DTASelect v1.9
/auto/gtl/ms/gtl_rpal/gtl_rpal_proteome/global_analysis/dbd_tryptic_1/Contrast/pairwise/contrast-wt_anaer_light-wt_anaer_auto-p2_verbose
Included directories:LocationHidden
wt_anaer_light_1/auto/gtl/ms/gtl_rpal/gtl_rpal_proteome/global_analysis/dbd_tryptic_1/wt_anaer_light_1false
wt_anaer_light_2/auto/gtl/ms/gtl_rpal/gtl_rpal_proteome/global_analysis/dbd_tryptic_1/wt_anaer_light_2false
wt_anaer_auto_1/auto/gtl/ms/gtl_rpal/gtl_rpal_proteome/global_analysis/dbd_tryptic_1/wt_anaer_auto_1false
wt_anaer_auto_2/auto/gtl/ms/gtl_rpal/gtl_rpal_proteome/global_analysis/dbd_tryptic_1/wt_anaer_auto_2false

Criteria sets:

2pep_def
-p 2 -1 25 -2 30 -3 45
trueUse criteria
25.0Minimum +1 XCorr
30.0Minimum +2 XCorr
45.0Minimum +3 XCorr
0.08Minimum DeltCN
1Minimum charge state
3Maximum charge state
0.0Minimum ion proportion
1000Maximum Sp rank
-1.0Minimum Sp score
IncludeModified peptide inclusion
AnyTryptic status requirement
trueMultiple, ambiguous IDs allowed
IgnorePeptide validation handling
XCorrPurge duplicate peptides by protein
falseInclude only loci with unique peptide
falseRemove subset proteins
IgnoreLocus validation handling
0Minimum modified peptides per locus
10Minimum redundancy for low coverage loci
2Minimum peptides per locus

Numbers in table report the percentage of residues in protein sequence that are represented by at least one peptide passing the criteria.
Jump to summary table.
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA000238.460.558.649.564.8dnaN DNA polymerase III beta subunit 2332:3450 forward MW:40401
K.ATDLDLEVTETLPAETATAGSTTVPAHMFYDIVR.K +237.0153
K.ATDLDLEVTETLPAETATAGSTTVPAHMFYDIVR.K +348.809851.228955.1453
K.DFEAAVDR.V +230.3741
K.LADPGSPTLIQDR.D +254.934952.898644.4906
K.LADPGSPTLIQDRDSK.S +237.064339.036731.568
K.LADPGSPTLIQDRDSK.S +345.3846
K.LIDGTFPDYGR.V +126.0038
K.LIDGTFPDYGR.V +242.810446.11551.767541.7856
K.SALYVLMPMRV.- +140.337538.467332.0094
K.SALYVLMPMRV.- +236.469939.39438.026430.3719
K.SLSHVHR.V +230.378434.4611
R.AENAQLALK.A +127.785227.2992
R.AENAQLALK.A +252.6227
R.FTLGNVVLTSK.L +131.55827.909926.43830.0472
R.FTLGNVVLTSK.L +247.599748.644336.928642.9309
R.KLPDGSQIVLESDGDR.S +250.425755.9511
R.KLPDGSQIVLESDGDR.S +345.657
R.LAQLDLTLPSGADGMPGVIVPR.K +263.020757.343963.433550.8319
R.LAQLDLTLPSGADGMPGVIVPR.K +349.3872
R.NTIPILGNVLVR.A +232.198230.6808
R.SRFTLQTLPESDFPDLAAGEMSHAFR.L +237.3659
R.SRFTLQTLPESDFPDLAAGEMSHAFR.L +351.060368.085853.7383
R.TQFAISTEETR.Y +126.4928
R.VIPQNNDKELLVDKK.D +141.4428
R.VIPQNNDKELLVDKKDFEAAVDR.V +234.249537.54
R.YLLDIAAQIEGEVAVLK.L +267.713434.0259
R.YLLDIAAQIEGEVAVLK.L +371.907655.841654.9187
R.YYLNGIYLHTAGSPK.A +132.63143.234937.0663
R.YYLNGIYLHTAGSPK.A +240.369138.273642.817430.316
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA000840.450.040.440.450.0kaiB circadian clock protein 10890:11174 reverse MW:10217
K.IIGDLSDTPK.V +128.514534.792737.332431.0113
K.IIGDLSDTPK.V +254.838642.264731.4306
K.YKVEVIDLK.K +131.3273
M.ADPIKLVLYVAGETPK.S +126.5928
M.ADPIKLVLYVAGETPK.S +250.443544.581266.199747.5281
M.ADPIKLVLYVAGETPK.S +348.3084
R.EHGIVAIPTLVK.E +137.655339.28236.9487
R.EHGIVAIPTLVK.E +236.5827
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA001619.519.534.139.640.6ccoP, fixP cytochrome-c oxidase fixP chain 19019:19900 reverse MW:31591
K.DGTLTKDQIVQVANFVR.S +230.606858.7232
K.GFPNLNDDDWLWGGSLEQIEK.T +233.234554.4203
K.MQALATASLEEIEKNPALLALAR.A +246.687147.254963.068958.6319
K.MQALATASLEEIEKNPALLALAR.A +368.587553.642183.9053
R.AELDVDLAK.L +142.025441.2577
R.AELDVDLAKLNQVR.G +246.771839.9244
R.AELDVDLAKLNQVRGEK.M +247.526735.4667
R.GLFGYSSR.A +126.4415
R.SGNDEGHMGNMLAFGK.D +141.348841.8264
R.SGNDEGHMGNMLAFGK.D +256.585656.2287
R.SGNDEGHMGNMLAFGKDGTLTK.D +346.7736
R.SLSGQSTRPGVDLAAGK.Q +137.860632.3942
R.SLSGQSTRPGVDLAAGK.Q +253.261438.092156.158758.9255
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA001818.923.030.751.655.7ccoO, fixO cytochrome-c oxidase fixO chain 20082:20816 reverse MW:27263
K.AQVDPEGAAAADLQK.R +147.494349.232852.808553.2887
K.AQVDPEGAAAADLQK.R +261.215174.909775.647770.9499
K.AQVDPEGAAAADLQKRYPK.A +232.7889
K.YSDDWHVAHLKNPR.S +251.7607
K.YSDDWHVAHLKNPR.S +359.4236
R.NFDGQPGDPTELDALVSYLQMLGTLVDFK.L +245.385656.12
R.NFDGQPGDPTELDALVSYLQMLGTLVDFK.L +365.379164.1045
R.SIVPQSVMPNYAFLADNKVDVASLSDHLK.T +235.1043
R.TLGVPYSDEDIAK.A +129.61732.104333.907131.9183
R.TLGVPYSDEDIAK.A +232.729949.528330.3634
R.TLGVPYSDEDIAKAAADAK.A +233.9167
R.VGGKYSDDWHVAHLKNPR.S +253.759340.626265.606842.6359
R.YGHYSLAAESMYDHPFQWGSKR.T +235.6629
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA002825.526.661.564.367.5purH bifunctional purine biosynthesis protein 31989:33581 reverse MW:55969
K.AADDAGIAMVFTGTR.H +137.457736.0686
K.AADDAGIAMVFTGTR.H +234.613253.5926
K.AIAAAGLPVK.D +133.3426
K.AIAAAGLPVKDVSELTGFPEMMDGR.V +253.323361.832265.373266.7681
K.AIAAAGLPVKDVSELTGFPEMMDGR.V +346.268256.959256.6176
K.DLATVGIGAGQMSR.V +125.715130.504633.3305
K.DLATVGIGAGQMSR.V +230.136547.653475.962275.9974
K.ELSYNNINDTDAAYECVGEFDAAR.T +256.021655.1805
K.GASYEDCIENIDIGGPAMIR.A +248.917659.7873
K.GSVVASDAFFPFADGMLACIEAGATAVIQPGGSVRDDEVIK.A +348.498947.1617
K.HANPCGVAEGSSLLDAYKK.A +137.088534.8197
K.HANPCGVAEGSSLLDAYKK.A +231.117751.709587.739977.3637
K.HANPCGVAEGSSLLDAYKK.A +354.940991.117573.2254
K.LAAPMTK.G +125.153827.1491
K.RQPTEAELR.D +232.675
K.SNTIIYAK.D +125.313728.9035
K.TGLIDFAR.A +241.4406
K.TVAGGLLVQSR.D +230.820948.995251.7816
K.VHGGLLAIRDNDEHTQAMAAHGIPQIDLLVVNLYPFEATVDK.G +352.563554.6793
R.ALAGHGVELVSTGGTAK.A +138.669460.167863.00159.067
R.ALAGHGVELVSTGGTAK.A +258.442953.913373.078764.1614
R.ALAGHGVELVSTGGTAK.A +348.107745.524145.1378
R.ALLSVSDK.T +125.842827.731126.857732.582
R.ALLSVSDKTGLIDFAR.A +244.615664.496863.7727
R.ALLSVSDKTGLIDFAR.A +356.409968.8546
R.DNAVVDDMALK.V +134.293237.564144.051445.6083
R.DNAVVDDMALK.V +240.166239.937537.6543
R.KAQDAAEAMK.L +131.095439.5396
R.LLLAGALPDPR.A +255.716559.83160.945460.8158
R.TAACVIVK.H +127.385
R.TAAYDAAISNWFALQLK.T +125.0632
R.TLDAEAAR.A +230.0659
R.YGENPHQTAAFYATPEK.R +239.5577
R.YGENPHQTAAFYATPEKRPGVATAR.Q +241.142635.050436.6961
R.YGENPHQTAAFYATPEKRPGVATAR.Q +357.768950.1948
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA003533.041.316.114.347.2pheT putative phenylalanine-tRNA ligase beta chain 40904:43315 reverse MW:85210
-.MKLTLSWLKDHLDTDEPLEK.L +245.27945.179743.7103
-.MKLTLSWLKDHLDTDEPLEK.L +358.4441
K.ADAFAVLAAAGAPMAGLQIATNKLPAWLHPGR.S +233.442930.6864
K.ADAFAVLAAAGAPMAGLQIATNKLPAWLHPGR.S +345.124248.505955.1257
K.FKDPGIKPIKGEFPCPVSVTVEDSTLCPGFALR.L +347.2402
K.LADKLTMIGLEVEGIEDK.A +239.318561.496
K.LADKLTMIGLEVEGIEDK.A +373.0745
K.LGINTDAR.Y +234.5318
K.VLTAAKHPNADKLQVCTVDVGDGAAPVQVVCGAPNAR.A +347.755372.2133
R.AGLVTVFAPPGTYIPAKDFTLGIGNIR.G +234.89437.153437.1117
R.AKDGETLLALDGR.T +127.9053
R.AKPALELSAFHPVSR.D +127.5563
R.AKPALELSAFHPVSR.D +233.15346.6236
R.DKTMTDQEIEAVAAK.I +136.737135.1553
R.DKTMTDQEIEAVAAK.I +254.751241.150157.9331
R.DLAAADMGK.F +142.458949.124352.2188
R.GVDPAFMLPGLELATK.L +132.900336.335827.5825
R.GVDPAFMLPGLELATK.L +238.3647
R.HWSGSAQATALDAK.A +130.272137.6761
R.HWSGSAQATALDAK.A +253.596154.7776
R.ILNHLGFTVVGQAPVVK.V +242.993433.5196
R.IVGVDKVPLTPFER.G +231.425
R.LTAIGLRPINALVDITNYLTFDR.S +235.342835.813635.2262
R.LTAIGLRPINALVDITNYLTFDR.S +362.180462.994553.8365
R.RGVASSAGLGR.H +236.285937.7587
R.SGAIQIGPQNVLGYFGELHPR.V +236.195545.8999
R.SGAIQIGPQNVLGYFGELHPR.V +352.768
R.SRPLHVFDAAK.V +252.323737.279142.1286
R.SRPLHVFDAAK.V +347.2872
R.VLEQLGADGPLVAFEVILEKIPDPK.Q +355.7511
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA003720.320.316.916.926.1pheS phenylalanyl-tRNA synthetase, alpha-subunit 44200:45282 reverse MW:40115
K.EAVTDALTAR.R +129.3923
K.KGSISALLATLGK.M +134.743436.7483
K.KGSISALLATLGK.M +256.077853.1643
K.LAAETIDVTLPMREPAAEQGR.L +231.7525
M.SNLENLQSQILADIAAAADEAALEAVR.V +282.500471.482569.19182.7159
M.SNLENLQSQILADIAAAADEAALEAVR.V +366.030770.378369.714155.6928
R.AKEAVTDALTAR.R +132.4611
R.AKEAVTDALTAR.R +255.493
R.WLNHYGFKPLDIPTLAGGLSS.- +241.440935.171233.742
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA003826.934.534.534.552.1rplT ribosomal protein L20 45426:45785 reverse MW:13300
K.AAVDKAGQYAFR.D +128.0942
K.AAVDKAGQYAFR.D +230.984630.8923
K.SGIVVDRK.V +233.7874
K.VLSDLAINEPAAFQAIAEK.A +138.432233.014430.3568
K.VLSDLAINEPAAFQAIAEK.A +272.539368.805254.360956.642
K.VLSDLAINEPAAFQAIAEK.A +362.353998.6001
K.VLSDLAINEPAAFQAIAEKAK.A +346.8546
R.KVLSDLAINEPAAFQAIAEK.A +272.214379.852753.346253.0351
R.KVLSDLAINEPAAFQAIAEK.A +366.446775.818
R.LNAAVRPFGMTYSVFINGLSK.S +255.343549.9903
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA004033.337.522.936.540.6infC translation initiation factor IF-3 46403:46981 reverse MW:21922
K.IVEIKEIK.L +233.0671
K.LRPMIDDHDYEVK.M +132.362827.61528.4763
K.LRPMIDDHDYEVK.M +239.792937.686533.33
K.LRPMIDDHDYEVK.M +345.342253.625261.829653.0209
K.MAMDAGMDLVEISPTSSPPVCK.I +237.515348.625252.969745.3759
K.VKNDVAEIAK.V +133.545632.04133.6766
K.VKNDVAEIAKVEQDPR.F +231.4309
R.EMAHQEIGTK.L +125.001831.537228.7196
R.FFEEGDKVK.I +127.787432.723938.423432.4543
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA004519.912.124.019.924.0RPA0045 putative NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 51116:52081 reverse MW:33871
K.LQPVYVGDVATAIADAVDGLAKPGATYELGGPEELTMR.E +353.810347.507250.3193
K.SAGLTLQGLGIQPDSLQAIVPSYLWR.F +234.970852.543246.947544.1105
R.MLEVDNVVSEAAK.S +249.832639.0964
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA005116.445.339.836.848.8RPA0051 putative sigma-54 modulation protein 57746:58351 forward MW:21946
K.SISIGEALR.S +130.5398
K.SISIGEALR.S +239.715738.074138.3732
K.YFDGNYSGHFTLSK.D +126.5635
R.ADGNIGWIDPPVLNGAN.- +140.745125.4064
R.ADGNIGWIDPPVLNGAN.- +236.758434.312
R.KAHAEANALAELSTPVDAASYVIEAPGDEEHHEDAYNPVIIAEATTAMK.R +352.753550.674557.9675
R.KAHAEANALAELSTPVDAASYVIEAPGDEEHHEDAYNPVIIAEATTAMKR.L +351.2539
R.KYFDGNYSGHFTLSK.D +126.9405
R.KYFDGNYSGHFTLSK.D +350.65
R.RADGNIGWIDPPVLNGAN.- +237.808148.2187
R.VNIIYR.R +128.3446
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA005828.541.648.942.354.5ugpB1 putative sn-glycerol 3-phosphate transport system; periplasmic binding protein 63575:64903 reverse MW:48101
K.ADGFYKEQPYLETPIKELTNKPPTENSR.G +353.4104
K.AKADGFYKEQPYLETPIKELTNKPPTENSR.G +358.838645.2269
K.ASGYLPITK.A +138.836836.325531.664329.9891
K.ASGYLPITK.A +232.244434.60138.6735
K.FLAFLSDTDR.Q +238.049440.82838.5383
K.FLAFLSDTDRQVAIHK.A +235.1042
K.FNWTNAPMPYYPDVK.G +130.786126.214326.9444
K.FNWTNAPMPYYPDVK.G +248.256948.0561
K.GAPQNSIIGGASLWVMGGK.N +138.065225.5381
K.GAPQNSIIGGASLWVMGGK.N +237.9191
K.KTAQEALDAAVTR.G +130.9513
K.KTAQEALDAAVTR.G +230.1955
K.LANEFNAAQGDYK.V +128.554640.590133.4426
K.LANEFNAAQGDYK.V +253.6905
K.LEFNGPVQVK.H +125.7723
K.LIELQKDKTYDYSGR.T +243.159942.1835
K.LMQETGEPFDPK.A +129.103127.0846
K.LMQETGEPFDPK.A +244.304935.6668
K.NAAEYKGVAK.F +131.8083
K.TAQEALDAAVTR.G +132.657129.9875
K.TAQEALDAAVTR.G +238.317852.476932.7601
R.AGNAPHILQVFEVGTATMMAATGAVKPVYK.L +239.973534.975638.3316
R.AGNAPHILQVFEVGTATMMAATGAVKPVYK.L +355.836848.106246.257552.1226
R.DVWAEEIEQALAGK.K +134.476828.892849.395642.1434
R.DVWAEEIEQALAGK.K +270.716553.5799
R.DVWAEEIEQALAGKK.T +140.0102
R.DVWAEEIEQALAGKK.T +254.306156.400760.542261.1128
R.FTSGECPLFLTSSGFFGNVK.S +250.907249.64370.733651.1303
R.LGNMVQLR.D +125.801
R.LGNMVQLR.D +238.060942.367541.092742.6251
R.TNTGEGRFTSGECPLFLTSSGFFGNVK.S +238.3325
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA006045.948.945.945.948.9RPA0060 conserved unknown protein 66656:67057 reverse MW:14461
K.FYDLNKNPVISPYTGEVVPIAPVTAPR.T +266.078758.460862.64861.4704
K.FYDLNKNPVISPYTGEVVPIAPVTAPR.T +355.529666.561264.741763.8332
K.KFYDLNKNPVISPYTGEVVPIAPVTAPR.T +238.943248.959448.159453.7731
K.KFYDLNKNPVISPYTGEVVPIAPVTAPR.T +345.7387
R.ADQRSPVVDTEAPEAMEAEELVSLEEADAEENTGKVK.A +346.2878
R.SPVVDTEAPEAMEAEELVSLEEADAEENTGK.V +244.580348.572157.109352.844
R.SPVVDTEAPEAMEAEELVSLEEADAEENTGK.V +356.5536
R.SPVVDTEAPEAMEAEELVSLEEADAEENTGKVK.A +232.521950.81848.616342.5231
R.SPVVDTEAPEAMEAEELVSLEEADAEENTGKVK.A +351.338662.604874.736779.6109
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA006456.562.843.950.369.7rpsA ribosomal protein S1 70316:72013 forward MW:62801
K.ALEVAEEK.E +131.369226.485629.813635.1761
K.ALEVAEEKEAIAQYGSSDSGATLGDILGTALK.Q +245.389855.732865.456474.5155
K.ALEVAEEKEAIAQYGSSDSGATLGDILGTALK.Q +360.631790.574468.152964.6775
K.ALEVAEEKEAIAQYGSSDSGATLGDILGTALKQR.D +242.383930.2448
K.ALEVAEEKEAIAQYGSSDSGATLGDILGTALKQR.D +378.594377.3146102.37394.3931
K.AVVLDVDVEKER.I +139.711145.150430.7816
K.AVVLDVDVEKER.I +253.099858.417336.054938.2446
K.EAIAQYGSSDSGATLGDILGTALK.Q +273.483933.8437
K.EAIAQYGSSDSGATLGDILGTALKQR.D +235.369935.530.3641
K.EAIAQYGSSDSGATLGDILGTALKQR.D +345.190546.3232
K.ERISLGVK.Q +128.1482
K.ESGIDVQIVGTDFNTFIKR.S +238.4752
K.GKVVAIEK.D +131.6573
K.HPVGSTVEGEVK.N +135.1178
K.IIKINHETHR.I +243.8972
K.KGAVVTCEVLDVK.E +135.9572
K.LPGEQVIDNFK.K +236.4119
K.LPGEQVIDNFKK.G +237.8121
K.LPGEQVIDNFKKGDMVK.A +128.8396
K.LPGEQVIDNFKKGDMVK.A +231.28733.5791
K.LPGEQVIDNFKKGDMVK.A +354.187851.9266
K.NITDYGAFVDLGGIDGLLHVTDIAWR.R +242.404632.215132.823545.2563
K.NITDYGAFVDLGGIDGLLHVTDIAWR.R +347.187566.5025
