
*rpal_wt_anaer_auto_1_pellet_full.1368.1368.242.10170.593861292.991292.561138.065.0%4K.LVMPESMSIER.R2
*rpal_wt_anaer_auto_1_pellet_1.4269.4269.355.60120.4946781679.671678.051254.047.9%1K.MLAFLGAELVLTEAAK.G3
*rpal_wt_anaer_auto_1_cleared_1c.4293.4293.234.5230.5465251680.851678.051140.044.8%5K.MLAFLGAELVLTEAAK.G2
*rpal_wt_anaer_auto_1_crude_3.2310.2310.266.83520.6824742371.872371.761250.057.5%6K.GAVAKAEELVAATPNAVMPQQFK.N2
*rpal_wt_anaer_auto_1_cleared_full.1753.1753.259.62880.7124761944.41945.251186.063.6%9K.AEELVAATPNAVMPQQFK.N2
*rpal_wt_anaer_auto_1_crude_4.1838.1838.146.71040.580471946.991945.251198.064.3%10K.AEELVAATPNAVMPQQFK.N1
*rpal_wt_anaer_auto_1_cleared_1.2032.2032.349.75120.4533941947.551945.251184.046.6%1K.AEELVAATPNAVMPQQFK.N3
*rpal_wt_anaer_auto_1_cleared_4.3394.3394.369.0080.5204993878.083875.29191.053.1%3R.RTTAEEIWNDTDGAVDIFVAGVGTGGTVSGVGQVLKPR.K3
*rpal_wt_anaer_auto_1_pellet_full.3217.3217.370.22580.5639013718.273719.11196.049.5%3R.TTAEEIWNDTDGAVDIFVAGVGTGGTVSGVGQVLKPR.K3
*rpal_wt_anaer_auto_1_crude_2.1165.1165.352.73610.3739512586.12584.98135.054.8%1R.KASLKVVAVEPEESPVLSGGAPGPHK.I3
*rpal_wt_anaer_auto_1_crude_full.2250.2250.364.47480.4075414138.064137.771154.052.7%3R.KASLKVVAVEPEESPVLSGGAPGPHKIQGIGAGFVPDILDR.S3
*rpal_wt_anaer_auto_1_cleared_2c.1224.1224.271.92520.7407132057.472057.311153.067.6%9K.VVAVEPEESPVLSGGAPGPHK.I2
*rpal_wt_anaer_auto_1_cleared_1c.1248.1248.364.59750.5420712057.612057.311226.052.2%6K.VVAVEPEESPVLSGGAPGPHK.I3
*rpal_wt_anaer_auto_1_crude_3c.2641.2641.235.05040.451573608.673610.1118.026.6%1K.VVAVEPEESPVLSGGAPGPHKIQGIGAGFVPDILDR.S2
*rpal_wt_anaer_auto_1_pellet_2c.2730.2730.375.09180.4913633611.083610.111148.060.9%9K.VVAVEPEESPVLSGGAPGPHKIQGIGAGFVPDILDR.S3
*rpal_wt_anaer_auto_1_cleared_full.2440.2440.272.540.6894071571.851571.821248.082.1%5K.IQGIGAGFVPDILDR.S2
*rpal_wt_anaer_auto_1_pellet_3c.2709.2709.132.35960.3178691572.581571.82142.060.9%6K.IQGIGAGFVPDILDR.S1
*rpal_wt_anaer_auto_1_pellet_3.2160.2160.250.44210.5383242015.912016.31184.052.9%12R.SVIDEVVKIPSATAIETSR.A2
*rpal_wt_anaer_auto_1_crude_full.1971.1971.379.43210.6368472017.532016.31249.065.0%8R.SVIDEVVKIPSATAIETSR.A3
*rpal_wt_anaer_auto_1_cleared_full.895.895.243.33540.4659791145.931146.29121.061.9%1K.IPSATAIETSR.A2
*rpal_wt_anaer_auto_1_cleared_full.2010.2010.382.66410.6066412773.352773.121100.061.2%7R.HEGIPGGISSGAAIAAAIELGKRPENAGK.T3
*rpal_wt_anaer_auto_1_pellet_4.2103.2103.266.12460.6339622773.812773.1212.049.0%5R.HEGIPGGISSGAAIAAAIELGKRPENAGK.T2
*rpal_wt_anaer_auto_1_pellet_2c.1987.1987.128.64020.4118621319.041319.54132.068.4%2K.TIVAIVPSFSER.Y1
*rpal_wt_anaer_auto_1_pellet_full.1683.1683.241.93250.4456191321.421319.541240.059.1%5K.TIVAIVPSFSER.Y2