K.NMHPGKIVSTSQEVEVQVLEVDSVKR.R +352.7397
K.QLEGDPFAEPGDVK.K +243.393946.781733.949333.6618
K.QLEGDPFAEPGDVKK.G +132.3032
K.QLEGDPFAEPGDVKK.G +238.496238.7856
K.QLLDDPWQGIEAK.Y +133.390732.024225.1612
K.QLLDDPWQGIEAK.Y +256.010748.352644.904846.356
K.QTMRNPWEVFVEKHPVGSTVEGEVK.N +237.1719
K.QTMRNPWEVFVEKHPVGSTVEGEVK.N +351.2161
K.VGDTVEVFLDR.I +132.639331.024536.4548
K.VGDTVEVFLDR.I +257.588
K.VGDTVEVFLDRIENALGEAVLSR.D +249.155946.223746.572945.9152
K.VGDTVEVFLDRIENALGEAVLSR.D +387.796895.801996.317492.1381
K.VGDTVEVFLDRIENALGEAVLSRDK.A +369.374357.1003
K.VVAIEK.D +129.390932.38827.0376
M.ASTDTYNPTRDDFAAMLDESFAGGNLQESSVIKGK.V +352.693371.28456.28451.3174
R.AEQRQELVQNLEEGQVIDGVVK.N +253.312759.280552.977667.1313
R.AEQRQELVQNLEEGQVIDGVVK.N +347.597558.357857.1141
R.DVAPLMNNSQPFQILK.M +131.4902
R.DVAPLMNNSQPFQILK.M +230.851163.753430.4596
R.IENALGEAVLSR.D +134.172333.031333.524232.6962
R.IENALGEAVLSR.D +274.930674.296968.665372.3637
R.IENALGEAVLSRDK.A +238.5817
R.ISLGLK.Q +127.978630.0655
R.ISLGLKQTMRNPWEVFVEKHPVGSTVEGEVK.N +345.1675
R.ISLGMK.Q +130.441928.2569
R.ISLGVK.Q +128.161
R.ISLGVKQLEGDPFAEPGDVK.K +235.8619
R.KVQVSIK.A +128.092326.2941
R.NPWEVFVEK.H +128.0532
R.NPWEVFVEK.H +232.7774
R.NPWEVFVEKHPVGSTVEGEVK.N +251.983457.864452.1362
R.NPWEVFVEKHPVGSTVEGEVK.N +350.0213
R.QELVQNLEEGQVIDGVVK.N +254.636980.962158.101373.7039
R.QELVQNLEEGQVIDGVVK.N +346.9619
R.RVNHPTEVLTIGQTVK.V +261.034160.083349.5756.9109
R.RVNHPTEVLTIGQTVK.V +360.346758.057859.6233
R.SDRFAVGEKVDAR.V +238.3453
R.SQVDIRPIRDVAPLMNNSQPFQILK.M +232.515333.5364
R.SQVDIRPIRDVAPLMNNSQPFQILK.M +353.134862.11357.080751.743
R.TVLEETRAEQRQELVQNLEEGQVIDGVVK.N +350.598149.6331
R.VIQFDK.K +125.4996
R.VIQFDKK.A +132.440229.238633.5998
R.VIQFDKK.A +242.295735.0957
R.VNHPTEVLTIGQTVK.V +149.24148.20744.208954.3659
R.VNHPTEVLTIGQTVK.V +253.951354.901844.619350.2635
R.VPLR.E +127.092126.306
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA006844.657.371.844.671.8trpF putative N-(5'-phosphoribosyl)anthranilate isomerase 74185:74826 forward MW:22677
K.AIAVAGPDDLSVLPDYAAVADR.I +278.654664.226861.483960.8522
K.ICGLTTADTLEAAVEAGADMVGFVFFPASPR.H +350.791
K.LLDGVNLKLPFLVSGGINAGNVAEALR.V +232.952332.123337.4792
K.LLDGVNLKLPFLVSGGINAGNVAEALR.V +349.02462.4303
K.LPFLVSGGINAGNVAEALR.V +254.149859.1075
K.VALTVDADDDLLDAIVEQLRPNWLQFHGSESPER.V +351.568452.268567.491560.6037
R.AQGVDVSSGVETSPGEKDPDLIRDFIR.A +345.937451.8583
R.HLDIDFADALGR.Q +247.619233.574945.201935.8025
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA007022.322.322.322.322.3trpA tryptophan synthase alpha subunit 76054:76890 forward MW:28607
K.VLPAAGADVIEIGMPFTDPMADGPAIQAAGLR.A +236.203452.855940.481237.4307
K.VLPAAGADVIEIGMPFTDPMADGPAIQAAGLR.A +363.3261
R.ATDNATPLVLMGYYNPIYIYGVDAFLADAK.A +241.598441.863834.974130.0574
R.ATDNATPLVLMGYYNPIYIYGVDAFLADAK.A +349.3946
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA007116.223.920.518.037.9accD acetyl-CoA carboxylase carboxyltransferase beta subunit 77000:77983 forward MW:35824
K.AEPEATTTEQPGAPAPTEPPAQPAAPQA.- +241.8726
K.SPALTVTTAVEAPAEAAAK.A +130.777838.505439.597439.5318
K.SPALTVTTAVEAPAEAAAK.A +260.368455.502853.598847.6591
R.AEYLKEHGMVDMVVHR.H +238.42
R.AIFDNETWYDVALPEVVADPLK.F +232.2404
R.AIFDNETWYDVALPEVVADPLKFRDER.K +347.0777
R.GMELAVEK.H +125.52825.717825.543730.9594
R.GMELAVEK.H +238.9327
R.LLTKSPALTVTTAVEAPAEAAAK.A +238.440655.8901
R.MQEGILSLMQMPR.T +260.109346.894555.1378
R.TTVAVQMLR.E +231.7444
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA007350.060.450.050.060.4trxA thioredoxin 79484:79804 reverse MW:11253
K.AKLQQWISAAV.- +125.3339
K.AKLQQWISAAV.- +243.32
K.IVKLNVDESPVTASK.Y +154.57358.846444.244650.2159
K.IVKLNVDESPVTASK.Y +274.646565.933564.717557.5319
K.IVKLNVDESPVTASK.Y +367.613267.6011
K.LNVDESPVTASK.Y +142.336540.052640.436143.1094
K.LNVDESPVTASK.Y +267.183559.273562.88362.2126
K.YGVMSIPTLMIFK.G +132.005334.836931.29631.7125
K.YGVMSIPTLMIFK.G +248.298354.016436.479448.8173
K.YGVMSIPTLMIFKGGEMASR.Q +244.887839.989840.665138.9126
K.YGVMSIPTLMIFKGGEMASR.Q +350.02555.848957.2684
R.MIAPALDEIAGAMGDK.V +143.0753
R.MIAPALDEIAGAMGDK.V +262.552575.454756.079
R.MIAPALDEIAGAMGDKVK.I +134.191934.318336.0757
R.MIAPALDEIAGAMGDKVK.I +266.3661.915470.763567.4632
R.MIAPALDEIAGAMGDKVK.I +350.817145.6627
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA008940.740.740.737.246.9RPA0089 conserved unknown protein 102225:102566 reverse MW:12691
K.DFQDVVR.I +125.1883
K.DVVEMTKPTVIVPNDG.- +141.672432.3663
R.GAMTNYLEFISK.S +127.4656
R.GAMTNYLEFISK.S +249.096543.250943.8548
R.IQTEFLQTQFR.V +248.22347.587156.3538
R.VLTDQAKDVVEMTKPTVIVPNDG.- +246.622648.241864.362854.3489
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA010215.915.026.628.335.6oppA putative ABC transporter oligopeptide-binding protein 115230:116831 reverse MW:58400
K.ALPSTGPIAPGSPLEEK.N +132.8191
K.ALPSTGPIAPGSPLEEK.N +240.8903
K.GLGNLPTTVWGVASPLDELYWVTPPKN.- +243.130445.478750.436354.1346
K.IVVEDAPIFYINATPYHTSFAK.G +235.334440.393931.255
K.IVVEDAPIFYINATPYHTSFAK.G +347.8323
K.LAHPHPAMLLAMSPALMPILPK.H +230.844530.966930.2987
K.LLDEAGLKPDGAGVR.T +235.45231.1365
K.TMLAAVESVDTPDPHTAVIK.L +231.8135
R.HFNGAVQSGIATALPSTQIFASPLR.Y +261.065644.3462
R.LEKAPNVVVTDKGFAGIGALNWLAFNTK.K +233.6839
R.LISDPNALMVSAER.G +233.892534.1542.125649.5624
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA013923.116.220.39.831.5RPA0139 methyl-accepting chemotaxis receptor/sensory transducer 157930:160131 reverse MW:77029
K.AAGGGGGFAFALGDGEDDRDADFQR.- +235.1185
K.AGELQNNILYQTR.A +237.6732
K.AHGAPIDKAVNQLR.A +231.377440.429935.1222
K.DTLGIALEQMVEK.L +125.419336.2664
K.FSTAYDKMNATEDQIIK.F +137.6746
K.FSTAYDKMNATEDQIIK.F +237.894549.793355.2654
K.IAAQSAKDAEASGAAVGR.A +245.040131.1064
K.ITIVQEIAR.Q +255.586151.393952.6547
K.MNATEDQIIK.F +125.6468
K.RLSEKDTLGIALEQMVEK.L +270.068764.1393
K.RLSEKDTLGIALEQMVEK.L +360.02153.8316
K.VAQEAGEMLAK.L +133.741435.1283
R.AGEHGKGFAVVASEVR.K +251.5214
R.ANALISILSIR.A +241.2858
R.AVEAMQTIAEK.I +137.516325.388328.4439
R.AVEAMQTIAEK.I +258.0554
R.GAQLWTSEGAPVVKDWSEAVESSLAEAR.K +351.1592
R.GNLTIEAK.R +127.2475
R.IRDEIAAVATEAGKR.M +246.859866.429840.2724
R.IRDEIAAVATEAGKR.M +353.823250.528450.560256.7242
R.SQASATEIGELSGETVK.V +130.758933.106342.9887
R.SQASATEIGELSGETVK.V +239.972852.773343.566
R.SQASATEIGELSGETVKVAQEAGEMLAK.L +246.424149.313346.08741.917
R.SQASATEIGELSGETVKVAQEAGEMLAK.L +367.630565.324658.785554.5974
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA015916.716.716.716.716.7rpmA, L27 ribosomal protein L27 177918:178190 forward MW:9581
K.AFGGEHVIPGNIIAR.Q +139.19337.044833.042630.25
K.AFGGEHVIPGNIIAR.Q +230.555133.118535.798539.1348
K.AFGGEHVIPGNIIAR.Q +366.34848.8665
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA016950.259.046.141.362.0ctpA putative periplasmic carboxyl-terminal processing protease 187815:189191 forward MW:48865
K.AAADLLHGIK.V +127.4483
K.AAADLLHGIK.V +239.7705
K.AGILANDIITNLDDEAVQGLTLNQAVEK.M +277.368477.581972.761265.9162
K.AGILANDIITNLDDEAVQGLTLNQAVEK.M +379.811876.290769.860286.5515
K.EIANLTNQIGADKLK.G +133.847130.5438
K.EIANLTNQIGADKLK.G +244.028542.252137.8709
K.GFILDLR.N +232.220140.6762
K.GITPDIEVMQDVPADLK.A +135.891439.743139.379938.0798
K.GITPDIEVMQDVPADLK.A +263.400567.198362.122559.2345
K.GITPDIEVMQDVPADLKAR.T +260.760660.029331.886542.1087
K.GITPDIEVMQDVPADLKAR.T +349.6825
K.GKPVIVLINGGSASASEIVAGALQDHKR.A +257.077556.3478
K.GKPVIVLINGGSASASEIVAGALQDHKR.A +362.251747.9022
K.GSVQTIIPLGSGNGALR.L +234.5673
K.LVESAISGMLAGLDPHSSYMDAK.S +237.923544.790134.7355
K.LVESAISGMLAGLDPHSSYMDAK.S +355.126571.586948.0513
K.VVSPIDDTPASK.A +138.663342.52738.845839.7705
K.VVSPIDDTPASK.A +238.781741.571830.2927
R.ARVEDSDIGYIR.I +130.3775
R.ARVEDSDIGYIR.I +247.634951.28544.4397
R.GEFGGLGIEVTMEDGLIKVVSPIDDTPASK.A +237.882
R.ITTFNEQTTEGLKK.E +232.8118
R.ITTFNEQTTEGLKKEIANLTNQIGADKLK.G +354.588853.6391
R.KGQDNPIEVTLVR.D +130.640533.628
R.KGQDNPIEVTLVR.D +260.378450.980354.181753.8802
R.KGQDNPIEVTLVR.D +368.7348
R.KGQDNPIEVTLVRDNIR.V +345.8025
R.NNPGGLLEEAVTVSDAFLDR.G +250.777851.540850.395352.5379
R.NNPGGLLEEAVTVSDAFLDR.G +379.909251.612
R.NNPGGLLEEAVTVSDAFLDRGEIVSTR.G +232.768830.8877
R.NNPGGLLEEAVTVSDAFLDRGEIVSTR.G +345.370446.313656.103650.6804
R.QLNLFGDVFER.V +242.596345.7106
R.SAHAGDLTK.G +137.267933.8339
R.SDYVEKPDDSKLVESAISGMLAGLDPHSSYMDAK.S +350.055258.2571
R.SFGKGSVQTIIPLGSGNGALR.L +253.939552.422542.905237.3609
R.SFGKGSVQTIIPLGSGNGALR.L +353.92457.41
R.VEDSDIGYIR.I +131.4441
R.VEDSDIGYIR.I +245.780555.6427
R.VRSDYVEKPDDSKLVESAISGMLAGLDPHSSYMDAK.S +357.5991
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA01758.912.68.98.912.6atpC putative H+-transporting ATP synthase epsilon chain. 194253:194660 reverse MW:14258
K.SIQHELNTTAMH.- +141.558946.787743.81241.5601
K.SIQHELNTTAMH.- +263.991756.038363.127148.1364
R.LDHFKSIQHELNTTAMH.- +256.5382
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA017678.679.281.783.686.8atpD putative H+-transporting ATP synthase beta chain. 194774:196204 reverse MW:50717
K.FVDLADTIK.G +140.418443.652647.200643.6324
K.FVDLADTIK.G +254.392451.337651.406850.5019
K.FVDLADTIKGFR.A +125.2595
K.FVDLADTIKGFR.A +257.417355.416246.460540.4603
K.FVDLADTIKGFR.A +350.8143
K.GGKIGLFGGAGVGK.T +126.048
K.GIYPAVDPLDSTSR.M +125.762926.61925.4402
K.GIYPAVDPLDSTSR.M +250.258246.254151.511753.8738
K.IERFLSQPFFVAEVFTGSPGKFVDLADTIK.G +346.733351.612246.7806
K.IGLFGGAGVGK.T +137.723338.5316
K.IGLFGGAGVGK.T +239.687644.641639.697630.7164
K.IGLFGGAGVGKTVLIQELINNVAR.A +234.7664
K.IGLFGGAGVGKTVLIQELINNVAR.A +346.423375.9215
K.LAAEAA.- +125.1513
K.NGDNRLVLEVAQHLGESTVR.T +249.973745.67257.446149.195
K.NGDNRLVLEVAQHLGESTVR.T +375.492978.520573.241175.5136
K.SLQDIIAILGMDELSEEDKLTVAR.A +264.018971.85772.140472.3478
K.SLQDIIAILGMDELSEEDKLTVAR.A +363.295662.429745.32352.1348
K.TVLIQELINNVAR.A +141.657828.284635.476234.9904
K.TVLIQELINNVAR.A +277.638577.731676.260675.793
K.TVLIQELINNVAR.A +388.902690.8958
K.VVDLLAPYAK.G +137.127233.636139.726337.1542
K.VVDLLAPYAK.G +252.76352.657151.071646.1391
K.VVDLLAPYAKGGK.I +126.7168
K.YDHLPEAAFYMVGTIEEAVEK.G +237.703262.134755.1319
K.YDHLPEAAFYMVGTIEEAVEK.G +353.763456.6453
K.YKSLQDIIAILGMDELSEEDKLTVAR.A +274.931359.5968
K.YKSLQDIIAILGMDELSEEDKLTVAR.A +375.397386.611157.39294.8751
M.ATPANQTGR.I +235.1227
R.AHGGYSVFAGVGER.T +143.089149.933241.339437.8203
R.AHGGYSVFAGVGER.T +261.365364.649848.6674
R.AHGGYSVFAGVGER.T +351.844
R.AICEGKYDHLPEAAFYMVGTIEEAVEK.G +251.917253.717349.18553.4735
R.AICEGKYDHLPEAAFYMVGTIEEAVEK.G +379.819972.806582.078781.9159
R.AICEGKYDHLPEAAFYMVGTIEEAVEKGK.K +369.555270.7672
R.AICEGKYDHLPEAAFYMVGTIEEAVEKGKK.L +365.925659.9276
R.AICEGKYDHLPEAAFYMVGTIEEAVEKGKKLAAEAA.- +356.9134
R.AIHQEAPAYTDQSTEAEILVTGIK.V +275.865377.815579.715383.9613
R.AIHQEAPAYTDQSTEAEILVTGIK.V +372.04374.455371.86748.0818
R.AIHQEAPAYTDQSTEAEILVTGIKVVDLLAPYAK.G +237.195536.3161
R.AIHQEAPAYTDQSTEAEILVTGIKVVDLLAPYAK.G +364.570972.635457.200162.5766
R.AISEKGIYPAVDPLDSTSR.M +262.990462.811
R.AISEKGIYPAVDPLDSTSR.M +361.960873.7343
R.DQGQDVLFFVDNIFR.F +129.395427.9295
R.DQGQDVLFFVDNIFR.F +267.209755.660961.306656.8531
R.DQGQDVLFFVDNIFR.F +362.3777
R.EGNDLYHEFIESGVNK.K +234.0967
R.EGNDLYHEFIESGVNKK.G +230.026543.245538.1843
R.EGNDLYHEFIESGVNKKGGGEGSK.C +253.890352.018139.0036
R.FLSQPFFVAEVFTGSPGK.F +127.50734.567236.0786
R.FLSQPFFVAEVFTGSPGK.F +271.065363.72586.407573.446
R.FLSQPFFVAEVFTGSPGK.F +349.4165
R.FLSQPFFVAEVFTGSPGKFVDLADTIK.G +245.905739.625348.681243.4993
R.FLSQPFFVAEVFTGSPGKFVDLADTIK.G +353.646945.202173.065
R.FLSQPFFVAEVFTGSPGKFVDLADTIKGFR.A +237.295
R.FLSQPFFVAEVFTGSPGKFVDLADTIKGFR.A +346.995362.0981
R.FTQAGSEVSALLGR.I +126.576339.916232.402337.2611
R.FTQAGSEVSALLGR.I +277.321771.665868.750965.5405
R.FTQAGSEVSALLGR.I +354.335855.2189
R.FTQAGSEVSALLGRIPSAVGYQPTLATDMGALQER.I +230.5725
R.FTQAGSEVSALLGRIPSAVGYQPTLATDMGALQER.I +391.080481.29891.974584.4136
R.GQEVTDTGAPISVPVGAGTLGR.I +267.236267.699674.76467.5709
R.GQEVTDTGAPISVPVGAGTLGR.I +365.368488.6917
R.IMNVIGEPVDEQGPIK.S +133.462337.2878
R.IMNVIGEPVDEQGPIK.S +251.788952.5174
R.IMNVIGEPVDEQGPIKSEGLR.A +269.602771.113772.569368.3009
R.IMNVIGEPVDEQGPIKSEGLR.A +357.304363.0668.309666.0555
R.IPSAVGYQPTLATDMGALQER.I +270.685265.300377.647177.4153
R.IPSAVGYQPTLATDMGALQER.I +362.014482.309968.641474.253
R.ITQVIGAVVDVQFEGHLPAILNAIETK.N +235.536230.4881
R.LVLEVAQHLGESTVR.T +139.777736.03
R.LVLEVAQHLGESTVR.T +263.715664.943469.332667.8214
R.LVLEVAQHLGESTVR.T +363.024888.999567.469664.7924
R.MLSASIVGEEHYNTAR.M +133.865631.190933.265435.9721
R.MLSASIVGEEHYNTAR.M +248.944955.028558.103554.028
R.MLSASIVGEEHYNTAR.M +353.560760.0305
R.MVQQILQK.Y +136.878433.914431.544633.3439
R.MVQQILQK.Y +254.729354.594650.57748.6367
R.TIAMDTTEGLVR.G +133.403731.994230.166127.7641
R.TIAMDTTEGLVR.G +271.194271.599370.941170.8521
R.TIAMDTTEGLVRGQEVTDTGAPISVPVGAGTLGR.I +232.627832.9364
R.TIAMDTTEGLVRGQEVTDTGAPISVPVGAGTLGR.I +354.613964.325269.325465.2181
R.TREGNDLYHEFIESGVNK.K +262.253668.452763.813870.2254
R.TREGNDLYHEFIESGVNK.K +366.65264.571862.1747
R.TREGNDLYHEFIESGVNKK.G +249.163347.848866.830165.326
R.TREGNDLYHEFIESGVNKK.G +367.931577.782576.201
R.TREGNDLYHEFIESGVNKKGGGEGSK.C +255.915459.223352.444760.7107
R.TREGNDLYHEFIESGVNKKGGGEGSK.C +382.771678.832385.658381.4103
R.VGLTGLTVAEHFR.D +127.5395
R.VGLTGLTVAEHFR.D +247.094946.7593
R.VGLTGLTVAEHFR.D +348.716845.328949.0728
R.VGLTGLTVAEHFRDQGQDVLFFVDNIFR.F +231.5869
R.VGLTGLTVAEHFRDQGQDVLFFVDNIFR.F +365.137867.1525100.64385.4989
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA017743.345.739.221.658.1atpG putative H+-transporting ATP synthase gamma chain. 196276:197151 reverse MW:31934
K.AMQMVAASK.L +132.4403
K.ELIEIISGAEAI.- +127.498832.476425.4373
K.ELIEIISGAEAI.- +230.6177
K.QIIDNVELR.S +238.058731.032931.425535.0478
R.ALLENNASFYGAQMSAMDNATR.N +255.282357.7396
R.AYELMSQGK.T +125.019532.652326.7335
R.ERAYELMSQGK.T +246.700132.2674
R.FKSVISQIPTAQQLIPLEVTAPAAGTVATSYEYEPEEDEILSGLLPR.N +346.131646.357147.2421
R.FNAGEFDVCTLFYSR.F +243.4008
R.GLSGAFNSSIVR.L +125.618327.1316
R.GLSGAFNSSIVR.L +265.913164.166957.141740.3377
R.KQTLVYNR.T +126.416
R.NFEKQIIDNVELR.S +248.1946
R.NFEKQIIDNVELR.S +361.2226
R.NLAVQIFR.A +136.3142
R.NLAVQIFR.A +245.24746.9297
R.QIGFVNAEDIAK.K +125.101130.379
R.QIGFVNAEDIAK.K +241.422932.5399
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA017856.959.257.552.767.1atpA putative H+-transporting ATP synthase alpha chain. 197295:198827 reverse MW:55178
K.APGIIPR.K +134.865729.972933.275431.66
K.APGIIPR.K +241.5031
K.AVVESYAK.T +127.801226.247331.1759
K.DQIKNFGQEAEVSEVGQVLSVGDGIAR.V +233.552335.1027
K.GLLGRVVDALGNPIDGK.G +232.23830.4319
K.GLLGRVVDALGNPIDGKGPIQAVER.K +237.25131.1113
K.GLLGRVVDALGNPIDGKGPIQAVER.K +369.0990.3725
K.GLLGRVVDALGNPIDGKGPIQAVERK.R +362.7299
K.GPIQAVER.K +236.7907
K.IKGELAQYR.E +136.774635.532235.4744
K.IKGELAQYR.E +238.167831.669336.711432.7277
K.IKGELAQYREMAAFAQFGSDLDAATQR.L +233.604
K.IKGELAQYREMAAFAQFGSDLDAATQR.L +385.652488.745152.77
K.LKAVVESYAK.T +139.92643.957440.777437.7695
K.LKAVVESYAK.T +241.877840.024935.6631
K.NFGQEAEVSEVGQVLSVGDGIAR.V +274.123372.55588.095581.7656
K.NFGQEAEVSEVGQVLSVGDGIAR.V +372.402171.250368.2588
K.RVDVKAPGIIPR.K +352.6292
K.SIDALIPIGR.G +130.087729.646834.83434.1974
K.SIDALIPIGR.G +248.44248.335643.48642.4705
K.TAIALDTILNQKPLNVEGAPESQK.L +269.204656.374160.805447.7708
K.TAIALDTILNQKPLNVEGAPESQK.L +371.161966.704661.779348.352
K.TAIALDTILNQKPLNVEGAPESQKLYCVYVAVGQKR.S +346.084159.2311
K.VAGKIKGELAQYR.E +242.5122
K.VRAFEDGLLALLR.G +257.476738.490855.543958.5598
K.VRAFEDGLLALLR.G +369.6245
R.AAEISAILKDQIK.N +144.992842.083441.767630.7869
R.AAEISAILKDQIK.N +260.683847.297553.4803
R.AAEISAILKDQIK.N +346.422
R.AAEISAILKDQIKNFGQEAEVSEVGQVLSVGDGIAR.V +368.160368.934859.9373
R.AFEDGLLALLR.G +134.091729.19632.369130.9229
R.AFEDGLLALLR.G +273.914872.948470.832768.8157
R.AFEDGLLALLR.G +356.9663
R.AFEDGLLALLRGK.E +244.836551.0038
R.AFEDGLLALLRGKESGILEAIR.T +232.5009
R.AFEDGLLALLRGKESGILEAIR.T +361.85262.732557.2345
R.DLSDDTAAK.L +136.959636.969336.197230.4204
R.DLSDDTAAKLK.A +134.507434.564
R.DLSDDTAAKLK.A +258.513947.002148.3019
R.DLSDDTAAKLKAVVESYAK.T +243.887758.463632.2634
R.DLSDDTAAKLKAVVESYAK.T +361.2959
R.DNGMHAVIIYDDLSK.Q +144.4187
R.EAYPGDVFYLHSR.L +126.3017
R.EAYPGDVFYLHSR.L +242.794534.213639.7316
R.ELIIGDR.Q +126.325933.434534.7197
R.ELIIGDR.Q +230.727431.0972
R.ELIIGDRQTGK.T +129.6785
R.ELIIGDRQTGK.T +241.870631.442235.5359
R.EMAAFAQFGSDLDAATQR.L +267.988757.457889.971280.6197
R.GKESGILEAIR.T +141.884140.338832.657335.8103
R.GKESGILEAIR.T +270.112447.199150.356430.5895
R.GQRELIIGDR.Q +245.148437.2659
R.KRVDVKAPGIIPR.K +137.2012
R.KRVDVKAPGIIPR.K +250.514963.1411
R.KRVDVKAPGIIPR.K +351.663364.0992
R.KSVHEPMATGLK.S +140.575147.203645.570744.8983
R.KSVHEPMATGLK.S +239.281538.505945.443339.3142
R.KSVHEPMATGLK.S +347.8167
R.KSVHEPMATGLKSIDALIPIGR.G +232.1176
R.LLNRGSR.L +230.3208
R.LTELLKQPQFSPLK.M +137.066834.327138.7629
R.LTELLKQPQFSPLK.M +246.064659.682559.560752.7397
R.LTELLKQPQFSPLK.M +348.785245.331846.242852.7292
R.LTELLKQPQFSPLKMEEQVCVIWAGTNGYLDALPLNK.V +353.468353.3492
R.LTELLKQPQFSPLKMEEQVCVIWAGTNGYLDALPLNKVR.A +352.747
R.SIVDAPVGK.G +141.795131.654432.348534.7176
R.SIVDAPVGK.G +235.81644.561932.552234.0932
R.SIVDAPVGKGLLGR.V +243.9915
R.STVAQFVK.V +132.143928.376926.6635
R.STVAQFVK.V +240.722639.5587
R.TRSIVDAPVGK.G +234.5501
R.TSRDLSDDTAAKLKAVVESYAK.T +351.4772
R.VDVKAPGIIPR.K +230.958
R.VGSSAQTK.A +128.123926.987727.08830.6844
R.VVDALGNPIDGK.G +135.014936.9507
R.VVDALGNPIDGK.G +253.698553.807547.876852.3898
R.VVDALGNPIDGKGPIQAVER.K +263.657151.339470.782269.1067
R.VVDALGNPIDGKGPIQAVER.K +391.367983.064889.766583.7494
R.VVDALGNPIDGKGPIQAVERK.R +230.471842.433939.7869
R.VVDALGNPIDGKGPIQAVERK.R +347.206355.330152.681
R.VYGLDNVLAGEMVEFENGTR.G +279.200478.415979.656575.338
R.VYGLDNVLAGEMVEFENGTR.G +389.688498.083555.8252
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA017971.063.464.064.074.7atpH putative H+-transporting ATP synthase delta chain. 198827:199387 reverse MW:19513
K.AALKSVTGKDVALNINVDPAIIGGLVVK.L +355.0935
K.AGITGISANFLK.V +129.89935.0901
K.AGITGISANFLK.V +251.658144.1278
K.ALAAVLDK.A +141.31935.216535.272333.7083
K.ALAAVLDK.A +238.611141.5376
K.ALAAVLDKAGITGISANFLK.V +268.163470.394163.27273.9536
K.ALAAVLDKAGITGISANFLK.V +375.017287.371179.3329
K.FKGEATADVTVAEKLSDKNLEALK.A +231.3436
K.LSDKNLEALK.A +135.005427.725729.173226.5853
K.LSDKNLEALK.A +237.273531.069841.1684
K.LSDKNLEALKAALK.S +139.773335.086825.1375
K.LSDKNLEALKAALK.S +259.188839.97635.3501
K.LSDKNLEALKAALK.S +360.212659.8669
K.SIDAVTADLDKFSAMLAGSPDLVR.L +281.320878.604280.881885.7451
K.SIDAVTADLDKFSAMLAGSPDLVR.L +354.790653.126248.9508
K.SVTGKDVALNINVDPAIIGGLVVK.L +268.643364.659874.390859.532
K.SVTGKDVALNINVDPAIIGGLVVK.L +345.924962.1131
R.DEKSIDAVTADLDKFSAMLAGSPDLVR.L +230.858
R.DEKSIDAVTADLDKFSAMLAGSPDLVR.L +366.194264.4153
R.LFVVADVIR.A +254.957955.737952.525245.3411
R.LVRSPVFASEVQGK.A +235.100341.1833
R.LVRSPVFASEVQGK.A +356.2006
R.MVDSSLR.T +132.272927.8301
R.SPVFASEVQGK.A +146.591343.995741.387140.3857
R.SPVFASEVQGK.A +257.1155.903749.8372
R.YATALFELAR.D +128.312630.103228.5159
R.YATALFELAR.D +252.366952.462247.884
R.YATALFELARDEK.S +238.9479
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA018533.827.643.039.056.1dldH dihydrolipoamide dehydrogenase, E3 component of 2-oxoglutarate and pyruvate dehydrogenase complexes 205473:206876 reverse MW:48585
K.AEDEGVAVAELIAGK.A +134.343633.956
K.AEDEGVAVAELIAGK.A +235.565
K.AGHVNYDVIPGVVYTTPEVSSVGK.T +231.871
K.AGHVNYDVIPGVVYTTPEVSSVGKTEEDLK.Q +245.549
K.AGHVNYDVIPGVVYTTPEVSSVGKTEEDLK.Q +345.280150.659649.2813
K.ALLHASELFEEAGHSFAK.M +126.5109
K.ALLHASELFEEAGHSFAK.M +257.17460.72966.041558.576
K.ALLHASELFEEAGHSFAK.M +369.966881.133886.440295.0599
K.GVEYLMK.K +125.2998
K.GVYAIGDVVR.G +131.9863
K.GVYAIGDVVRGPMLAHKAEDEGVAVAELIAGK.A +354.1694
K.LDLPAMMNFK.Q +235.5491
K.LDLPAMMNFKQQGIDGNVK.G +232.0268
K.MGIGVSAPK.L +240.5308
K.NATLGGTCLNVGCMPSK.A +127.273632.87747.423538.5528
K.NATLGGTCLNVGCMPSK.A +244.799663.820445.6691
K.NKIDVLVGK.G +128.8404
K.RVVSSTGALSLDKVPGK.L +354.7056
R.AAQLGLK.V +125.1483
R.EAGEMIHEAAVLMEFGGSAEDLAR.T +244.665570.683639.5214
R.GPMLAHKAEDEGVAVAELIAGK.A +250.211750.46975.409566.6215
R.GPMLAHKAEDEGVAVAELIAGK.A +360.044169.974669.010873.539
R.ILPGMDGEVVK.Q +125.856927.7346
R.SEAIKEAALTVGKR.A +252.5555
R.SEAIKEAALTVGKR.A +361.6222
R.SKVNQTTDGFVK.I +137.848226.0358
R.SKVNQTTDGFVK.I +242.792545.057834.2208
R.TCHAHPTRSEAIKEAALTVGKR.A +361.2515
R.VLGVHIIGR.E +244.094140.9058
R.VPYTEGLGLKEAGVALDER.G +240.307359.0044
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA018826.629.339.846.352.5sucB dihydrolipoamide succinyl transferase 208123:209376 reverse MW:43864
K.AAAPAAAPAPAAPAPAAAPAAK.A +131.233547.251761.7193
K.AAAPAAAPAPAAPAPAAAPAAK.A +248.055842.527980.731574.7356
K.AASAPTPVNQPAAAVQVR.G +125.5405
K.AASAPTPVNQPAAAVQVR.G +246.961150.77651.410464.7534
K.ACVQALKDIPAVNAEMDGTDLIYK.N +240.359266.453549.6254
K.APPSDAPLAPSVR.R +233.2114
K.DGETVAVGALLGQITDGAAPAKPAAAAPAK.A +249.864649.822857.92359.0789
K.DGETVAVGALLGQITDGAAPAKPAAAAPAK.A +353.2768
K.GDMLAAIEK.A +133.3627
K.GLVVPVVR.D +127.959
K.IQERPVVIGGK.I +239.256450.7428
K.LGFMGFFTK.A +250.056645.384753.300941.6978
K.NYYHIGVAVGTDKGLVVPVVR.D +252.8953
K.SIADIEK.S +127.4839
K.SIVDYGK.R +128.3942
M.TEIRVPTLGESVTEATIGR.W +242.841938.514537.493640.2604
R.LVLDL.- +125.8621
R.RLSTESGVDASTVPGSGKDGR.V +240.3148
R.VPTLGESVTEATIGR.W +231.6642
R.VTKGDMLAAIEK.A +130.0701
R.VTKGDMLAAIEK.A +234.2329
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA018918.58.614.59.725.2sucA putative alpha-ketoglutarate dehydrogenase (E1 subunit) 209481:212438 reverse MW:111339
K.AFLDEALR.- +127.931
K.AFLDEALR.- +231.0646
K.IAGHPTTLEIYSK.R +127.7122
K.IFLDHVLGLEYGSLR.E +232.9028
K.MIDAPIFHVNGDDPEAVVFAAK.I +233.5704
K.TLVHELSR.F +237.6603
R.AASAATATGLMSK.H +134.024627.725428.4633.0585
R.AASAATATGLMSK.H +260.89957.37
R.AIDSGNGLDWATGEALAFCTMLLEGHR.I +232.8018
R.AIDSGNGLDWATGEALAFCTMLLEGHR.I +372.360160.07654.573572.8589
R.ALFHEFKGGSANPDEVEGSGDVK.Y +238.7992
R.DELTSALDGNWNQVEK.A +131.961833.0266
R.FGLDGGEALIPALEQIIK.R +235.826835.8865
R.GIDDVYLLR.V +250.381
R.HGHNEGDEPSFTQPLMYR.K +230.0756
R.LEELGPDTSFHR.V +235.3109
R.LIADGVITEGEVEK.A +245.8725
R.NMGGWHFIEPYLEWVQNQIEAK.H +234.480733.145843.775544.8927
R.NMGGWHFIEPYLEWVQNQIEAK.H +353.8046
R.VEQLYPVPVK.T +133.346131.7453
R.VEQLYPVPVK.T +233.868246.4703
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA019043.565.649.346.365.6sucD succinyl-CoA synthetase alpha-subunit 212566:213450 reverse MW:30063
K.GGSTHLGLPVFDTVR.E +236.4367
K.IGIMPANIFKPGSVGIVSR.S +126.1705
K.IGIMPANIFKPGSVGIVSR.S +247.927755.723654.636751.6324
K.IGIMPANIFKPGSVGIVSR.S +355.697764.352956.814566.4712
K.MVGGTSPGKGGSTHLGLPVFDTVR.E +258.237363.108771.019667.9465
K.MVGGTSPGKGGSTHLGLPVFDTVR.E +353.649348.032157.178353.7381
K.NGTFHSEAAIAYGTK.M +145.736431.5442
K.NGTFHSEAAIAYGTK.M +255.133334.371
K.SRLIGPNCPGVMTAGECK.I +256.0985
K.TAAMEAAGITVSPSPAR.L +136.306628.414534.5535
K.TAAMEAAGITVSPSPAR.L +237.837253.108840.9557
K.TAAMEAAGITVSPSPAR.L +351.2656
M.SILIDSNTR.V +251.214945.04840.216432.941
R.DKTGADASVIYVPPPGAADAICEAIDAEIPLIVCITEGIPVLDMVR.V +352.3432
R.KKPMVGFIAGVTAPPGRR.M +230.184141.82430.8022
R.LIGPNCPGVMTAGECK.I +130.533734.420335.555238.3007
R.LIGPNCPGVMTAGECK.I +253.56855.01756.137857.7565
R.MGHAGAIISGGK.G +135.2532
R.MGHAGAIISGGKGDAASK.T +168.167366.761671.578660.813
R.MGHAGAIISGGKGDAASK.T +268.128467.963378.9864.9163
R.MGHAGAIISGGKGDAASK.T +364.04857.361354.8823
R.MGHAGAIISGGKGDAASKTAAMEAAGITVSPSPAR.L +239.600755.3974
R.MGHAGAIISGGKGDAASKTAAMEAAGITVSPSPAR.L +352.6511
R.RMGHAGAIISGGKGDAASK.T +249.66639.9531
R.VICQGFTGK.N +130.522731.882631.6181
R.VICQGFTGK.N +244.551733.1492
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA019156.864.357.054.564.3sucC succinyl-coA synthetase beta chain 213515:214711 reverse MW:42318
-.MNIHEYQAK.A +137.112340.788436.834136.571
-.MNIHEYQAK.A +236.559645.826450.520532.8489
K.ALNLKGEQAK.Q +139.626141.934927.518835.3381
K.ALNLKGEQAK.Q +245.934749.440345.9005
K.ALNLKGEQAKQAEAMVAK.L +244.277142.489846.627850.4986
K.ALNLKGEQAKQAEAMVAK.L +351.359
K.ASEAEAAAK.Q +127.138927.288333.6826
K.AVLREFGVPVGHGFPIFK.A +251.987155.664250.822758.4787
K.AVLREFGVPVGHGFPIFK.A +368.91769.687972.079269.6016
K.DMDMLEINPLVLTK.Q +155.812155.424156.460250.9766
K.DMDMLEINPLVLTK.Q +272.381987.462878.001669.6985
K.EVGLDVPLVVR.L +133.004226.056925.817626.7151
K.EVGLDVPLVVR.L +246.394263.800434.914845.0559
K.FKEASAGDKGGVR.L +133.5591
K.GILINIFGGIMK.C +137.8018
K.GILINIFGGIMK.C +255.532961.081448.093741.3677
K.HSGLNVLPADNLDDAAQK.I +157.283448.081539.1716
K.HSGLNVLPADNLDDAAQK.I +274.043571.998469.045379.4059
K.HSGLNVLPADNLDDAAQK.I +362.151658.5979
K.HSGLNVLPADNLDDAAQKIVAAVK.G +237.270735.479953.734930.3075
K.HSGLNVLPADNLDDAAQKIVAAVK.G +383.27176.196283.036685.3348
K.HSGLNVLPADNLDDAAQKIVAAVKGA.- +348.9481
K.IIKHSGLNVLPADNLDDAAQK.I +254.329855.858755.1021
K.IIKHSGLNVLPADNLDDAAQK.I +361.227349.518549.2183
K.IITADPNVK.G +125.503328.945927.224928.9029
K.IITADPNVK.G +234.656232.581834.0432
K.IITADPNVKGILINIFGGIMK.C +234.7526
K.IITADPNVKGILINIFGGIMK.C +368.820867.7643
K.ISFDGNALYR.H +246.817948.982249.243541.8814
K.IVSFTVDPATGIMGHHGR.T +249.900361.401164.033352.3246
K.LYGMSPANFLDVGGGASK.E +149.108833.6654
K.LYGMSPANFLDVGGGASK.E +261.103671.304263.222350.2979
K.LYGMSPANFLDVGGGASKEK.V +246.897145.760842.348236.2235
K.LYTAFVAK.D +127.964626.9381
K.LYTAFVAK.D +233.4542
K.QLGGPVWVVK.S +128.727625.320827.3635
K.QLGGPVWVVK.S +230.8708
K.QMLGATLVTVQTGADGKQVNR.L +237.528639.137439.980343.5346
K.SIDEVKEFAK.Q +143.638141.732641.361343.6564
K.SIDEVKEFAK.Q +255.240152.635557.971957.4083
K.VTAAFK.I +128.1024
R.EFGVPVGHGFPIFK.A +135.292243.121238.386536.909
R.EFGVPVGHGFPIFK.A +242.648845.562841.786144.5955
R.LEGTNVEAGKK.I +128.868433.46327.7602
R.LEGTNVEAGKK.I +235.5291
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA019298.499.198.498.499.1mdh malate dehydrogenase 214807:215775 reverse MW:33996
K.ALDIAESSPVDGFDSK.L +158.949261.886552.780356.2843
K.ALDIAESSPVDGFDSK.L +284.36576.426882.552582.4159
K.ALDIAESSPVDGFDSKLTGANSYEAIEGAR.V +239.920138.430959.519855.4076
K.ALDIAESSPVDGFDSKLTGANSYEAIEGAR.V +371.706771.485798.089492.2365
K.ASGLPAKKVVGMAGVLDSAR.F +264.118464.939667.531871.9789
K.ASGLPAKKVVGMAGVLDSAR.F +347.135451.760160.16255.4479
K.DMYVGVPVVIGDK.G +153.353552.211150.35846.7143
K.DMYVGVPVVIGDK.G +257.999
K.DMYVGVPVVIGDKGVER.I +130.406231.706725.1095