*rpal_wt_anaer_auto_1_crude_full.2478.2478.125.53910.3836741127.661128.31166.071.4%1R.YLSTVLFEGV.-1

URPA43094318079.2%390419337.1serC phosphoserine aminotransferase, 4859855:4861027 reverse MW:41933
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_pellet_full.735.735.256.55930.6088072116.652115.421190.056.8%7M.TVAKPASRPNAPQFSSGPCAK.R2
*rpal_wt_anaer_auto_1_pellet_full.1150.1150.254.63360.5816621808.851808.051192.069.0%5K.RPGWTPENLKDAPLGR.S2
*rpal_wt_anaer_auto_1_pellet_1c.1337.1337.373.60430.5425611809.611808.051222.068.6%6K.RPGWTPENLKDAPLGR.S3
*rpal_wt_anaer_auto_1_crude_1.1344.1344.232.13790.4792881043.71043.31172.052.9%1K.LKLAIDLTR.D2
*rpal_wt_anaer_auto_1_pellet_3.1455.1455.134.1620.345481043.851043.31100.078.6%1K.LKLAIDLTR.D1
*rpal_wt_anaer_auto_1_cleared_full.1234.1234.243.79630.4949091149.521149.291230.066.7%5R.DVLEVPADYK.I2
*rpal_wt_anaer_auto_1_crude_2c.1258.1258.138.94660.6076961150.251149.29190.075.0%8R.DVLEVPADYK.I1
*rpal_wt_anaer_auto_1_cleared_4.4873.4873.347.61830.3417764517.814516.171142.043.0%1K.IGIVPASDTGAVEMALWSLLGPRPVTTLAWESFGDGWVGDITK.E3
*rpal_wt_anaer_auto_1_pellet_2c.1110.1110.127.1130.3494381041.891042.261165.057.1%2K.ELKLPNVTK.L1
*rpal_wt_anaer_auto_1_pellet_4.1247.1247.143.56660.5317471390.61391.611229.078.9%4K.LKAGYGEIPDLSK.V1
*rpal_wt_anaer_auto_1_pellet_1c.1314.1314.249.0920.5597551392.421391.611188.066.7%2K.LKAGYGEIPDLSK.V2
*rpal_wt_anaer_auto_1_pellet_2c.1327.1327.135.33450.4148131149.631150.271150.070.6%2K.AGYGEIPDLSK.V1
*rpal_wt_anaer_auto_1_pellet_2c.1157.1157.131.14970.380411944.01943.0911209.075.0%2R.VPNADWIK.A1
*rpal_wt_anaer_auto_1_pellet_3.3256.3256.364.67250.4336083476.443475.911253.057.8%4R.VPNADWIKADREGLTICDATSAAFAQPLDWAK.L3
*rpal_wt_anaer_auto_1_cleared_2c.2736.2736.260.93360.473872553.282551.841226.051.2%5K.ADREGLTICDATSAAFAQPLDWAK.L2
*rpal_wt_anaer_auto_1_pellet_2c.3097.3097.245.81250.5732192210.592209.481232.048.6%2R.EGLTICDATSAAFAQPLDWAK.L2
*rpal_wt_anaer_auto_1_crude_full.1790.1790.137.04410.3963361223.71223.411182.080.0%7K.LDVVTFSWQK.A1
*rpal_wt_anaer_auto_1_pellet_1.1963.1963.257.44540.6343331224.791223.411238.077.8%4K.LDVVTFSWQK.A2
*rpal_wt_anaer_auto_1_crude_4.1521.1521.146.90480.599991593.781593.89197.070.8%10K.ALGGEAAHGMLILSPR.A1
*rpal_wt_anaer_auto_1_pellet_full.1433.1433.378.20620.6168631594.661593.891167.064.7%4K.ALGGEAAHGMLILSPR.A3
*rpal_wt_anaer_auto_1_pellet_2.1540.1540.273.29990.685361594.981593.891230.072.4%9K.ALGGEAAHGMLILSPR.A2
*rpal_wt_anaer_auto_1_crude_4.1757.1757.130.24330.5320851449.791450.71198.061.1%7R.LESYTPTWPMPK.I1
*rpal_wt_anaer_auto_1_crude_2.1672.1672.241.710.5512951452.951450.71176.068.2%3R.LESYTPTWPMPK.I2