K.DMYVGVPVVIGDKGVER.I +250.191160.449765.659762.6252
K.ELGDVVLFDIAEGVPQGK.A +136.475626.143935.800638.6522
K.ELGDVVLFDIAEGVPQGK.A +245.239269.234770.2074
K.ELGDVVLFDIAEGVPQGK.A +353.690168.36254.259
K.IALIGSGQIGGTLAHLVGLK.E +130.243834.851435.7482
K.IALIGSGQIGGTLAHLVGLK.E +261.14767.625272.167374.1912
K.IALIGSGQIGGTLAHLVGLK.E +351.284853.791752.130466.256
K.IALIGSGQIGGTLAHLVGLKELGDVVLFDIAEGVPQGK.A +367.429568.114382.40190.1807
K.IAPDLLGR.- +127.519428.89925.131337.8018
K.IAPDLLGR.- +237.505937.896238.215835.4967
K.KIAPDLLGR.- +128.748229.572430.6738
K.KIAPDLLGR.- +239.647230.2177
K.KVVGMAGVLDSAR.F +134.326946.0255
K.KVVGMAGVLDSAR.F +251.580461.88257.154760.1383
K.KVVGMAGVLDSAR.F +354.6152
K.KYAPDAFVICITNPLDAMVWALQK.A +252.866666.866162.58255.0792
K.KYAPDAFVICITNPLDAMVWALQK.A +360.9819
K.LTGANSYEAIEGAR.V +133.271839.470631.041126.2808
K.LTGANSYEAIEGAR.V +263.466271.283772.570363.8545
K.LTGANSYEAIEGAR.V +348.8264
K.MGWTSQAR.L +127.593632.6
K.MGWTSQAR.L +241.023939.267636.857444.4657
K.RVVPVAAHLNGEYGVKDMYVGVPVVIGDKGVER.I +345.3743
K.TGSAFYAPASSAIAMAESYLK.D +263.245768.715486.960580.4066
K.TGSAFYAPASSAIAMAESYLK.D +376.005769.070852.7337
K.TGSAFYAPASSAIAMAESYLKDK.K +254.580958.37564.799756.1388
K.TGSAFYAPASSAIAMAESYLKDK.K +345.233857.050350.932248.1036
K.TGSAFYAPASSAIAMAESYLKDKK.R +236.022931.975141.5632
K.TGSAFYAPASSAIAMAESYLKDKKR.V +249.777834.663148.4007
K.TGSAFYAPASSAIAMAESYLKDKKR.V +346.6345.620746.2671
K.VMEQVGAGIKK.Y +129.206633.797225.197825.4923
K.VMEQVGAGIKK.Y +246.060441.528938.1989
K.VVGMAGVLDSAR.F +133.77728.683637.83834.4759
K.VVGMAGVLDSAR.F +269.027763.896767.176863.9212
K.YAPDAFVICITNPLDAMVWALQK.A +273.157775.686178.553671.7819
K.YAPDAFVICITNPLDAMVWALQK.A +368.739765.246375.3651
K.YSTVAGIPLPDLVK.M +147.588652.245344.260444.0594
K.YSTVAGIPLPDLVK.M +252.923649.401950.89639.6276
M.ARDKIALIGSGQIGGTLAHLVGLK.E +242.537841.1982
M.ARDKIALIGSGQIGGTLAHLVGLK.E +357.17350.806379.9143
M.ARDKIALIGSGQIGGTLAHLVGLKELGDVVLFDIAEGVPQGK.A +351.013853.9557.016
R.DDLLSINLK.V +139.379531.917841.0901
R.DDLLSINLK.V +242.535841.2034
R.DKIALIGSGQIGGTLAHLVGLK.E +235.335
R.DKIALIGSGQIGGTLAHLVGLK.E +345.7175
R.IVEIELAGK.D +129.2938
R.IVEIELAGKDKEAFDR.S +127.78127.5085
R.IVEIELAGKDKEAFDR.S +267.024154.609473.909471.0899
R.IVEIELAGKDKEAFDR.S +359.164255.958246.1309
R.KPGMSRDDLLSINLK.V +130.39129.376327.6608
R.KPGMSRDDLLSINLK.V +238.993344.735142.7445
R.LDEIVDR.T +125.959328.29726.90630.0614
R.LDEIVDR.T +244.961244.981442.233842.4444
R.NGGAEIVNLLK.T +134.315435.962832.888831.9376
R.NGGAEIVNLLK.T +269.876765.755863.199957.9468
R.SVAAVQGLVEACK.K +134.771643.79139.657938.0784
R.SVAAVQGLVEACK.K +267.654365.9361.890936.8962
R.SVAAVQGLVEACKK.I +136.372240.497940.756743.1208
R.SVAAVQGLVEACKK.I +259.180852.580954.386354.3463
R.SVAAVQGLVEACKK.I +347.1955
R.TRNGGAEIVNLLK.T +242.26133.9906
R.VVIVTAGVPR.K +131.6297
R.VVIVTAGVPR.K +259.522659.412854.139649.2009
R.VVIVTAGVPRKPGMSRDDLLSINLK.V +234.511435.215233.1376
R.VVIVTAGVPRKPGMSRDDLLSINLK.V +347.603951.810851.4661
R.VVPVAAHLNGEYGVK.D +141.005749.121638.081628.8066
R.VVPVAAHLNGEYGVK.D +259.873248.893349.694249.2306
R.VVPVAAHLNGEYGVKDMYVGVPVVIGDK.G +245.938140.8211
R.VVPVAAHLNGEYGVKDMYVGVPVVIGDKGVER.I +248.603136.3882
R.VVPVAAHLNGEYGVKDMYVGVPVVIGDKGVER.I +384.007466.4604
R.YFLADEFNVSVEDVTAFVLGGHGDTMVPLVK.Y +231.5335
R.YFLADEFNVSVEDVTAFVLGGHGDTMVPLVK.Y +358.767353.374949.799857.9154
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA020255.451.530.427.368.3acnA aconitate hydratase 225515:228232 reverse MW:98545
K.ALEHEIAFRPAR.V +125.7708
K.ALEHEIAFRPAR.V +234.4551
K.ALEHEIAFRPAR.V +345.447
K.EGVTATDLVLTVTQMLR.K +267.901835.0869
K.EGVTATDLVLTVTQMLR.K +366.6959
K.EGVTATDLVLTVTQMLRK.Q +251.4569
K.EINAFVK.K +125.7775
K.FVEFFGPGLDNLSVADK.A +143.750325.9917
K.FVEFFGPGLDNLSVADK.A +280.711465.5054
K.FVEFFGPGLDNLSVADK.A +346.6154
K.GADGNIPEGGLTK.H +132.79426.874326.1713
K.GALKEGVTATDLVLTVTQMLR.K +282.743863.247353.0633
K.GALKEGVTATDLVLTVTQMLR.K +352.8826
K.GALKEGVTATDLVLTVTQMLRK.Q +372.5306
K.GISRLPYSMK.V +240.8404
K.GLKAAPWVK.T +126.5621
K.ITTDHISPAGSIK.L +141.809
K.ITTDHISPAGSIK.L +230.746536.6463
K.ITTDHISPAGSIKLTSPAGK.Y +239.1927
K.KADIMAVAK.W +125.789826.9022
K.KALEHEIAFRPAR.V +242.5685
K.LKGALKEGVTATDLVLTVTQMLR.K +249.0485
K.LKGALKEGVTATDLVLTVTQMLR.K +360.6968
K.NGLKGISRLPYSMK.V +233.7743
K.NLAVDPIGTGK.D +141.980925.438
K.NLAVDPIGTGKDGKPVYLK.D +259.1008
K.NLAVDPIGTGKDGKPVYLKDIWPSTK.E +238.775
K.NLAVDPIGTGKDGKPVYLKDIWPSTK.E +355.409251.972848.5944
K.NVAEEYKQNQERYEFLK.W +250.691543.4941
K.QPEPITDVVDAR.V +237.3901
K.RVPLLCR.I +230.6114
K.SINDNGIVAAAVLSGNR.N +263.437663.0471
K.SPDPVFTVTLTLDLADVVPSLAGPKRPEGR.V +349.85750.3747
K.SYVYYSLPTAEK.N +132.702327.6089
K.SYVYYSLPTAEK.N +253.489555.6078
K.SYVYYSLPTAEKNGLK.G +246.417736.1361
K.SYVYYSLPTAEKNGLKGISR.L +242.4651
K.TSLAPGSQVVAEYLANSGLQK.D +252.057250.245757.001166.9123
K.TSLAPGSQVVAEYLANSGLQK.D +354.82159.4295
K.TSLAPGSQVVAEYLANSGLQKDLDK.V +247.118630.3531
K.TSLAPGSQVVAEYLANSGLQKDLDKVGFNLVGFGCTTCIGNSGPLPEEISK.S +345.7997
K.VLLENLLR.N +125.2758
K.VLLENLLR.N +251.10148.48247.6844
K.VLLENLLRNEDDRTVK.K +346.785257.8753
K.VTIRGLEGDLKPR.Q +237.762935.1647
K.VTIRGLEGDLKPR.Q +348.820259.7683
K.YLTER.Q +127.8265
K.YQEEKVPLVVFAGAEYGNGSSR.D +236.953432.898
K.YQEEKVPLVVFAGAEYGNGSSRDWAAK.G +347.2361
M.TSLDSFK.C +126.922925.1954
R.AVICQSFER.I +127.7282
R.AVICQSFER.I +247.165835.6337
R.GLEGDLKPR.Q +125.683729.9327
R.GLEGDLKPR.Q +238.278839.812533.6819
R.GTFANIR.I +126.1996
R.IDTLDELDYYR.N +138.764434.639639.655436.0367
R.IDTLDELDYYR.N +272.768370.81961.783966.1909
R.IDTLDELDYYRNGGILHYVLR.K +345.4896
R.IKNHMLK.G +234.7831
R.KKALEHEIAFRPAR.V +234.6601
R.LPYSMK.V +125.7689
R.NFDIGHGDVVIAAITSCTNTSNPSVLIGAGLLAR.N +232.9858
R.NGGILHYVLR.K +127.4661
R.NGGILHYVLR.K +239.281948.3286
R.QMLEAEITSAAGK.R +132.3627
R.QMLEAEITSAAGK.R +236.4166
R.QMLEAEITSAAGKR.K +243.544537.3934
R.QVRPADFNQYGTR.R +242.896634.159634.8142
R.QVRPADFNQYGTR.R +352.484
R.RGNHEVMMR.G +232.2024
R.SNLVGMGVLPLTFEEGTSWASLGLK.G +268.162632.5465
R.SNLVGMGVLPLTFEEGTSWASLGLK.G +361.9167
R.SNLVGMGVLPLTFEEGTSWASLGLKGDEK.V +237.442636.923830.6128
R.SNLVGMGVLPLTFEEGTSWASLGLKGDEK.V +351.095148.4049
R.VALPAVAEGFTTAMDAEYK.K +263.835253.3691
R.VALPAVAEGFTTAMDAEYKK.A +267.401362.222357.321654.814
R.VALPAVAEGFTTAMDAEYKK.A +352.363359.5951
R.VALPAVAEGFTTAMDAEYKKALDGAR.Y +242.1417
R.VALPAVAEGFTTAMDAEYKKALDGAR.Y +347.412759.4035
R.VALVEK.Y +128.1965
R.VALVEKYAK.A +134.9008
R.VALVEKYAK.A +231.9951
R.VLALFGDK.I +237.5136
R.VLALFGDKITTDHISPAGSIK.L +263.537857.472663.196655.784
R.VLALFGDKITTDHISPAGSIK.L +362.527658.979864.325751.4126
R.VLALFGDKITTDHISPAGSIKLTSPAGK.Y +240.794853.334635.9587
R.VLALFGDKITTDHISPAGSIKLTSPAGK.Y +374.839685.8429
R.VLALFGDKITTDHISPAGSIKLTSPAGKYLTER.Q +363.984745.1716
R.VLMQDFTGVPAVVDLAAMR.N +273.398358.623669.191655.1173
R.VLMQDFTGVPAVVDLAAMR.N +388.441371.893862.6136
R.VSPDVQANYLASPPLVVAYALAGSVTK.N +244.420158.997247.881549.1108
R.VSPDVQANYLASPPLVVAYALAGSVTK.N +376.695582.398250.1466
R.YADVFKGDTNWRK.I +130.2883
R.YADVFKGDTNWRK.I +241.7513
R.YADVFKGDTNWRK.I +345.0731
R.YEFLK.W +127.8399
R.YKVEGR.N +126.4722
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA020729.550.040.243.253.0RPA0207 unknown protein 231468:231866 forward MW:13746
K.AAAPAKSEKTELLDINSATAEQLDALPGVGK.A +356.9409
K.AYSAAIIK.G +125.3786
K.AYSAAIIKGRPYKGKDELVQKK.I +232.6145
K.GRPYKGKDELVQK.K +128.7921
K.GRPYKGKDELVQKK.I +125.421530.174432.5877
K.GRPYKGKDELVQKK.I +236.1951
K.IVPQKTYDGIKDK.I +134.327429.742736.1197
K.IVPQKTYDGIKDK.I +235.9188
K.IVPQKTYDGIKDKIIAK.Q +134.6073
K.IVPQKTYDGIKDKIIAK.Q +245.670130.6076
K.SEKTELLDINSATAEQLDALPGVGK.A +251.1779
K.TELLDINSATAEQLDALPGVGK.A +258.582958.979169.94472.7123
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA02097.027.334.937.152.7ftsY putative cell division protein FtsY 232613:233560 reverse MW:33143
K.EQGRDVLLIDTAGR.L +230.3273
K.HKLPVHFIGVGEGVEDLAPFTAR.D +252.73438.9466
K.HKLPVHFIGVGEGVEDLAPFTAR.D +358.1232
K.KVDATAPHAVLLVLDATVGQNALSQVEAFTK.T +246.930250.3553
K.KVDATAPHAVLLVLDATVGQNALSQVEAFTK.T +347.0873
K.TAGVTGLVMTK.L +130.088229.335829.671
K.VLAPVAQPLEVDAGNKPFVILMVGVNGSGK.T +233.727
R.ADLGTEVAAR.I +239.4615
R.AMLEEIEDVLLR.A +270.236674.361672.415167.239
R.TELMSELEK.V +126.7216
R.TGTPVVAGAQGSDAAGLAFNALTAAK.E +278.444660.8562
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA021125.723.442.337.749.8RPA0211 acetyl-CoA synthetase 234927:236879 forward MW:72459
K.DIGPIASPDLIQFAPGLPK.T +126.036237.132233.1037
K.DIGPIASPDLIQFAPGLPK.T +258.099358.032656.357656.3481
K.IAEDEPSSLGDTSTLADPAVVDDLVEHR.Q +239.836546.168156.051956.1987
K.IAEDEPSSLGDTSTLADPAVVDDLVEHR.Q +379.172592.774784.9881
K.IYDVPAEWASR.A +131.224731.028435.877329.7212
K.IYDVPAEWASR.A +235.379243.673956.998661.986
K.KCEGVDWVMVVKRTGAAVEMDDVR.D +345.9821
K.LKPGSATRPFFGVVPEILDPEGNVLEGECTGNLCLAR.S +361.704556.795
K.VSEAAVVGYPHDIK.G +147.324741.491639.14939.6288
K.VSEAAVVGYPHDIK.G +256.677757.794656.2825
K.VSEAAVVGYPHDIKGQGIYAYVTLMAGEEPTEELRK.E +347.433449.2345
K.WFEDGVLNAAYNCIDR.H +247.4719
M.SEKIYDVPAEWASR.A +137.6639
M.SEKIYDVPAEWASR.A +234.47438.477647.466441.0258
R.AFVDDAK.Y +127.597528.0989
R.ALMQAGDEPVKK.T +126.7026
R.ALMQAGDEPVKK.T +241.163143.5098
R.DTDGFYWITGR.V +126.7637
R.DTDGFYWITGR.V +238.0823
R.FEQTYFSAYKGK.Y +126.7127
R.IGAIHSVVFAGFSPDSLAGR.I +234.134740.0358
R.IGAIHSVVFAGFSPDSLAGRINDCNSK.I +230.8808
R.KDIGPIASPDLIQFAPGLPK.T +275.162978.557481.00278.0145
R.KDIGPIASPDLIQFAPGLPK.T +363.046360.666865.924863.1382
R.KIAEDEPSSLGDTSTLADPAVVDDLVEHR.Q +235.107156.115748.0337
R.KIAEDEPSSLGDTSTLADPAVVDDLVEHR.Q +365.198392.605355.7216
R.KIAEDEPSSLGDTSTLADPAVVDDLVEHRQNKHHK.A +351.7412
R.LLGSVGEPINPEAWEWYHR.V +247.233142.902158.390640.5034
R.LLGSVGEPINPEAWEWYHR.V +353.984767.227153.7514
R.MGTAEVESSLVAHPK.V +130.188428.395435.13728.3241
R.MGTAEVESSLVAHPK.V +261.877851.584566.902353.7972
R.MGTAEVESSLVAHPK.V +347.1079
R.SITYRELHDEVCK.F +235.0587
R.SVTDPTGFWAEHAK.R +135.612631.9224
R.SVTDPTGFWAEHAK.R +252.858149.303364.415461.3688
R.SVTDPTGFWAEHAKR.V +230.899237.4486
R.VDDVINVSGHR.M +259.906641.254953.0953
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA02139.314.519.913.526.1RPA0213 possible OmpA family member 237864:239933 reverse MW:70746
R.AAPPPPPPAAAPAPAPK.R +128.7542
R.DRYIVDYEDASPELIYETLEAPPVER.I +243.106244.368451.823354.4651
R.EIIIIDNSYGPR.D +125.7281
R.EVNENGR.I +125.0329
R.IIVRDPSGQEFIR.H +230.1339
R.ITPLLNGGQAALPPPPPGVAPPR.- +235.7904
R.RAEAAAALLTQQFGVPAENLTSQGYGEQYLK.I +256.441752.91
R.RAEAAAALLTQQFGVPAENLTSQGYGEQYLK.I +347.6586
R.RGPPPGAPGTPPNATAPGMTPPPGEAPR.R +236.345732.243
R.TIVVRPDGTEIINITGDDGQLMR.R +233.059857.002260.7419
R.YIVDYEDASPELIYETLEAPPVER.I +248.762337.711953.755656.8616
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA021620.416.220.48.824.6sdhB succinate dehydrogenase iron-sulfur protein subunit 241162:241944 reverse MW:29531
K.AMDDVRDDAVK.I +231.7145
K.AMDDVRDDAVKINPLPHQPVVK.D +237.9365
K.AMDDVRDDAVKINPLPHQPVVK.D +358.8239
K.GLNPSEAIANLK.L +132.528729.451833.542932.411
K.GLNPSEAIANLK.L +244.899339.894751.308736.2464
K.GLNPSEAIANLKLK.L +126.2373
K.GLNPSEAIANLKLK.L +239.5164
K.INPLPHQPVVK.D +130.4554
M.VEFALPK.N +126.5539
M.VEFALPK.N +236.831736.4908
R.FLGPAALLQATR.W +239.14233.362730.3844
R.LDNLEDPFR.I +238.834
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA021718.118.816.312.932.9sdhA succinate dehydrogenase flavoprotein subunit 242052:243875 reverse MW:65896
K.DGDDNAVVPGLMAIGEAACVSVHGANR.L +231.6387
K.GSDWLGDQDSIEYMVR.N +128.2761
K.GSDWLGDQDSIEYMVR.N +244.504438.407675.600572.4001
K.LVPNGKQPELPASSADMSLSR.L +242.8342
R.AGLPLQDMEFVQFHPTGIYGSGCLVTEGAR.G +235.46840.6614
R.AGLPLQDMEFVQFHPTGIYGSGCLVTEGAR.G +371.867960.0069
R.AMTIEMR.E +232.8766
R.AVVGCSEAGLR.T +251.3902
R.AYASCTSAHTCTGDGGAMALR.A +231.6908
R.LGSNSLIDLVVFGR.A +129.269133.4185
R.LGSNSLIDLVVFGR.A +256.697358.363661.318453.2698
R.LGSNSLIDLVVFGR.A +349.3306
R.NAPEAVYELEHWGVPFSR.T +262.648156.747764.692267.6202
R.NAPEAVYELEHWGVPFSR.T +349.15645.8291
R.TGEVLAEGKELIANVHGSVGDVGVSDR.T +244.826260.0442
R.WHMYDTVK.G +128.4823
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA022115.913.911.527.831.8matB malonyl CoA synthetase 246248:247759 reverse MW:54453
K.GATIDEAQVLHGLDGQLAK.F +232.8405
K.KVIFVDDLPR.N +234.932731.5081
K.NVLR.E +126.387629.1878
K.VGATVETLGPDGRGSLTDAAAGASEAFATIDRGADDLAAILYTSGTTGR.S +346.4765
R.AGGVYLPLNTAYTLHELDYFITDAEPK.I +244.381630.8829
R.DKGATIDEAQVLHGLDGQLAK.F +232.111847.6104
R.GYVHILGR.G +128.527925.096
R.GYVHILGR.G +230.24
R.VANVLVAR.G +238.0964
R.YGMTETNMNTSNPYDGDRVPGAVGPALPGVSAR.V +347.134357.935771.041962.7474
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA022533.144.271.571.571.5sodC putative superoxide dismutase (Cu/Zn) 250637:251155 forward MW:17363
K.ADDYKSDPAGNAGDR.I +133.223325.3108
K.ADDYKSDPAGNAGDR.I +241.8888
K.ADDYKSDPAGNAGDRIACGVIEEAK.- +236.143538.258
K.ATLKNAEGTEIGTATLTESSK.G +268.614364.5167
K.ATLKNAEGTEIGTATLTESSKGVTIK.L +253.283843.8498
K.ATLKNAEGTEIGTATLTESSKGVTIK.L +355.399861.6776
K.CEPPFTSAGGHFNPENKK.H +242.884234.483
K.DGGTALVIHAK.A +129.289243.0807
K.DGGTALVIHAK.A +243.7218
K.GKPNSVFKDGGTALVIHAK.A +132.778140.506230.2213
K.GKPNSVFKDGGTALVIHAK.A +230.231249.77534.1734
K.GKPNSVFKDGGTALVIHAK.A +354.826
K.MAEGGAHAGDMPNLDVPASGALSIDVVNDAVTLAK.G +233.167455.003170.895660.4842
K.MAEGGAHAGDMPNLDVPASGALSIDVVNDAVTLAK.G +380.675783.8275
K.NAEGTEIGTATLTESSK.G +129.926238.187132.913
K.NAEGTEIGTATLTESSK.G +271.87261.3306
K.NAEGTEIGTATLTESSKGVTIK.L +238.560539.673364.27755.3859
K.NAEGTEIGTATLTESSKGVTIK.L +348.8943
R.IACGVIEEAK.- +130.721135.2522
R.IACGVIEEAK.- +258.293853.6091
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA022743.839.244.630.847.8leuB beta-isopropylmalate dehydrogenase 252707:253819 forward MW:39643
K.DLGLFANLRPAVCYPALADSSSLKR.D +356.20957.5079
K.GMANPVAMLASFGMALR.Y +127.15926.7451
K.GMANPVAMLASFGMALR.Y +277.479969.364479.367868.86
K.GMANPVAMLASFGMALR.Y +379.80466.129554.5829
K.LLLLPGDGIGTEVMAEVSR.L +259.088357.587750.805755.0523
K.LLLLPGDGIGTEVMAEVSR.L +347.912259.7082
K.SEGTTVISTSQMGEAIVTELQALHA.- +268.268264.19841.810938.6123
K.SMYEPVHGSAPDIAGK.G +136.569338.684631.7362
K.SMYEPVHGSAPDIAGK.G +235.687334.31258.392
K.SMYEPVHGSAPDIAGKGMANPVAMLASFGMALR.Y +235.9268
K.SMYEPVHGSAPDIAGKGMANPVAMLASFGMALR.Y +353.2172
K.TGVLWNEVITAVHDR.E +247.393332.5799
K.TGVLWNEVITAVHDR.E +357.179766.948748.2539
M.ATHKLLLLPGDGIGTEVMAEVSR.L +242.249833.6298
M.ATHKLLLLPGDGIGTEVMAEVSR.L +347.5415
R.AVDTQVYDTYEIER.I +237.551840.7415
R.ELTGGVYFGEPK.T +126.30830.544429.8009
R.KSMYEPVHGSAPDIAGK.G +132.7496
R.LIDWLNK.A +128.895
R.YSLDMGALADKLDEAIAAVLAK.G +267.05566.285959.384159.6041
R.YSLDMGALADKLDEAIAAVLAK.G +397.448194.9855100.43296.8637
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA022821.833.143.643.654.9RPA0228 unknown protein 253976:254377 reverse MW:14481
K.RSWLDAGTEVQPGER.H +255.951148.1566
R.ENGQRPLDRWPLNPASDLGGSPTGFPLY.- +230.932
R.ENGQRPLDRWPLNPASDLGGSPTGFPLY.- +361.724764.4517
R.HFSDYAFPPGYSFAR.E +131.141925.8344
R.HFSDYAFPPGYSFAR.E +247.212645.576558.491547.2125
R.SWLDAGTEVQPGER.H +127.878934.990639.684
R.SWLDAGTEVQPGER.H +235.394555.648460.821561.2046
R.WPLNPASDLGGSPTGFPLY.- +126.556
R.YGSRGPNVVYQAGPR.T +231.999
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA023033.734.627.937.257.6asdB aspartate-semialdehyde dehydrogenase 255445:256479 forward MW:37476
K.ALEHYDFSDVDICLMSAGGEVSKEWSPK.I +236.2638
K.AVYTNSELVNK.K +251.1217
K.AVYTNSELVNKKFPK.R +234.6691
K.GAALNAIQIAEVLINR.K +255.506748.180938.42
K.GAALNAIQIAEVLINR.K +373.408159.8722
K.IKRVVVSTYQSVSGAGKDAMDELFSQTK.A +351.517946.9671
K.KNIIANPNCSTAQLVVALKPLHDHAK.I +230.9785
K.NIIANPNCSTAQLVVALKPLHDHAK.I +233.924445.276639.9717
K.RVVVSTYQSVSGAGKDAMDELFSQTK.A +346.406
K.VAVVGATGNVGR.E +241.112436.9567
M.GYKVAVVGATGNVGR.E +248.390539.2736
R.EMLAILDER.K +239.848
R.IRTDPTVDNGLVLWCVSDNLRK.G +351.434857.027
R.KAPGCLVIDKHEPGGYVTPYEAAGEDATYISR.I +360.506453.8117
R.KGAALNAIQIAEVLINR.K +263.795354.427763.372851.8484
R.KGAALNAIQIAEVLINR.K +353.974863.349363.4241
R.KGAALNAIQIAEVLINRK.L +352.89261.47465.727382.9016
R.KLITAKK.Q +125.4002
R.VVVSTYQSVSGAGKDAMDELFSQTK.A +246.97444.810964.657459.4993
R.VVVSTYQSVSGAGKDAMDELFSQTK.A +367.177276.511265.6876
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA023362.759.648.329.565.4RPA0233 putative Citrate lyase beta chain (acyl lyase subunit) (citE) 258147:259025 forward MW:31312
K.AGPDGILVPK.V +129.222827.228425.1279
K.AGPDGILVPK.V +242.948348.5824
K.KTIAIADAIETAGH.- +234.5936
K.SRLEGFVFGPNDISR.E +242.2302
K.TIAIADAIETAGH.- +127.769225.3239
K.TIAIADAIETAGH.- +257.160668.7054
K.TLIHPGQIDACNAAFTPPPEDVAQAR.K +249.578553.674457.1571
K.TLIHPGQIDACNAAFTPPPEDVAQAR.K +354.219352.4799
K.VSSIEDIATVGNK.L +125.338327.05726.2629
K.VSSIEDIATVGNKLAELGADPSIR.V +233.4983
R.ETGIR.M +128.3639
R.GVLHAEELAAQK.H +131.9541
R.GVLHAEELAAQKHEAK.S +151.44935.3233
R.GVLHAEELAAQKHEAK.S +252.850239.7328
R.GVLHAEELAAQKHEAK.S +347.3119
R.KILAAFERPENQGR.G +238.209336.3203
R.LEGFVFGPNDISR.E +235.37738.9054
R.LLPVDGLILDLEDAVAPDAK.D +260.354158.134750.221164.8447
R.LLPVDGLILDLEDAVAPDAK.D +363.257570.4408
R.LLPVDGLILDLEDAVAPDAKDTAR.D +252.230934.061938.3071
R.LLPVDGLILDLEDAVAPDAKDTAR.D +347.8839
R.STMLSMITHCVLAAR.V +241.600633.039
R.STMLSMITHCVLAAR.V +371.489253.818
R.VHGLIALDGPYSDIGNVDGLSEECAQAR.D +245.606360.500365.607947.3677
R.VHGLIALDGPYSDIGNVDGLSEECAQAR.D +356.939899.6269
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA023543.845.351.751.753.2leuD 3-isopropylmalate dehydratase small subunit 261643:262248 reverse MW:22323
-.MDKFTTLEGVAAPLK.I +130.302941.491728.601726.5678
-.MDKFTTLEGVAAPLK.I +259.10552.516960.277369.1382
-.MDKFTTLEGVAAPLK.I +355.279
-.MDKFTTLEGVAAPLKIINVDTDMIIPK.Q +240.542835.301243.332845.649
-.MDKFTTLEGVAAPLKIINVDTDMIIPK.Q +384.630178.333693.220499.2152
K.HCLINGLDDIGLTLEK.K +136.5871
K.HCLINGLDDIGLTLEK.K +240.3231
K.IINVDTDMIIPK.Q +128.204527.1859
K.IINVDTDMIIPK.Q +263.482374.788833.443134.4714
K.ILVAGDNFGCGSSR.E +252.106463.668266.187239.6249
R.EHAPWALLDFGIR.C +128.739
R.EHAPWALLDFGIR.C +237.396341.032837.619651.8097
R.VSQADLDKLFDDAER.G +127.7258
R.VSQADLDKLFDDAER.G +243.394637.098451.763559.8125
R.YKDDGSENPDFILNKPAYR.G +260.528170.57951.997862.1332
R.YKDDGSENPDFILNKPAYR.G +357.100650.967653.7208
R.YKDDGSENPDFILNKPAYRGAK.I +253.6536
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA024026.939.433.336.953.1leuC 3-isopropylmalate dehydratase 265013:266422 reverse MW:50478
K.AGFEWREPGCSMCLAMNPDKLAPEER.C +348.268455.5357
K.GAAWDAALR.Y +127.337
K.GAAWDAALR.Y +236.708740.9361
K.LDAAALPPIVTWGTSPEDVISVTGR.V +252.017242.2501
K.TLAVVDHNVPTTDR.S +129.453129.6541
K.TLAVVDHNVPTTDR.S +253.969355.650641.510743.7589
K.TVNANVNAIIVPGSGLVK.E +128.0077
M.SAKPTTLYDKIWNDHLVHEAEDGTCLLYIDR.H +366.7041
R.AGLIAPDER.A +128.7922
R.AGLIAPDER.A +237.370831.0638
R.ALAYMGLTPGTK.I +136.387935.957739.496938.6502
R.ALAYMGLTPGTK.I +250.996153.605835.897743.4168
R.DFGITYYNEFDKR.Q +237.9734.9126
R.HLVHEVTSPQAFEGLR.T +133.781533.1807
R.HLVHEVTSPQAFEGLR.T +255.041862.077264.829660.5073
R.HLVHEVTSPQAFEGLR.T +356.215664.32580.577380.2196
R.MFIGSCTNGR.I +231.6694
R.SKPNPDPESAEQIAALAENAR.D +262.336965.410259.063468.3203
R.SKPNPDPESAEQIAALAENAR.D +350.816556.4731
R.THLVSPAMAAAAAIAGHFVDIR.D +236.608350.585440.068
R.THLVSPAMAAAAAIAGHFVDIR.D +360.979759.945762.557350.9665
R.THLVSPAMAAAAAIAGHFVDIRDWH.- +257.319854.2587
R.VTVDGQLPDGVTAK.D +132.966337.287835.0737
R.VTVDGQLPDGVTAK.D +244.260647.034235.6325
R.YWDTLR.S +126.7367
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA024137.237.230.222.549.6rplS, L19 50s ribosomal protein L19 266732:267121 reverse MW:14297
K.LYYLR.N +128.5367
K.TIPEFGPGDTVIVNVK.V +133.618631.75935.29637.1064
K.TIPEFGPGDTVIVNVK.V +254.395346.046743.710849.1833
K.TIPEFGPGDTVIVNVKVVEGER.S +235.6216
R.AKLYYLR.N +230.2006
R.KISYGEGVER.V +125.9301
R.SGGGINESFTVR.K +127.552828.4262
R.SGGGINESFTVR.K +239.179644.3666
R.SGGGINESFTVRK.I +126.5349
R.VFPLLSPMIDSIK.V +143.941236.778550.478133.8266
R.VFPLLSPMIDSIK.V +254.336663.155540.112636.7487
R.VFPLLSPMIDSIK.V +362.870659.5846
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA024439.634.930.230.239.6rpsP, S16 ribosomal protein S16 268667:268987 reverse MW:12149
K.LDLDKVKDWLAK.G +231.4069
M.SVVIR.L +128.5926
R.FLDTAGVR.K +131.519229.6012
R.FLDTAGVR.K +244.898347.588542.333339.4977
R.LGYFNPLMAK.D +134.226333.2831.308331.8928
R.LGYFNPLMAK.D +253.424956.892846.230350.9132
R.LGYFNPLMAKDNEAR.L +131.9193
R.LGYFNPLMAKDNEAR.L +251.210657.5055
R.LGYFNPLMAKDNEAR.L +352.746763.6324
R.LKLDLDKVKDWLAK.G +145.411650.386445.67849.134
R.LKLDLDKVKDWLAK.G +265.933761.526161.923361.6406
R.LKLDLDKVKDWLAK.G +357.634963.439264.65864.4324
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA024517.115.315.319.232.4ffh/ftsY signal recognition particle protein 269157:270707 reverse MW:54743
-.MFDNLSEK.L +126.6345
K.AAANPHEVLLVADSLTGQDAVNLAR.A +247.4686
K.AAATLDAEKAAAVAEK.M +237.628431.5061
K.GKFDLTDLRDQLLQMTK.M +230.9243
K.LGGYDVVLLDTAGR.T +131.332131.249
K.LGGYDVVLLDTAGR.T +237.472145.1
K.MGGIGGLMGLMPGISK.M +245.9268
R.DLQIDTLPIVAGQQPPDIAR.R +230.274545.827159.699
R.GALSEADVDAAMR.E +126.3602
R.ILGMGDIVSLVEK.A +128.4506
R.ILGMGDIVSLVEK.A +271.376857.465447.065563.3502
R.TTLDEDMMTEAAEIK.A +133.73
R.TTLDEDMMTEAAEIK.A +240.305632.653759.151954.4638
R.VGLTGIVLTR.I +246.857745.5313
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA024833.628.029.331.540.9bp26 DUF541 272667:273365 reverse MW:23918
K.SVAPDTAVIEAGVSNFAK.S +140.895136.947436.396444.2537
K.SVAPDTAVIEAGVSNFAK.S +258.962364.019732.363648.302
K.VLLELK.N +127.6373
R.AAAEATNLAIGK.V +125.266726.252427.2877
R.AAAEATNLAIGK.V +247.448952.3606
R.AAGLTLGAPVSIAEDSGPGVMPMR.K +233.7539
R.AAGLTLGAPVSIAEDSGPGVMPMRK.M +238.948945.408535.520248.3961
R.AAGLTLGAPVSIAEDSGPGVMPMRK.M +345.0539
R.GISFTVSNASK.L +130.587
R.LMVAGANEVR.G +246.275741.4422
R.VRDITALAGILDR.L +244.205156.244653.2912
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA025724.722.217.323.739.7RPA0257 conserved unknown protein 280945:282354 forward MW:47487
K.AAAPLAPDAGSLNPLDR.F +246.1295
K.AASDGAAAADPAATGRIDALEK.S +250.931944.5734
K.LEAAPTAGGATAVPSDSAALEALAIR.I +247.131935.896647.473154.1109
K.SVASLRDDLTALR.S +232.696530.333935.724338.7317
R.ALGQELIDQLPNLLPDKTHSNANFIDR.F +350.0112
R.AVAATLLDLAVTQGQPFQALLK.A +249.535234.331851.616551.9351
R.AVAATLLDLAVTQGQPFQALLK.A +378.850680.567359.5002
R.DQALAASHQFATAALGALQKPSP.- +244.9003
R.IAKLEAAPTAGGATAVPSDSAALEALAIR.I +237.880135.2009
R.IAKLEAAPTAGGATAVPSDSAALEALAIR.I +351.575
R.LGALETAAKAEAEKPAPK.S +240.730557.9076
R.RAVAATLLDLAVTQGQPFQALLK.A +351.5317
R.SQTDQLAATVKDLK.A +231.4087
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA025820.017.727.620.034.0RPA0258 unknown protein 282363:284060 forward MW:60386
K.VIEAAWQAQPHPDLASTYANLKPGDTATAR.L +361.0657
R.AAIDAGSFSR.A +238.79
R.ADDPYAALAIAEEALR.V +125.58
R.ADDPYAALAIAEEALR.V +269.252367.296472.305679.3214
R.ADDPYAALAIAEEALR.V +390.3232
R.AIDLEESDESLAR.D +126.1445
R.AIDLEESDESLAR.D +237.5847.780439.8825
R.ALHDPVWTADGYVSDHWRPVSPVTGR.L +351.9346
R.DSALEANKLAPTLVPAAVLAAK.Y +243.523945.497648.229442.185
R.LDAFQWQVPVSALPSSK.A +130.2407
R.LDAFQWQVPVSALPSSK.A +256.261649.697460.5842
R.LGRVENLVGKGPQQLESALAIAR.A +352.140161.2875
R.NLSAGLIDKK.A +128.7133
R.SDWTGALEILER.N +129.01226.2799
R.SDWTGALEILER.N +266.699364.733953.319360.9638
R.TVLQPYLDMPTQR.V +236.7744
R.VENLVGKGPQQLESALAIAR.A +252.911239.6371
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA025930.019.617.39.630.0RPA0259 HTransmembrane sensor and HAMP domains 284749:285531 reverse MW:27423
K.IQQSLIELAK.L +135.086828.780631.7347
K.IQQSLIELAK.L +248.007144.743837.559931.7592
R.EMLFTDGR.T +233.030633.2607
R.GLLAPLGELEKDVER.L +130.1226
R.GLLAPLGELEKDVER.L +255.998556.049439.60961.3326
R.GLLAPLGELEKDVER.L +348.4151
R.SIAKIQQSLIELAK.L +134.2065
R.SIAKIQQSLIELAK.L +252.481744.4492
R.SIAKIQQSLIELAK.L +360.41661.1883
R.SWSSWLHNGLGVPK.R +125.23929.7424
R.SWSSWLHNGLGVPK.R +248.872530.2749
R.VLDGTNGILSNLKEMWMDLK.G +234.3858
R.VLDGTNGILSNLKEMWMDLKGAVSNAR.E +349.4041
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA02619.412.524.216.830.3RPA0261 unknown protein 287243:288424 forward MW:42275
K.SYPFDHLPMIDYDAHPAYGR.V +247.542150.9298
K.SYPFDHLPMIDYDAHPAYGR.V +358.215964.757250.4838
K.VDDSYNVLK.M +128.7099
R.DGFAAVQLGPDK.I +129.8734
R.DGFAAVQLGPDKIVELR.N +269.680458.504373.121274.3349
R.DGFAAVQLGPDKIVELR.N +351.938659.1196
R.ETFYALPAGLQR.K +129.0094
R.NQLEAAFK.T +126.971535.691637.1287
R.RFWDAMIR.R +234.617635.6588
R.SAVIVTFTELPR.- +235.5195
R.VVIDPTAAPDLYK.W +135.743134.5402
R.VVIDPTAAPDLYKWFNQVAADAGLTEAASGYLK.R +367.9767
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA026817.832.961.834.766.7RPA0268 putative Lon family ATP-dependent protease 296626:297303 forward MW:24793
K.ANNLKVDWDGVESAPNEALVNALAMMSPYGPPEK.Q +231.518531.688
K.VDWDGVESAPNEALVNALAMMSPYGPPEK.Q +234.302853.019351.0321
K.VDYFPFVDDFTAR.K +239.7092
M.PINAAYRGPADLPEVIPVFPLAGALLLPR.G +237.492246.230940.153336.7733
M.PINAAYRGPADLPEVIPVFPLAGALLLPR.G +361.321765.15468.247456.3742
R.FKVVDELQVLTPYR.Q +233.7437
R.GPADLPEVIPVFPLAGALLLPR.G +241.42642.019633.467140.1819
R.GQMPLNIFEPR.Y +235.63140.946
R.KGEDEVDRETLLSVLTDFLK.A +234.1265
R.KGEDEVDRETLLSVLTDFLK.A +361.931668.4972
R.LIGMIQPDAAHSSETAEKPSLFNVGCVGR.I +350.6689
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA027017.214.817.918.526.3ubiH putative UbiH protein, 2-octaprenyl-6-methoxyphenol 4-monoxygenase 297726:299087 reverse MW:48794
K.SFPLGYFVAQSFIAPR.L +236.8843
K.SFPLGYFVAQSFIAPR.L +348.756154.7326
R.GIRDIGLGLVDRLPPLK.G +357.0081
R.GIRDIGLGLVDRLPPLKGAFIR.Q +346.132665.5807
R.LALIGDAAHVIHPIAGQGLNMGLR.D +347.503774.196360.2941
R.LALIGDAAHVIHPIAGQGLNMGLRDVAALAEVVVDAAR.L +352.268153.392853.139650.3508
R.LGDIKPLDKPK.S +136.5183
R.LGDIKPLDKPK.S +238.012
R.LGIDPGQVDVLER.Y +126.0029
R.LGIDPGQVDVLER.Y +260.357861.169341.348455.3762
R.QAAGLTGEIPR.L +230.484
R.YLVEALAK.R +125.2954
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA027233.939.354.540.266.1glnK1 GlnK, nitrogen regulatory protein P-II 300253:300591 forward MW:12361
-.MKLVVAIIKPFKLDEVR.Q +238.950851.33244.4868
-.MKLVVAIIKPFKLDEVR.Q +359.5868
K.IFVTPIDR.A +230.618832.013532.6089
R.GAEYIVNFLPK.L +130.1427
R.GAEYIVNFLPK.L +243.727436.463349.81
R.IEIAVDSALADKAVEVITR.G +246.208
R.IRTGETDVDAL.- +125.9198
R.TGETDVDAL.- +125.538127.5703
R.TGQIGDGKIFVTPIDR.A +232.529149.4088
R.TGQIGDGKIFVTPIDR.A +359.260249.358
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA028714.814.66.84.818.0leuS leucyl-tRNA synthetase 315572:318202 forward MW:97725