*rpal_wt_anaer_auto_1_pellet_3c.4162.4162.230.72940.5106023662.113660.23164.027.6%1K.GGKLMEGIFQGETINTPSMLCVEDYIDALQWAK.S2
*rpal_wt_anaer_auto_1_cleared_3.3942.3942.359.13070.442673662.843660.231193.044.7%1K.GGKLMEGIFQGETINTPSMLCVEDYIDALQWAK.S3
*rpal_wt_anaer_auto_1_pellet_3c.4375.4375.244.71820.6253233419.483417.95177.034.0%4K.LMEGIFQGETINTPSMLCVEDYIDALQWAK.S2
*rpal_wt_anaer_auto_1_cleared_2c.4155.4155.361.17230.3330233420.663417.951206.049.4%3K.LMEGIFQGETINTPSMLCVEDYIDALQWAK.S3
*rpal_wt_anaer_auto_1_crude_1c.1037.1037.247.89770.5988351071.571071.311112.076.2%4K.SVGGLKGLIAR.A2
*rpal_wt_anaer_auto_1_crude_3.1013.1013.135.49280.4574451071.811071.31142.070.6%2K.SVGGLKGLIAR.A1
*rpal_wt_anaer_auto_1_cleared_3.825.825.131.51920.346008961.21961.1061188.066.7%7K.VLTDWQAK.T1
*rpal_wt_anaer_auto_1_pellet_1.2146.2146.237.22140.6136521076.211077.271104.068.8%2K.TPWVDFLAK.D2
*rpal_wt_anaer_auto_1_cleared_1c.2311.2311.371.9530.536241629.851629.9187.066.7%8K.TPWVDFLAKDPAIR.S3
*rpal_wt_anaer_auto_1_pellet_2.2222.2222.258.49030.6009271630.551629.91196.068.0%9K.TPWVDFLAKDPAIR.S2
*rpal_wt_anaer_auto_1_crude_3c.2253.2253.129.25410.435051631.721629.9149.054.5%3K.TPWVDFLAKDPAIR.S1
*rpal_wt_anaer_auto_1_pellet_full.1762.1762.273.93090.7186481943.21944.191248.076.5%9K.VVDPAITALSPEAQADFAK.K2
*rpal_wt_anaer_auto_1_pellet_4.2028.2028.138.74960.582051944.531944.191136.058.6%5K.VVDPAITALSPEAQADFAK.K1
*rpal_wt_anaer_auto_1_cleared_1.2200.2200.367.17590.5993091946.051944.191251.061.4%5K.VVDPAITALSPEAQADFAK.K3
*rpal_wt_anaer_auto_1_pellet_full.1554.1554.268.09150.5593242072.292072.371236.066.7%7K.VVDPAITALSPEAQADFAKK.L2
*rpal_wt_anaer_auto_1_crude_full.1556.1556.361.78640.5141972072.332072.371178.050.0%5K.VVDPAITALSPEAQADFAKK.L3
*rpal_wt_anaer_auto_1_crude_2.534.534.132.6760.425034858.07858.071241.071.4%1K.KLVAAVEK.E1
*rpal_wt_anaer_auto_1_crude_3.1551.1551.238.19930.5649841995.351995.2913.042.9%1K.KLVAAVEKEGAGFDLGAYR.D2
*rpal_wt_anaer_auto_1_pellet_4.1848.1848.230.49710.3039732702.292702.09150.028.3%1K.KLVAAVEKEGAGFDLGAYRDAPPGLR.I2
*rpal_wt_anaer_auto_1_crude_1c.537.537.125.02750.444175664.38661.7341136.080.0%1K.ASLTQAA.-1

URPA40454526878.9%426447027.7RPA4045 possible branched-chain amino acid ABC transport system substrate-binding protein 4576388:4577668 forward MW:44701
FilenameXCorrDeltCNObsM+H+CalcM+H+SpRSpScoreIon%#Sequence
*rpal_wt_anaer_auto_1_crude_1.1277.1277.351.54640.3018041784.581782.911123.050.0%1K.QLNVDTNDYGYQVPR.A3
*rpal_wt_anaer_auto_1_cleared_2c.1419.1419.272.56880.7072781785.631782.911186.081.5%12K.QLNVDTNDYGYQVPR.A2
*rpal_wt_anaer_auto_1_crude_1c.567.567.134.9740.400406806.49807.0241138.090.9%4R.AIALYKK.W1