K.FMAIAADHPLAQAAAAK.A +245.5035
K.IFTTRPDTLFGAK.F +242.8751
K.RLETEQLAGAPVGAR.K +232.3638
K.YYVLEMFPYPSGR.I +232.0989
R.ATLLDGGSPVEIGPIEK.M +248.6069
R.DAPTSEIEAAVLALDTVK.Q +132.4083
R.DAPTSEIEAAVLALDTVK.Q +248.346940.2647
R.FTDPWNTEAPTTPDVVNR.M +248.982641.166646.4409
R.GYNVLHPMGWDAFGLPAENAAIER.K +253.216951.297439.497147.8807
R.MMPVDQYIGGVEHAILHLLYSR.F +252.964949.6744
R.RATLLDGGSPVEIGPIEK.M +273.000959.672658.382859.6414
R.RATLLDGGSPVEIGPIEK.M +346.579654.75
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA028823.56.423.523.523.5RPA0288 conserved unknown protein 318189:318752 forward MW:20275
R.AVQEIAENINTR.L +126.121232.200430.845531.1763
R.AVQEIAENINTR.L +257.372354.4223
R.SSLIVDPSTQLPTIENYAIDASYQLK.D +246.3359
R.SSLIVDPSTQLPTIENYAIDASYQLKDIATGK.T +231.5664
R.SSLIVDPSTQLPTIENYAIDASYQLKDIATGK.T +349.042349.839249.9473
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA029618.812.643.535.444.9rho transcription termination factor rho 326580:327845 reverse MW:47129
K.AKTPAELVSFSEELGVENASTMR.K +249.5288
K.ETDIIGEGVVEVLSDGFGFLR.S +247.954653.4228
K.VLTGGVDANALQRPK.R +245.871862.349165.2857
R.AYNTVVPSSGK.V +126.16830.4663
R.AYNTVVPSSGKVLTGGVDANALQRPK.R +239.4923
R.HVQVAEMVIEK.A +137.4138.6543
R.HVQVAEMVIEK.A +244.527149.2772
R.ILNPMGTMDAIEFLLDK.L +137.492
R.ILNPMGTMDAIEFLLDK.L +247.290781.366877.0279
R.ILNPMGTMDAIEFLLDKLR.N +240.937166.932967.607
R.ILNPMGTMDAIEFLLDKLR.N +350.086748.157950.429251.4062
R.LVEHGRDVVILLDSITR.L +249.236748.6766
R.LVEHGRDVVILLDSITR.L +353.465269.189568.5394
R.RILNPMGTMDAIEFLLDKLR.N +238.4801
R.RILNPMGTMDAIEFLLDKLR.N +363.446679.603186.9163
R.SGTRKEELITDPQLLKK.M +242.695143.6511
R.SPDANYLPGPDDIYVSPSQIR.R +253.597555.5234
R.SVKGEVISSTFDEPAVR.H +128.251528.7478
R.SVKGEVISSTFDEPAVR.H +270.732567.08272.519671.8567
R.VIDIVAPIGK.G +141.553840.7954
R.VIDIVAPIGK.G +237.99346.150140.6578
R.YFALLK.V +125.8798
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA030314.99.725.610.731.8RPA0303 conserved unknown protein 332729:333598 forward MW:31577
K.FVSQMISATR.D +249.096641.489
K.GIAEPDSELEHGLNAIAQNDSSFDAQHFITGAK.S +368.5985
R.DKTGAVVDGSPDKVVDITDVWTFAR.D +251.777257.4738
R.DKTGAVVDGSPDKVVDITDVWTFAR.D +358.76758.907467.7131
R.DTSSRDPNWKLVGTGSGT.- +235.293137.107
R.FVSIEK.A +129.138226.1202
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA030916.812.731.023.931.0hisB imidazoleglycerol-phosphate dehydratase 338703:339296 forward MW:21349
K.AVGDLHVDFHHTTEDVGIALGQAVK.Q +245.569954.418470.414348.6807
K.AVGDLHVDFHHTTEDVGIALGQAVK.Q +361.816556.485866.646849.2695
R.AAVAIDPK.T +131.991628.894431.0219
R.VVIDVSGRPFLVFK.A +125.597
R.VVIDVSGRPFLVFK.A +236.998846.2526
R.YATVLMPMDETLTR.V +127.6709
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA031116.733.325.532.444.0hisH imidazoleglycerol-phosphate synthase, amidotransferase component 339842:340492 forward MW:23630
K.GLHAYFVHSFHLAAEHEGDVLAR.A +345.4884
M.SVAIVDYGSGNLHSAAK.A +125.8128
M.SVAIVDYGSGNLHSAAK.A +231.255841.2472
R.ADYGGPVTAVVGKDTAIGTQFHPEK.S +235.782545.11434.6142
R.FGLALISNFLK.W +247.410659.526661.246253.9385
R.GKEHVTTDGLNWIAGDVVK.I +253.492745.198645.9418
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA032922.428.715.27.231.2rph ribonuclease PH 356701:357414 reverse MW:25980
K.YAEGSCLVK.F +128.3468
R.GWVTAEYGMLPR.A +238.8862
R.LVDLQK.M +128.4311
R.TASITGAWVALADCLNWMK.A +259.588856.568161.1799
R.TASITGAWVALADCLNWMK.A +359.166754.088245.6166
R.TIVDLEALGER.Q +253.254659.5847
R.TPFSQDEFLQLMALAQK.G +125.743930.321229.769528.1749
R.TPFSQDEFLQLMALAQK.G +277.91481.369685.829480.8059
R.TPFSQDEFLQLMALAQK.G +364.357462.1458
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA033135.133.29.619.235.1RPA0331 possible heat shock protein (HSP-70 COFACTOR), grpE 358745:359371 forward MW:22207
K.ALIEGVELTER.S +128.2537
K.ALIEGVELTER.S +255.942959.2292
R.ALDAVPADAR.A +129.6018
R.ALDAVPADAR.A +239.450234.6311
R.DVLDIADNLQR.A +132.3240.034635.569235.2353
R.DVLDIADNLQR.A +260.874868.946758.1388
R.SLLNALEK.N +128.239229.84
R.SLLNALEK.N +245.729339.1965
R.TLAEMENLR.K +128.483327.2395
R.TLAEMENLR.K +239.780742.2602
R.TYGVTSFAR.D +125.3043
R.TYGVTSFAR.D +243.913440.658838.4849
R.VLRPALVGVAK.G +127.7404
R.VLRPALVGVAK.G +248.554445.090141.3288
R.VLRPALVGVAKGGAK.A +232.1239
R.VLRPALVGVAKGGAK.A +354.9008
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA033218.518.524.618.524.6RPA0332 conserved unknown protein 359478:360419 reverse MW:33481
K.VLVSELPGPAFDQIDAAFK.A +237.668447.189641.435243.9909
K.VLVSELPGPAFDQIDAAFK.A +368.0679
R.FAQQAAEAIPGVR.E +131.3984
R.FAQQAAEAIPGVR.E +240.400941.045447.767243.2981
R.VGIVPMPGLNQSTAFLGFESGDQGVK.V +243.304439.190954.597656.9953
R.VTGVSGKNNTPVTVVQWLR.F +234.9151
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA033362.864.759.163.575.9dnaK heat shock protein DnaK (70) 360754:362649 forward MW:67947
K.ALKDAGLTAGEISEVVLVGGMTR.M +232.119974.641270.3076
K.ALKDAGLTAGEISEVVLVGGMTR.M +348.8213
K.ASNGDAWVEADGK.T +128.463443.676137.2294
K.ASNGDAWVEADGK.T +254.5132
K.ASNGDAWVEADGKTYSPSQVSAFILQK.M +254.602357.135953.708464.9341
K.ASNGDAWVEADGKTYSPSQVSAFILQK.M +362.249377.3888
K.DAGKIAGLEVLR.I +140.123243.036626.687534.1105
K.DAGKIAGLEVLR.I +240.193743.937441.0779
K.DAGKIAGLEVLR.I +359.1271
K.DKATGKEQQIR.I +126.1855
K.DKGLVPYKIVK.A +135.2517
K.DKLALQRLK.E +126.2111
K.DVLLLDVTPLSLGIETLGGVFTR.I +255.222156.02348.044636.8297
K.DVLLLDVTPLSLGIETLGGVFTR.I +346.413550.2951
K.FEALVDDLVQK.T +125.516242.0669
K.FEALVDDLVQK.T +239.0635
K.GLVPYKIVK.A +131.4245
K.HLTMK.L +125.398
K.IAGLEVLR.I +130.4217
K.IAGLEVLR.I +253.937352.060437.633
K.IELSSTTQTEINLPFITADQSGPK.H +231.3871
K.KSQVFSTAEDNQNAVTIR.V +263.3014
K.LGEAMYK.Q +131.522930.422532.287334.993
K.LGEAMYK.Q +232.036333.2402
K.LGEAMYKQAEAAGGAQQAGKDDVVDAEFTEVDDDKKK.S +345.198656.8227
K.MKETAEAHLGQK.V +143.070145.01140.909340.7026
K.MKETAEAHLGQK.V +234.976643.361347.2435
K.MLGQFDLMGIPPAPR.G +128.378732.737337.212331.574
K.MLGQFDLMGIPPAPR.G +242.259648.655738.840142.2422
K.NHADALVHSTEK.A +155.477954.345155.816952.397
K.NHADALVHSTEK.A +253.961143.876356.435547.0706
K.QAEAAGGAQQAGKDDVVDAEFTEVDDDKKK.S +232.3264
K.QAEAAGGAQQAGKDDVVDAEFTEVDDDKKK.S +362.672769.115863.4652
K.SNTLAQASMK.L +132.763132.525633.50630.6556
K.SNTLAQASMK.L +248.2693
K.SQVFSTAEDNQNAVTIR.V +261.700563.442574.686870.6899
K.STNGDTFLGGEDFDMR.L +126.0988
K.STNGDTFLGGEDFDMR.L +263.432370.4458.950160.8309
K.TYSPSQVSAFILQK.M +145.534742.6135.739930.6285
K.TYSPSQVSAFILQK.M +264.469469.208961.04960.5474
K.VDQAVITVPAYFNDAQR.Q +128.2413
K.VDQAVITVPAYFNDAQR.Q +234.678746.227950.959349.0562
K.VIENAEGMR.T +127.691725.918633.565
K.VIENAEGMR.T +251.123937.6668
K.VQEVVK.Q +133.251328.112826.2712
R.AKFEALVDDLVQK.T +159.477255.012750.86549.7111
R.AKFEALVDDLVQK.T +274.741380.482778.040881.2996
R.AKFEALVDDLVQK.T +369.544970.9216
R.EALKGDDAEAIKAK.S +151.6756
R.EALKGDDAEAIKAK.S +234.4624
R.EAVDAKNHADALVHSTEK.A +131.021931.5032
R.EAVDAKNHADALVHSTEK.A +262.274947.728746.472741.2755
R.EAVDAKNHADALVHSTEK.A +358.766248.2681
R.IIDRNTTIPTKK.S +230.9658
R.IINEPTAAALAYGLDK.A +152.501554.063951.687951.979
R.IINEPTAAALAYGLDK.A +285.400183.596680.258674.3468
R.IINEPTAAALAYGLDK.A +377.774287.458458.3811
R.IINEPTAAALAYGLDKAK.T +126.239742.685341.2752
R.IINEPTAAALAYGLDKAK.T +255.272157.41855.244352.8028
R.IINEPTAAALAYGLDKAK.T +353.967545.059545.2872
R.IQASGGLSDSEIDK.M +135.293341.961738.478843.5831
R.IQASGGLSDSEIDK.M +237.664741.459652.8955
R.IQASGGLSDSEIDKMVK.D +126.108226.3472
R.IQASGGLSDSEIDKMVK.D +263.306469.231355.392751.3074
R.IQASGGLSDSEIDKMVKDAEANAAEDKKRR.E +346.9359
R.KALKDAGLTAGEISEVVLVGGMTR.M +251.815267.854454.1297
R.LKEAAEK.A +125.3812
R.LVNYLADEFQK.E +149.799650.277934.727441.0901
R.LVNYLADEFQK.E +257.749558.144931.284955.3797
R.LVNYLADEFQKEQGIDLR.K +260.998871.638878.603363.3759
R.LVNYLADEFQKEQGIDLR.K +392.157192.68973.663359.6913
R.LVNYLADEFQKEQGIDLRK.D +247.6869
R.LVNYLADEFQKEQGIDLRK.D +349.1267
R.LVNYLADEFQKEQGIDLRKDK.L +234.4576
R.LVNYLADEFQKEQGIDLRKDKLALQR.L +353.289451.0935
R.QATKDAGKIAGLEVLR.I +234.0875
R.RYDDPMVEKDKGLVPYK.I +238.151933.1969
R.RYDDPMVEKDKGLVPYKIVK.A +248.077645.5203
R.RYDDPMVEKDKGLVPYKIVK.A +356.686659.352645.1481
R.SIEDALSDLR.E +127.135
R.SIEDALSDLR.E +254.117552.139348.191156.4307
R.SIEDALSDLREALKGDDAEAIK.A +230.061644.897541.3345
R.SIEDALSDLREALKGDDAEAIK.A +347.727972.245667.96159.6103
R.SIEDALSDLREALKGDDAEAIKAK.S +234.142448.4423
R.SIEDALSDLREALKGDDAEAIKAK.S +358.235954.997660.156164.046
R.TFFAVK.R +127.858927.749827.426831.5765
R.TFFAVKR.L +232.6645
R.TTPSIVAITDDGER.L +129.19734.562241.911130.4723
R.TTPSIVAITDDGER.L +257.524253.282956.743758.7521
R.TTPSIVAITDDGERLVGQPAKR.Q +231.5417
R.VFQGEREMAADNK.M +230.954537.5646
R.YDDPMVEKDKGLVPYKIVK.A +238.709742.201830.0501
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA033730.424.521.935.939.7pyrF orotidine 5`-phosphate decarboxylase 365393:366106 forward MW:24690
K.AAADAIVAEIAAAR.G +126.497435.7266
K.AAADAIVAEIAAAR.G +255.652657.389446.2992
K.AIAAGASYLVVGRPVLDAPDPK.A +232.048
K.IGYQLAYAGGLPLAR.A +133.5592
K.IGYQLAYAGGLPLAR.A +258.706952.434145.074452.6808
R.GVESLSHLGASFLTVHAYPQTMK.A +252.674560.414862.519263.3314
R.GVESLSHLGASFLTVHAYPQTMK.A +359.619267.195575.4704
R.LGDSVGFYK.I +131.425.9698
R.LIVALDLPDLR.V +254.337842.671532.242
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA033917.023.623.617.023.6dapB dihydrodipicolinate reductase 366537:367352 forward MW:27784
K.GKKPGLYSMADVLGLGDI.- +134.584228.8371
R.AKVDAPSGTALLLGEAVAAGR.K +236.415863.880376.834358.0183
R.GIAHIIGTTGLSTSDNAVIQSVTDR.A +269.138563.974581.2018
R.GIAHIIGTTGLSTSDNAVIQSVTDR.A +345.46260.1222
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA034015.718.338.531.744.2pgm1 phosphoglycerate mutase 367433:368947 reverse MW:53352
K.ASGGTCHLMGLVSPGGVHSLQDHACALAK.I +241.622936.9562
K.ASGGTCHLMGLVSPGGVHSLQDHACALAK.I +348.116247.8038
K.AVAAIESGKYDLIVLNFANPDMVGHTGSLPAAIK.A +237.7467
K.AVAAIESGKYDLIVLNFANPDMVGHTGSLPAAIK.A +349.446481.2087
K.AVETVDTQLGHIVAAIR.K +253.280755.347260.647955.1576
K.LMELPQPAEMTGK.S +131.513
K.LMELPQPAEMTGK.S +236.7059
K.TPTFDALWTNGPHAFLR.T +246.635153.3165
K.TPTFDALWTNGPHAFLR.T +356.755260.812662.430251.5702
K.VATYDLQPEMSAPELGDK.A +130.888
K.VATYDLQPEMSAPELGDK.A +256.9583
R.EILAALLDSAFAGFPR.K +132.7191
R.EILAALLDSAFAGFPR.K +260.744939.630938.4207
R.EILAALLDSAFAGFPR.K +366.347166.528
R.ISDAIANGEIERAPGLVAFIDKLK.A +353.7441
R.MAETEKYPHVTYFLNGGEEVPYPGEDR.I +241.929252.0954
R.RPVMLVILDGWGWREDPADNAVLQAK.T +348.5749
R.VREILAALLDSAFAGFPR.K +235.207338.8699
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA03528.58.58.58.58.5lepA possible GTP-binding protein LepA 381139:382950 reverse MW:66746
K.IAEIEEPWIEATILTPDEYLGSVLK.L +242.363739.58946.752648.3052
K.MVNVEELGPGEVGFITAAIKEVADTR.V +235.760232.7363
K.MVNVEELGPGEVGFITAAIKEVADTR.V +348.252449.240752.037855.1695
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA035521.142.150.442.171.4RPA0355 PTS system permease (IIAMan), nitrogen regulatory IIA protein 384983:385384 reverse MW:14152
K.AALEHVMGPQQQIEAVTIGAEDDADLCR.S +234.536365.884361.6546
K.AALEHVMGPQQQIEAVTIGAEDDADLCR.S +347.7661
K.VEVLAGINLPMLVK.L +134.6166
K.VEVLAGINLPMLVK.L +238.844351.9836.5764
R.SDIIEAVNRVDSGEGVAILTDMFGGTPSNLAISCMSRPK.V +345.1962
R.SLPEAIALAQEAGR.K +127.9215
R.SLPEAIALAQEAGR.K +254.288555.769
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA035821.027.021.040.346.4chvI two-component transcriptional regulator ChvI, winged helix family 387944:388645 reverse MW:26523
K.FKAVDDEFEMIETLYGVGYR.F +242.5151
K.MGADDFIR.K +128.7161
K.MGADDFIRKPFSQR.L +347.1776
K.NEPVTLTVTEFLILQALATRPGVVK.S +258.7954
K.SDLPVIFLTSKDEEIDELFGLK.M +253.84460.273660.257763.9968
K.SDLPVIFLTSKDEEIDELFGLK.M +364.614869.643560.346367.59
R.IMTYTDGASALDGFR.T +268.130271.794460.740341.7569
R.TTPPDLAILDIK.M +130.946527.660227.617734.2486
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA036076.069.874.359.283.2pckA phosphoenolpyruvate carboxykinase 389802:391415 forward MW:58772
-.MQETGVHNGAYGTDK.F +130.7672
-.MQETGVHNGAYGTDKFGLK.N +260.585855.629860.050454.4573
-.MQETGVHNGAYGTDKFGLK.N +360.621660.874959.018255.7649
K.AAFDTTAR.K +126.6535
K.AAFDTTAR.K +230.9975
K.CIKLSSENEPEIYAASTR.F +235.9049
K.FEAQVDAEVR.A +232.3198
K.GVYWNFGAPQLYEHALK.N +127.6534
K.GVYWNFGAPQLYEHALK.N +239.31844.406136.613141.9661
K.GVYWNFGAPQLYEHALKNGEAVLSSDGALVADTGVFTGR.S +347.524
K.HAEGMTLFAQDLYGGADPTFR.I +270.251953.780144.794249.0552
K.HNVDCWLVNTGWTGGIYGTGHR.M +259.953869.468867.2163
K.HNVDCWLVNTGWTGGIYGTGHR.M +367.616475.258175.466670.7112
K.LSSENEPEIYAASTR.F +134.846638.714836.679335.8512
K.LSSENEPEIYAASTR.F +270.630958.881562.50465.9212
K.LTPAQAMYHFLSGYTAK.V +141.724150.106542.900533.3382
K.LTPAQAMYHFLSGYTAK.V +257.33264.010664.442661.9077
K.LTPAQAMYHFLSGYTAK.V +349.830351.477758.5661
K.LTPAQAMYHFLSGYTAKVAGTER.G +234.1798
K.NGEAVLSSDGALVADTGVFTGR.S +238.4792
K.NGEAVLSSDGALVADTGVFTGRSPK.D +230.9647
K.NLKGVYWNFGAPQLYEHALK.N +249.697847.401742.637948.0978
K.NLKGVYWNFGAPQLYEHALK.N +366.738659.861567.952468.8379
K.NLKGVYWNFGAPQLYEHALKNGEAVLSSDGALVADTGVFTGR.S +351.0811
K.NVVMLAADAFGVMPPIAK.L +155.423350.979255.111247.8744
K.NVVMLAADAFGVMPPIAK.L +264.785759.923156.821252.6935
K.NVVMLAADAFGVMPPIAK.L +395.759297.101197.246992.8124
K.SVFTTLNYYLPEK.G +239.107639.569
K.TTLSADPNRTLIGDDEHGWGK.D +348.3715
K.TTLSADPNRTLIGDDEHGWGKDGVFNFEGGCYAK.C +351.442649.542147.0314
K.TWADKAAFDTTAR.K +246.436236.2964
R.AAAPDVK.M +128.20928.1531
R.AAAPDVKMAVE.- +131.9779
R.AELENFVPELTLIDLPSFR.A +261.96757.22764.124759.3949
R.AELENFVPELTLIDLPSFR.A +360.689246.031
R.AGQPKNVVMLAADAFGVMPPIAK.L +255.016950.258143.9868
R.ALLTAALDGSLR.N +133.4957
R.ALLTAALDGSLR.N +273.761866.939656.352966.5314
R.DPSVYGNMLR.E +247.7778
R.ELIAK.H +130.736229.234
R.FGAVLENVVLGELDR.K +236.66
R.FGAVLENVVLGELDRKPDFDDGSK.T +236.604742.4509
R.FGAVLENVVLGELDRKPDFDDGSK.T +347.91455.1787
R.FGAVLENVVLGELDRKPDFDDGSKTENTR.S +239.880430.447731.333134.4887
R.FGAVLENVVLGELDRKPDFDDGSKTENTR.S +366.215658.062875.674276.567
R.GVTEPTPEFSTCFGSPFLPR.D +270.66468.095869.602966.3053
R.GVTEPTPEFSTCFGSPFLPRDPSVYGNMLR.E +345.545649.2515
R.KIVLIGGTQYAGEMKK.S +139.787454.224926.9007
R.KIVLIGGTQYAGEMKK.S +267.398559.7957
R.KIVLIGGTQYAGEMKK.S +366.961345.3792
R.KLVGMFQK.N +139.993236.691935.419933.598
R.KLVGMFQK.N +251.793151.130448.117145.5589
R.KLVGMFQKNFAK.F +140.4306
R.MPIKVTR.A +132.102227.982435.88629.2806
R.MPIKVTR.A +238.850932.33840.1077
R.SAYPLESIPNASLTGR.A +138.176233.0930.537132.84
R.SAYPLESIPNASLTGR.A +252.891453.148568.35356.0478
R.SENVVAIDFAR.K +136.34635.0756
R.SENVVAIDFAR.K +255.5412
R.TDPYFGFAVPTALPGVPSEILDPVK.T +258.145161.521460.151254.4942
R.TDPYFGFAVPTALPGVPSEILDPVK.T +360.029
R.TDPYFGFAVPTALPGVPSEILDPVKTWADK.A +238.69739.456342.79640.9701
R.TDPYFGFAVPTALPGVPSEILDPVKTWADK.A +354.636852.10653.955266.0962
R.TDPYFGFAVPTALPGVPSEILDPVKTWADKAAFDTTAR.K +348.975151.904452.0751.9555
R.TLIGDDEHGWGKDGVFNFEGGCYAK.C +236.556852.8159
R.VYTELAWHSLFIR.T +233.7964
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA040036.155.641.441.462.3RPA0400 possible alcohol dehydrogenases and quinone oxidoreductases. 439493:440467 forward MW:34165
-.MKAILCQQYCGPDDLVYADVPDPVAGPGEAVIAVK.A +231.7661
K.AAALNFFDILMIQGK.Y +126.9428
K.AAALNFFDILMIQGK.Y +240.9198
K.AILCQQYCGPDDLVYADVPDPVAGPGEAVIAVK.A +230.850951.855142.3559
K.IPDNLDFDR.A +134.0276
K.IPDNLDFDR.A +232.722430.8997
K.KLTGGKGVDIIFDPVGGTYAEAALR.S +233.875634.6891
K.LMGLK.V +128.2144
K.MPLNLALLK.G +231.788145.6166
K.YQIKPPFPFSPGAEVAGVIESVGEGVTDLK.V +243.4450.192453.128837.136
K.YQIKPPFPFSPGAEVAGVIESVGEGVTDLK.V +361.208678.259882.695574.7706
R.AAGIIIIYGTALHALEDR.A +238.041668.560957.6233
R.AAGIIIIYGTALHALEDR.A +355.240765.302972.5852
R.ASPKPGETLAVLGAAGGTGLAACELGK.L +247.78648.388467.376549.7437
R.ASPKPGETLAVLGAAGGTGLAACELGK.L +355.2158
R.EKIALPAQMIVK.I +133.8799
R.TFPLAQTADALK.V +125.3428
R.TFPLAQTADALK.V +231.6568
R.TFPLAQTADALKVLAGR.Q +252.142935.7924
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA041148.363.548.948.373.0ppa inorganic pyrophosphatase 454277:454813 forward MW:19751
-.MRIDAIPVGVNPPYDVNVIIEVPVGGEPIKYEMDK.A +347.6279
K.AAGTLVVDR.F +233.0464
K.IIAVPSSK.L +128.416429.482
R.FLYTAMHYPGNYGFIPHTLSDDGDPCDVLVANTR.G +369.039873.720888.403973.6182
R.GIVPGAVMSVRPVGVLYMSDEAGHDEK.I +234.753140.002838.878138.1214
R.GIVPGAVMSVRPVGVLYMSDEAGHDEK.I +351.234562.8674
R.WGGADEAHKLILEGLDR.A +264.463164.787260.870662.2973
R.WGGADEAHKLILEGLDR.A +354.53247.785456.8417
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA041331.531.534.625.440.7RPA0413 putative methylenetetrahydrofolate dehydrogenase 456520:457407 reverse MW:30536
K.EVAGAITPVPGGVGLMTVACLLVNTVR.A +238.1227
K.GLDSNAVIDAIDPAKDVDGLNPTNAGR.L +246.513857.983355.20951.876
K.GLDSNAVIDAIDPAKDVDGLNPTNAGR.L +360.645649.645474.1979
K.LNADPAVHGILVQLPLPK.G +254.54345.1849
K.LNADPAVHGILVQLPLPK.G +353.7182
R.LASGLFALTPCTPLGSIIMAK.T +246.304249.026957.426340.1792
R.LASGLFALTPCTPLGSIIMAK.T +353.2387
R.LKTDHGITPGLAVVLVGNDPASEVYVR.S +234.264440.188861.815554.9265
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA042242.054.156.848.069.1RPA0422 possible dehydrogenase 464180:465181 reverse MW:36575
K.KKPLVVVTR.K +128.4571
K.LIEAGDIAGAGLDVYEHEPAVNPK.L +239.864846.012961.6514
K.LIEAGDIAGAGLDVYEHEPAVNPK.L +355.037248.9727
K.VVLLPHMGSATIEGR.V +346.1872
R.GEVIDEETLTK.L +129.140635.740834.30537.7844
R.GEVIDEETLTKLIEAGDIAGAGLDVYEHEPAVNPK.L +364.9352
R.GITVTNTPK.V +125.508226.232727.2123
R.IADELGATYWDSLDQMLAR.M +264.290973.292682.399267.9344
R.KLPDSIETR.M +233.4752
R.LGIIGMGR.I +233.3938
R.LIAHFGNGIDNLDVAAAHAR.G +252.203855.376771.902266.0493
R.LIAHFGNGIDNLDVAAAHAR.G +350.229581.313356.3401
R.LNLDDVPMTAEQLAEAAR.T +128.598825.945533.4819
R.LNLDDVPMTAEQLAEAAR.T +250.152464.896176.987970.3428
R.LNLDDVPMTAEQLAEAAR.T +347.832352.8046
R.MDIISVNCPHTPATFHLLSAR.R +237.738142.3941
R.MIEGAALLTDGGEWPGWSPTWMLGR.R +230.151333.8279
R.RMIEGAALLTDGGEWPGWSPTWMLGR.R +230.284535.601936.0072
R.TADVLVPTVTDEITAAMVNQPDCK.L +260.323370.315362.236473.7444
R.TADVLVPTVTDEITAAMVNQPDCK.L +353.660350.5975
R.TFLDNHKPPDRVLPGML.- +230.4808
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA042626.029.922.329.435.5fabB beta-ketoacyl-ACP synthase I 467387:468613 forward MW:42904
K.IDYINPHATSTPAGDPPEMNAIR.A +247.764544.323934.1707
K.IDYINPHATSTPAGDPPEMNAIR.A +347.7741
R.AVFGIGDKCPPISATK.A +234.0898
R.FLGEGAAWNHVAMEQAIADSGLEESEISNIR.T +246.878236.13369.135262.5738
R.FLGEGAAWNHVAMEQAIADSGLEESEISNIR.T +356.793483.844978.947372.4317
R.KRVDNAK.L +231.6254
R.SQVQGAPTLNPADVVDRR.A +232.048633.7108
R.TGIVMGSGGPSAR.T +254.047852.296341.5336
R.TIVEAADITR.T +125.794132.616333.3207
R.TIVEAADITR.T +248.992936.97241.09
R.VVVTGMGIVSSIGNNTQEVLASLHDAK.S +247.31545.064.568762.8567
R.VVVTGMGIVSSIGNNTQEVLASLHDAK.S +368.637783.476173.36273.7592
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA042959.264.768.972.475.4katG catalase/peroxidase 470517:472727 reverse MW:80870
K.AAKDAGTAVKVPFTPGR.M +128.256328.2002
K.AAKDAGTAVKVPFTPGR.M +249.741930.424253.449361.6789
K.AAKDAGTAVKVPFTPGR.M +345.1903
K.AKGAEATVPDPFDPAK.K +238.455733.960934.509750.6808
K.AKGAEATVPDPFDPAKK.R +234.0732
K.ANGEVEIYEGR.D +236.7658
K.AQLLTLTGPELTVLVGGLR.V +127.379
K.AQLLTLTGPELTVLVGGLR.V +254.092751.232954.719165.5672
K.DAGTAVKVPFTPGR.M +141.014834.013130.829633.3702
K.DAGTAVKVPFTPGR.M +243.225142.390645.760552.1551
K.DAGTAVKVPFTPGR.M +352.603868.307163.018560.1145
K.DLHALMTDSQEWWPADFGHYGGLFVR.M +252.72451.242270.782966.6787
K.DLHALMTDSQEWWPADFGHYGGLFVR.M +375.546485.341899.59683.4267
K.FVSDFVAAWSK.V +139.186342.115140.825141.9095
K.FVSDFVAAWSK.V +265.34858.471370.550272.7727
K.GAEATVPDPFDPAK.K +129.898227.995432.871926.8137
K.GAEATVPDPFDPAKK.R +127.990827.4792
K.GAEATVPDPFDPAKK.R +234.6161
K.GAEATVPDPFDPAKKRVPTMLTTDLSLR.F +350.0897
K.ILASGLSVAQLVSTAWASASTFR.G +274.876974.572780.20181.9383
K.ILASGLSVAQLVSTAWASASTFR.G +373.795475.065581.559178.4404
K.ILASGLSVAQLVSTAWASASTFRGSDK.R +235.837730.8711
K.ILASGLSVAQLVSTAWASASTFRGSDK.R +357.224949.941252.958462.4955
K.ISWADLMVLTGNVALESMGFK.T +275.018165.947386.222976.5195
K.ISWADLMVLTGNVALESMGFK.T +388.829964.247395.604179.6531
K.KDLHALMTDSQEWWPADFGHYGGLFVR.M +242.4646
K.KDLHALMTDSQEWWPADFGHYGGLFVR.M +351.951848.472891.286172.8809
K.KLDLEAVKK.D +135.497739.822927.7967
K.KLDLEAVKK.D +242.7822
K.KLDLEAVKKDLHALMTDSQEWWPADFGHYGGLFVR.M +347.0631
K.KRVPTMLTTDLSLR.F +246.390847.6826
K.KRVPTMLTTDLSLR.F +348.931350.785146.6452
K.KSDPMGAAFNYAEEFK.K +240.0037
K.KSDPMGAAFNYAEEFKK.L +355.487872.4014
K.KVSLADLIVLGGAAAIEK.A +126.864551.129157.6575
K.KVSLADLIVLGGAAAIEK.A +260.150933.81375.645683.7859
K.KVSLADLIVLGGAAAIEK.A +350.849455.5895
K.LDLEAVKK.D +231.1379
K.LEAIQGEFNGAQK.D +127.114740.697534.5806
K.LEAIQGEFNGAQKDGK.K +125.945928.6737
K.LEAIQGEFNGAQKDGK.K +236.969840.918245.5885
K.LEAIQGEFNGAQKDGKK.V +125.120825.1657
K.LEAIQGEFNGAQKDGKK.V +231.432638.957836.4817
K.LTNDFFVNLLDMGTK.W +133.102537.152445.807740.2043
K.LTNDFFVNLLDMGTK.W +265.064162.797667.430778.0495
K.LTNDFFVNLLDMGTKWTK.A +235.466136.429938.0579
K.LTNDFFVNLLDMGTKWTK.A +352.741550.6574
K.RHQFMHPEEALVDK.A +241.9196
K.RHQFMHPEEALVDKAQLLTLTGPELTVLVGGLR.V +352.828669.321264.272
K.RVPTMLTTDLSLR.F +236.068641.70746.183448.3468
K.RVPTMLTTDLSLR.F +350.191161.4601
K.RVPTMLTTDLSLRFDPIYEK.I +345.6617
K.SDPMGAAFNYAEEFK.K +127.5044
K.SDPMGAAFNYAEEFK.K +234.2068
K.SDPMGAAFNYAEEFKK.L +230.049630.9127
K.TDDKGAGKCPFSGGSHGHR.N +126.6124
K.TDDKGAGKCPFSGGSHGHR.N +240.3964
K.TFGFAGGR.A +125.2167
K.TFGFAGGR.A +230.988
K.THGAGDPSLIGPAPEGGLLEEQGLGWTSK.Y +258.559268.15979.158467.6661
K.THGAGDPSLIGPAPEGGLLEEQGLGWTSK.Y +376.543793.093695.838894.3736
K.VMNADRFDIVAK.K +125.405426.544
K.VMNADRFDIVAK.K +239.70938.88150.229847.1561
K.VMNADRFDIVAKK.Q +236.7854
K.VMNADRFDIVAKKQAA.- +232.132933.7419
K.VSLADLIVLGGAAAIEK.A +143.013946.6255
K.VSLADLIVLGGAAAIEK.A +251.116449.71963.110643.6316
R.ADGFRNYINTK.R +236.8285
R.ADVWEPEELYWGPEGTWLGDER.Y +257.157863.258965.286764.2348
R.ADVWEPEELYWGPEGTWLGDER.Y +360.7558
R.DWWPDQLDISVLHNNSK.K +239.726837.6348.4089
R.FAPLNSWPDNANLDK.A +126.086327.668631.289132.9637
R.FAPLNSWPDNANLDK.A +242.932235.128843.191162.085
R.FAPLNSWPDNANLDKAR.R +240.727649.947144.8386
R.FDPIYEK.I +130.344429.303633.744232.9652
R.FDPIYEK.I +234.3574
R.FLENPDQFADAFAR.A +132.874832.570931.6414
R.FLENPDQFADAFAR.A +283.117579.840281.780587.7068
R.HQFMHPEEALVDK.A +145.695941.709444.8866
R.HQFMHPEEALVDK.A +253.95758.921861.151968.5297
R.HQFMHPEEALVDK.A +359.022867.665459.9751
R.HQFMHPEEALVDKAQLLTLTGPELTVLVGGLR.V +257.248451.139
R.HQFMHPEEALVDKAQLLTLTGPELTVLVGGLR.V +360.533775.993375.025955.6878
R.IRLAPQKDWEVNQPAELAQVLGK.L +240.478847.192565.021159.0039
R.IRLAPQKDWEVNQPAELAQVLGK.L +358.93266.080184.79973.826
R.IRLAPQKDWEVNQPAELAQVLGKLEAIQGEFNGAQK.D +351.6879
R.LAPQKDWEVNQPAELAQVLGK.L +246.289362.499655.752168.7383
R.LAPQKDWEVNQPAELAQVLGK.L +354.267567.4267.447965.1153
R.LAPQKDWEVNQPAELAQVLGKLEAIQGEFNGAQK.D +346.7075
R.LAPQKDWEVNQPAELAQVLGKLEAIQGEFNGAQKDGK.K +351.6142
R.LLWPIKQK.Y +126.9445
R.MAMDDEETVALIAGGHTFGK.T +236.3483
R.MDASAEQTDVESFK.V +131.930444.204944.4139
R.MDASAEQTDVESFK.V +268.964443.892871.090273.9253
R.MDASAEQTDVESFKVLEPR.A +262.623748.9741
R.MDASAEQTDVESFKVLEPR.A +347.3233
R.NRDWWPDQLDISVLHNNSK.K +251.096971.673656.1613
R.NRDWWPDQLDISVLHNNSK.K +346.467173.756458.5692
R.NRDWWPDQLDISVLHNNSKK.S +350.8681
R.NYINTK.R +128.7283
R.NYINTKR.H +136.7548
R.RFLENPDQFADAFAR.A +239.569456.325460.504664.1902
R.RFLENPDQFADAFAR.A +367.808570.5547
R.RLLWPIKQK.Y +231.39
R.RLLWPIKQK.Y +352.2363
R.VDLVFGSHSQLR.A +247.538139.6772
R.VLGANYAHSTHGVLTERPEK.L +253.942254.659661.90159.4809
R.VLGANYAHSTHGVLTERPEK.L +373.188466.822379.033954.1823
R.VLGANYAHSTHGVLTERPEKLTNDFFVNLLDMGTK.W +370.078676.1776
R.VPTMLTTDLSLR.F +127.994126.2325
R.VPTMLTTDLSLR.F +247.372242.89531.312445.2832
R.YLGPEVPKEELIWQDPIPAVNHELVGEADIEALK.A +353.272372.298364.508272.7718
R.YLGPEVPKEELIWQDPIPAVNHELVGEADIEALKAK.I +348.542450.676567.533466.8004
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA043262.969.049.744.674.5pnp polyribonucleotide nucleotidyltransferase 475919:478087 reverse MW:78285
-.MFNIHSVEIDWGGRPLK.L +255.954446.5708
-.MFNIHSVEIDWGGRPLK.L +346.4664
-.MFNIHSVEIDWGGRPLKLETGK.V +252.423260.448564.371946.3906
-.MFNIHSVEIDWGGRPLKLETGK.V +358.540457.101556.194946.8761
-.MFNIHSVEIDWGGRPLKLETGKVAR.Q +234.778835.6029
-.MFNIHSVEIDWGGRPLKLETGKVAR.Q +348.090256.4875
K.AEGEAPAQAAGE.- +125.533437.4103
K.AIAHFFPEGQEPK.Y +150.370950.522650.072937.53
K.AIAHFFPEGQEPK.Y +249.396748.674336.025636.6647
K.AIAHFFPEGQEPK.Y +353.519957.7514
K.AIAHFFPEGQEPKYDKLR.I +232.8347
K.AIAHFFPEGQEPKYDKLR.I +346.0836
K.DGLVHISQLAAGR.V +152.736644.495348.399243.7074
K.DGLVHISQLAAGR.V +258.415363.58646.540341.3247
K.DGLVHISQLAAGR.V +374.16560.983745.9282
K.EMLGLVEQELR.A +236.165634.6333
K.IAGITEEIMK.V +133.726333.272131.853732.4158
K.IAGITEEIMK.V +260.32359.375152.5282
K.LLGFDDR.G +240.973443.7796
K.SIASDPEVGEIYEGTVVK.V +138.51537.987836.986938.3125
K.SIASDPEVGEIYEGTVVK.V +278.835978.305981.7678.0663
K.SIASDPEVGEIYEGTVVK.V +364.4587
K.TGAKVNIEDDGTVK.V +240.8569
K.TSDVVKEGDKVK.V +138.331237.239137.454
K.TSDVVKEGDKVKVK.L +142.207825.534134.9216
K.TSDVVKEGDKVKVK.L +243.8073
K.VAGTEAGITSLQMDIK.I +129.353137.733
K.VAGTEAGITSLQMDIK.I +238.995935.1958
K.VALGQAK.D +127.674430.4106
K.VASSDGESIKAAIK.W +134.938630.9887
K.VASSDGESIKAAIK.W +244.681146.4688
K.VMEFGAFVNFFGAK.D +134.8078
K.VMEFGAFVNFFGAK.D +250.798462.108445.1329
K.VNIEDDGTVK.V +132.141828.231428.1467
K.VNIEDDGTVK.V +232.187534.0066
K.VVDQTTGEDLEAK.Q +139.104746.393936.395737.7997
K.VVDQTTGEDLEAK.Q +262.998555.925249.413152.1232
K.VVDQTTGEDLEAKQK.A +135.8844
K.VVDQTTGEDLEAKQKAEAK.A +241.2037
R.AAYAIPVKQDR.Y +134.102327.507526.6755
R.AAYAIPVKQDR.Y +244.004944.236937.5362
R.AELGEHAPR.I +127.944631.595128.7429
R.AIHPVLPPHHEFPYTIR.V +250.224854.5836.02940.5325
R.AIHPVLPPHHEFPYTIR.V +357.441257.14358.699750.3014
R.EGRPTEKETLVSR.L +126.301829.1071
R.EGRPTEKETLVSR.L +247.75642.69743.4233
R.EGRPTEKETLVSR.L +354.7947
R.EGVDFLPLTVDYQEK.A +149.199946.814841.129240.2541
R.EGVDFLPLTVDYQEK.A +258.838258.644948.52744.7148
R.ELTVVDDSEIEK.E +138.97
R.ELTVVDDSEIEKEMLGLVEQELR.A +270.173366.476972.759963.6449
R.ELTVVDDSEIEKEMLGLVEQELR.A +373.125884.974783.014175.6699
R.EVIGTGGK.V +132.1661
R.FAVLSDILGDEDHLGDMDFK.V +283.601973.228288.027177.9241
R.FAVLSDILGDEDHLGDMDFK.V +363.786567.784662.935458.5629
R.HFQPVIDAIIDLAEK.A +144.413437.062
R.HFQPVIDAIIDLAEK.A +269.331175.993281.005847.7236
R.HFQPVIDAIIDLAEK.A +388.265885.475254.3233
R.IAGVFK.E +128.4531
R.IAGVFKELEAK.I +139.195439.119136.1504
R.IAGVFKELEAK.I +260.52153.508447.55934.5714