*rpal_wt_anaer_auto_1_cleared_1.573.573.233.34560.264158808.32807.0241206.069.2%2R.AIALYKK.W2
*rpal_wt_anaer_auto_1_cleared_4.3877.3877.366.21570.5621495015.855016.511211.056.3%7K.WSGGDKVAAIMGWGTADTEALTGFLANDKIPDLSGSYAAALTDPEGTSGK.A3
*rpal_wt_anaer_auto_1_cleared_3c.3770.3770.375.21420.5308744387.154385.85161.050.0%8K.VAAIMGWGTADTEALTGFLANDKIPDLSGSYAAALTDPEGTSGK.A3
*rpal_wt_anaer_auto_1_cleared_3.2135.2135.259.2820.660832165.372165.41177.063.6%9K.AKPAPYNFFYGPSYSDALR.A2
*rpal_wt_anaer_auto_1_cleared_1c.2159.2159.371.36310.5298332167.12165.411251.057.6%6K.AKPAPYNFFYGPSYSDALR.A3
*rpal_wt_anaer_auto_1_crude_4.2046.2046.152.98120.6026871350.371350.541247.076.5%8R.AELMWAAEDWK.A1
*rpal_wt_anaer_auto_1_cleared_1.2275.2275.274.48950.6578621351.111350.541247.085.0%7R.AELMWAAEDWK.A2
*rpal_wt_anaer_auto_1_crude_full.1526.1526.231.41350.4244581550.271549.791102.045.5%1R.AELMWAAEDWKAK.G2
*rpal_wt_anaer_auto_1_cleared_4.1724.1724.133.09320.219381552.21549.79148.070.0%1R.AELMWAAEDWKAK.G1
*rpal_wt_anaer_auto_1_cleared_2.808.808.267.14070.7422071680.581680.931125.075.0%8K.FVHMGANHPYPNAPK.A2
*rpal_wt_anaer_auto_1_pellet_4.847.847.151.28520.6669431680.731680.93133.078.3%8K.FVHMGANHPYPNAPK.A1
*rpal_wt_anaer_auto_1_cleared_full.804.804.353.66740.4612241683.481680.931124.052.1%5K.FVHMGANHPYPNAPK.A3
*rpal_wt_anaer_auto_1_cleared_3.4135.4135.351.60620.4080673589.683591.211228.041.9%1K.AAGEAIAKELGFEVLPPLVFALAPGDYSAQCLSLK.S3
*rpal_wt_anaer_auto_1_cleared_full.3786.3786.249.86220.4816743589.753591.211197.031.1%11K.AAGEAIAKELGFEVLPPLVFALAPGDYSAQCLSLK.S2
*rpal_wt_anaer_auto_1_cleared_2c.4183.4183.370.27240.5180952878.972879.391161.052.6%8K.ELGFEVLPPLVFALAPGDYSAQCLSLK.S3
*rpal_wt_anaer_auto_1_cleared_3c.4225.4225.257.16020.5635792881.622879.391170.043.8%19K.ELGFEVLPPLVFALAPGDYSAQCLSLK.S2
*rpal_wt_anaer_auto_1_crude_3.1791.1791.284.33530.7025472121.972120.351209.075.7%15K.SSGANYAYLGNTAASNISVMK.A2
*rpal_wt_anaer_auto_1_cleared_2c.2665.2665.246.84260.5895742242.322241.511168.052.9%3K.AAGVDVQFMSNVWGMDENAAK.T2
*rpal_wt_anaer_auto_1_cleared_full.1708.1708.260.69410.619941403.141403.581251.076.0%9K.TAGDAADGVIFPLR.T2
*rpal_wt_anaer_auto_1_cleared_4.1807.1807.137.1640.3556021405.521403.581192.071.4%10K.TAGDAADGVIFPLR.T1
*rpal_wt_anaer_auto_1_crude_full.670.670.131.99190.371275789.69789.9118.083.3%5R.TAVAWGGK.A1
*rpal_wt_anaer_auto_1_cleared_3.856.856.152.98990.6133191273.821274.531149.089.5%4R.TAVAWGGKAPGMK.T1
*rpal_wt_anaer_auto_1_cleared_1.991.991.253.35820.5756921274.161274.531203.069.6%6R.TAVAWGGKAPGMK.T2
*rpal_wt_anaer_auto_1_cleared_full.423.423.131.53930.389352805.67805.9041158.081.8%8K.TVEEISK.I1
*rpal_wt_anaer_auto_1_cleared_full.2675.2675.245.77540.4880182741.062742.1910.0