R.IAGVFKELEAK.I +347.006147.8881
R.IETFKIPTDK.I +130.411832.1498
R.IETFKIPTDK.I +239.700340.541834.5181
R.IETFKIPTDKIR.E +130.049437.098527.5524
R.IETFKIPTDKIR.E +239.088233.745838.1671
R.IETFKIPTDKIR.E +352.1616
R.IETFKIPTDKIREVIGTGGK.V +245.423949.3032
R.IETFKIPTDKIREVIGTGGK.V +363.386845.4136
R.IHILGEMSK.A +146.187349.482943.080446.2834
R.IHILGEMSK.A +242.601245.381844.2018
R.IPGGYFK.R +128.0811
R.IPGGYFKR.E +233.2436
R.LIDRPIRPLFADGWR.N +346.9259
R.LSMKVVDQTTGEDLEAK.Q +233.237355.5255
R.NETQVIVTVLSHDMENDPDVLAMVAASAALTLSGVPFKGPIGAAR.V +349.614956.034473.18163.7004
R.NILAQVGVLPR.T +137.83843.8342.591233.2765
R.NILAQVGVLPR.T +271.547471.285859.902469.4495
R.QADGAVVATYGETVVLATVVAAK.A +232.5966
R.QADGAVVATYGETVVLATVVAAKAPR.E +230.0454
R.THGSALFTR.G +125.865426.5571
R.THGSALFTR.G +232.189637.7071
R.VGFINDEYVLNPVLDEMAETQLELVVAGTADAVLMVESEAK.E +365.1564
R.WNILDTGKR.I +131.075528.749
R.WNILDTGKR.I +238.025339.9502
R.YAAVGK.V +133.591632.0568
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA043349.456.249.457.364.0rpsO ribosomal protein S15 478426:478695 reverse MW:10142
K.AGDTGSPEVQVAILSER.I +129.548529.051326.7202
K.AGDTGSPEVQVAILSER.I +257.203965.344549.241442.2179
R.ITNLTAHFK.T +134.851432.020330.719628.5273
R.ITNLTAHFK.T +242.594842.463148.8214
R.KAEVIKTSATK.A +146.704340.121425.210128.1725
R.SLLDYIK.K +128.4305
R.SLLDYIK.K +235.473433.955631.8009
R.SLLDYIKKKDEAR.Y +242.3798
R.YKALLEK.H +130.64628.8575
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA043626.429.437.335.247.2infB putative translation initiation factor if-2 480385:483036 reverse MW:95506
K.AAGVPIIVAINK.I +128.5324
K.ADVQGSLEAILGSLEK.L +137.261950.9172
K.ADVQGSLEAILGSLEK.L +250.724133.236177.796860.4991
K.ADVQGSLEAILGSLEKLGTDEVAAR.I +243.961643.414755.4385
K.ADVQGSLEAILGSLEKLGTDEVAAR.I +349.574249.4323
K.ITDVIDADTAQLIAEELGHTVK.R +240.321145.161678.095856.7418
K.ITDVIDADTAQLIAEELGHTVK.R +345.557458.952750.0317
K.ITDVIDADTAQLIAEELGHTVKR.V +235.295734.1353.056449.5426
K.ITDVIDADTAQLIAEELGHTVKR.V +349.5816
K.ITFIDTPGHAAFTAMR.A +250.439348.433946.0011
K.ITFIDTPGHAAFTAMR.A +348.5067
K.NKINLDKLLEMIALQAEILELK.T +248.669146.127944.00339.1608
K.NKINLDKLLEMIALQAEILELK.T +346.21747.7652
K.RVAASDVEEGLFDVVDDSTDTEPR.S +244.9438
K.TNTQRPAEGTVIEAK.L +137.2709
K.TNTQRPAEGTVIEAK.L +242.1414
K.TSLLDALR.H +234.98531.2679
K.VTDIVVLVVAADDGVMPQTIEAINHAK.A +233.0287
R.ALISDQGETVQEAGPSVPVEVLGFNGPPEAGDR.L +238.540352.151550.873944.0469
R.EVVIPEVIAIQELANR.M +128.023330.246536.446431.7224
R.EVVIPEVIAIQELANR.M +277.703773.735167.493961.8632
R.EVVIPEVIAIQELANR.M +350.1212
R.FGDAEPAKKPAETSTTTTTAAPARPATTTTR.T +348.5575
R.FKDEVKEVVAGQECGMAFENYTDMR.A +232.3951
R.GRGPVATVLVQR.G +240.992138.7849
R.GSLEQMMTQLK.T +134.782937.118130.154730.3202
R.GSLEQMMTQLK.T +259.4913
R.HANVVSGEAGGITQHIGAYQVTSPESGKK.I +234.577344.125845.8365
R.HANVVSGEAGGITQHIGAYQVTSPESGKK.I +377.435391.379580.4734
R.LAVVENEAR.A +126.129
R.LAVVENEAR.A +245.285634.3218
R.LIRDNVVVHEGK.L +232.274230.5445
R.LIRDNVVVHEGK.L +347.4631
R.RLGGDEPAAPAAPEVAK.K +230.0594
R.SPVVTVMGHVDHGKTSLLDALR.H +360.4732
R.TPTPAGRPPAVAAEAGDDDEAPR.M +230.300240.108948.329151.4345
R.TPTPAGRPPAVAAEAGDDDEAPR.M +363.430162.899474.9997
R.VAASDVEEGLFDVVDDSTDTEPR.S +272.902967.398683.357879.5628
R.VAASDVEEGLFDVVDDSTDTEPR.S +354.5559
R.YYNIIYDLVDDIKK.A +133.2874
R.YYNIIYDLVDDIKK.A +269.428954.8665
R.YYNIIYDLVDDIKK.A +348.36557.4502
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA043843.255.353.449.266.5nusA putative NusA protein, transcriptional termination factor 483870:485483 reverse MW:59394
K.FGENDVKTVEDLAGCATDDLVGWTER.K +236.363137.2514
K.IDIIPWSPDIATFVVNALAPAEVSK.V +263.994868.497567.609571.3768
K.IDIIPWSPDIATFVVNALAPAEVSK.V +353.687153.562855.443
K.LFAQEVPEIYDGIVEIK.A +135.24439.884737.7804
K.LFAQEVPEIYDGIVEIK.A +264.906761.613173.894767.2
K.LFAQEVPEIYDGIVEIK.A +368.560366.1385
K.RVEYGSVIVDLGR.G +230.6627
K.RVEYGSVIVDLGRGEAIIR.R +349.6516
K.TVEDLAGCATDDLVGWTER.K +252.76863.916678.065169.6732
K.TVEDLAGCATDDLVGWTERK.D +236.882
M.AVSANRLELLQIADAVAR.E +245.938357.633361.766155.4529
M.AVSANRLELLQIADAVAR.E +391.568987.040179.909471.9492
R.ANPGAQIGDTIADTLPPLEYGR.I +252.628763.199667.748667.3905
R.ASEYLDRIESELEAR.R +239.494339.305341.454938.5762
R.ASEYLDRIESELEAR.R +349.898367.6825
R.DSSVDPVGACVGMR.G +231.527443.517847.55635.4163
R.EDAEHLIMQAR.V +137.1906
R.EDAEHLIMQAR.V +230.2098
R.ELASIEGFDEETAAELQTR.A +248.477845.4835
R.GPQIFLSR.T +127.0078
R.GPQIFLSR.T +233.999647.2885
R.HMLVVEQVENPANQISLK.D +260.316185.212875.47780.287
R.HMLVVEQVENPANQISLK.D +363.9298
R.HMLVVEQVENPANQISLKDAQR.A +278.611976.503385.43192.9693
R.HMLVVEQVENPANQISLKDAQR.A +373.003470.533696.533259.5615
R.IEVVVPDTNNQLSLAIGR.R +242.086150.017144.5089
R.IGDIVNGVVK.R +127.093125.4053
R.IGDIVNGVVK.R +245.012451.5568
R.KDGAEPVKYPGILDGMEMSR.E +236.9854
R.LASQLTGWDIDILTESEESERR.Q +231.4036
R.LELLQIADAVAR.E +261.950957.860636.263544.8391
R.RLELGVEDALKDVPGVTSK.M +244.719852.371942.884946.4091
R.RLELGVEDALKDVPGVTSK.M +356.322160.471863.08279.7193
R.SIVIAAMEDAIAK.A +253.794753.535239.4669.4749
R.VKAGWIDESELASEEDPADEASDESAD.- +236.158141.823460.777
R.VQAVVNELQGEK.I +128.60840.435638.131333.8539
R.VQAVVNELQGEK.I +259.88857.297
R.VQAVVNELQGEKIDIIPWSPDIATFVVNALAPAEVSK.V +346.962755.216459.820447.4966
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA044335.336.036.036.036.7RPA0443 possible transcriptional regulator, XRE family 489541:489960 reverse MW:15094
K.LGEALGLTFQQVQK.Y +139.394644.040940.106843.7214
K.LGEALGLTFQQVQK.Y +266.491266.355973.5102
K.LGEALGLTFQQVQKYEK.G +230.842831.157561.17347.8875
K.LGEALGLTFQQVQKYEK.G +346.8334
M.STKAPNPVDKYVGSR.V +131.759228.398932.550731.1177
M.STKAPNPVDKYVGSR.V +248.367143.379750.222444.8297
M.STKAPNPVDKYVGSR.V +351.124256.774662.4602
R.IMLGMSQEK.L +133.792233.829535.861937.7121
R.IMLGMSQEK.L +244.510538.533742.8833
R.RIMLGMSQEK.L +244.1623
R.RSIVDLVER.I +230.825733.6865
R.SIVDLVER.I +131.677726.785130.0944
R.SIVDLVER.I +245.501646.3424
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA045037.162.958.753.867.8RPA0450 transcriptional regulator, FUR family; probable FUR protein 496807:497238 reverse MW:16719
K.ATEIEAR.C +125.6577
K.ISISTVYR.T +230.185837.7843
K.LFEDAGIIER.H +130.693432.778833.063436.0048
K.LFEDAGIIER.H +263.471366.996164.037763.6506
K.LQAEIAR.R +128.6303
K.LVDHRLELYCVPLEDDKS.- +252.423754.056348.208148.8696
K.LVDHRLELYCVPLEDDKS.- +361.795162.909752.3649
R.DGTVIEFTNEEIEK.L +143.308244.6467
R.DGTVIEFTNEEIEK.L +269.214149.9474
R.DGTVIEFTNEEIEKLQAEIAR.R +230.955256.167446.139
R.DSHHDHLINLR.D +132.11332.774932.6558
R.DSHHDHLINLR.D +232.7147
R.LELYCVPLEDDKS.- +140.079435.696239.134740.6674
R.LELYCVPLEDDKS.- +259.923367.975163.714359.5959
R.VLAESEDHPDVEELYTR.C +268.370870.732968.581377.7012
R.VLAESEDHPDVEELYTR.C +362.70652.664358.897155.9554
R.YEQMRDSHHDHLINLR.D +230.8376
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA045336.244.140.424.560.1RPA0453 possible NifU-like domain (residues 119-187) 498641:499207 reverse MW:20292
-.MFIQTEPTPNPATLK.F +126.410628.1422
-.MFIQTEPTPNPATLK.F +245.156741.227544.594645.5598
K.HFVPEVVEVRPVT.- +126.968431.644136.8285
K.HFVPEVVEVRPVT.- +251.705556.051.236
K.HFVPEVVEVRPVT.- +348.818653.7872
K.SDGEDGDDDEFYADADAETVEIIKDLIETR.V +349.2892
R.GACAGCPSSTATLQHGIQNLLK.H +241.756939.5514
R.SVLDSGTLEFTDASQAAR.S +126.052726.5627
R.SVLDSGTLEFTDASQAAR.S +258.335964.788656.8901
R.VRPAVANDGGDITFR.G +230.8269
R.VRPAVANDGGDITFR.G +351.0445
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA045528.025.725.722.933.7trpS trytophanyl-tRNA synthetase 500093:501145 reverse MW:38240
K.GLETRPEADNLVGIYAALSGKPK.T +234.79644.4753
K.GLETRPEADNLVGIYAALSGKPK.T +372.339376.712751.9127
K.LSPIADEMKR.L +127.5661
K.LSPIADEMKR.L +232.557736.3719
K.SSLVDLAVAK.L +129.790727.487629.6177
K.SSLVDLAVAK.L +250.2018
K.TGVLTEFGGAQFSAFK.S +133.812728.131249.103534.6971
K.TGVLTEFGGAQFSAFK.S +240.268343.054451.9773
R.ATHVPVGEDQKQHVELTR.D +231.2703
R.AVKDIMGMVR.K +231.2598
R.INLTDDADAIAQK.I +137.831439.424737.888938.4509
R.INLTDDADAIAQK.I +262.708165.639534.671350.4205
R.LSADHAYVDSVLADGSDR.A +129.811842.598528.1406
R.LSADHAYVDSVLADGSDR.A +274.070371.845175.486174.9581
R.LSADHAYVDSVLADGSDR.A +346.116846.6802
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA046039.539.717.78.944.8RPA0460 putative esterase 506145:507332 reverse MW:42722
-.MQSSNQIDQSLR.Q +240.601939.3077
K.AVEAASGMK.L +127.209
K.FTQMILNK.G +129.100431.3317
K.FTQMILNK.G +233.6665
K.FTQMILNKGR.G +231.2203
K.LNSAIAFATNDVDLYPGMTKK.W +242.2277
K.LSLDEPIGK.V +125.6254
K.VLPDLAEPLVLDGFDADGTPK.T +269.213171.205766.710944.4388
K.VLPDLAEPLVLDGFDADGTPK.T +369.626
R.DLSKPEQMTTDSVFWIASMTK.A +247.745141.9543
R.GDIPGVVAIAGNSK.E +146.172335.828628.030529.7697
R.GEDGSLSPIPFEVAQEPEFHMGGGGLYGTAADYLK.F +345.779155.647350.3273
R.HGIPGIIGCQEAALKTPLASDPGTR.W +233.3278
R.HGIPGIIGCQEAALKTPLASDPGTR.W +346.831750.9417
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA04618.022.19.712.331.0gabD1 succinate-semialdehyde dehydrogenase 508060:509553 forward MW:52773
K.LANNSPFGLASYFYAR.D +230.6308
K.RVFNVLTGDAPAIGK.V +243.1371
K.VGDGTEQGVTQGPLINEAAVEK.T +238.11236.331353.8751
K.VGDGTEQGVTQGPLINEAAVEKTER.H +240.6129
K.VPHLGAAEATQAVEAAAQAFPAWAK.L +239.530934.4804
R.HALGGTFFEPTVLADVRPDALVAHEETFGPLAPVFR.F +346.69251.9188
R.HIADALSNGAK.I +137.9354
R.LIAIKQPIGVCGAITPWNFPSSMITR.K +239.0592
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA046522.419.940.036.548.2RPA0465 possible transmembrane protein 513127:514560 reverse MW:52128
K.ALDAAPAEALK.L +131.45132.56732.6765
K.ALDAAPAEALK.L +230.0515
K.FLVTAPGWSGAVPTGMQR.V +127.2815
K.FLVTAPGWSGAVPTGMQR.V +252.336740.507153.387841.864
K.GATPPVDAFWSLTLYDSEGFPVPNALQR.Q +235.349435.7246
K.GPFTLTMR.M +242.360437.140139.702146.391
K.QNPPHITDQPMIAR.L +236.7284
K.TPPKQQVDSMPAGQFFAYAAELLK.Q +253.302750.7951.213959.5576
K.TPPKQQVDSMPAGQFFAYAAELLK.Q +355.796265.074878.136466.1005
R.AIVAQFGLGANVPEDAIYPVNVADETGKPLDGTSNYVLHFQK.G +346.0363
R.IQAGYTATPLSQWGKPPVTPPAFVPDPAIDMK.T +232.243935.1099
R.IQAGYTATPLSQWGKPPVTPPAFVPDPAIDMK.T +350.010877.304184.524277.0596
R.KALDAAPAEALK.L +136.787531.3808
R.KALDAAPAEALK.L +248.995232.53239.1007
R.QALSSWMPLKPNADGSLDLLIQNASPGTEHESNWLPAPK.G +347.4917
R.VESPTPIIWIIGR.T +131.982629.5416
R.VESPTPIIWIIGR.T +253.032456.771441.536263.0728
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA047950.057.337.740.857.3fabG1 possible 3-oxoacyl-acyl carrier protein reductase 529346:530128 reverse MW:26995
K.GALNTMTLSLSR.A +232.2563
K.HVAHHLLDQLSADDFQR.I +247.976571.941344.029171.6487
K.HVAHHLLDQLSADDFQR.I +350.452
K.IASTAEDIAELVCFLATPK.S +129.713726.758
K.IASTAEDIAELVCFLATPK.S +263.871566.774754.272373.062
K.IASTAEDIAELVCFLATPK.S +357.324562.3055
K.LDALVNNAGTTK.H +127.6118
K.LDALVNNAGTTK.H +251.340655.7796
K.SSSMTGELVR.M +242.113144.4612
R.ALAPNIRVNAICPGYIDTPWFTK.G +351.2047
R.DMVVSRVPLKIASTAEDIAELVCFLATPK.S +349.594859.338455.012468.6758
R.ELLVAGAK.A +130.826833.259138.8574
R.IVEAAAPWGK.L +233.8419
R.IVEAAAPWGKLDALVNNAGTTK.H +234.125354.294847.5277
R.IVEAAAPWGKLDALVNNAGTTK.H +364.152157.4261
R.IYAINTVGPYQMVR.A +126.4612
R.IYAINTVGPYQMVR.A +242.029933.250244.456133.3491
R.LVINYASSKDDAEK.T +234.211336.6594
R.VNAICPGYIDTPWFTK.G +132.93240.363230.9241
R.VNAICPGYIDTPWFTK.G +246.467150.747756.1938
R.VPLKIASTAEDIAELVCFLATPK.S +239.848133.739265.214958.8497
R.VPLKIASTAEDIAELVCFLATPK.S +352.7374
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA048521.932.425.931.946.1RPA0485 possible urea/short-chain amide ABC transporter 535357:536562 reverse MW:43026
K.AAGTTDAAAVTK.K +127.9122
K.IIMFSGPGSIR.L +239.31935.2228
K.LGAILDMSGLYADITGTGSETAAK.M +247.2111
K.LLATVPGDQAFQSLADSR.C +252.849833.6842
K.MAVEDFGGTVLGR.K +244.564655.433432.1183
K.RMPTSAQAGLYSETMHYLQAVK.A +376.086252.7105
K.VIGLANAGGDTINAIK.Q +244.05
K.VIGLANAGGDTINAIKQGAEFGITK.G +244.641634.4788
K.VIGLANAGGDTINAIKQGAEFGITK.G +349.332445.5584
R.DMLDNQGVEAIIDVAASATALAAAEIAK.S +259.09453.537667.521149.0224
R.DMLDNQGVEAIIDVAASATALAAAEIAK.S +362.765767.378852.7152
R.KVEIIAADHLNKADLSANIAR.D +238.5102
R.MPTSAQAGLYSETMHYLQAVK.A +233.059639.3693
R.MPTSAQAGLYSETMHYLQAVK.A +357.3434
R.MVHDMYLFEVK.K +138.606235.222337.928939.0686
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA048822.334.534.529.134.5RPA0488 possible CarD-like transcriptional regulator 539338:540000 reverse MW:24183
K.ANEFVVYPAHGVGQILAIEEQEIAGAK.L +245.760632.29338.5025
K.ANEFVVYPAHGVGQILAIEEQEIAGAK.L +359.0012
K.INSGDIVAIAEVVR.D +125.519627.1025
K.INSGDIVAIAEVVR.D +262.221159.784662.889536.0531
K.LELFVINFIKDK.M +231.518135.3373
K.LELFVINFIKDK.M +345.9146
R.EIAVVQHITETEAVKEVESQLAK.S +260.395965.046174.105771.6613
R.EIAVVQHITETEAVKEVESQLAK.S +363.207671.075781.924576.8837
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA048950.943.850.950.952.7RPA0489 ferredoxin II 540697:541035 reverse MW:12513
K.DAPADAKEFDGQAGKFEK.Y +138.966936.965330.8228
K.DAPADAKEFDGQAGKFEK.Y +236.443658.428440.8671
K.DAPADAKEFDGQAGKFEK.Y +355.17755.6393
K.EFDGQAGKFEK.Y +133.434226.4679
K.KDAPADAKEFDGQAGKFEK.Y +239.057144.263660.558930.3167
K.KDAPADAKEFDGQAGKFEK.Y +348.0862
K.TWPNLTQK.K +126.888926.233826.0602
K.TWPNLTQKK.D +129.4581
K.TWPNLTQKKDAPADAKEFDGQAGKFEK.Y +231.368734.182150.4596
K.TWPNLTQKKDAPADAKEFDGQAGKFEK.Y +351.7312
K.WLELNSEYAK.T +137.900438.214239.045134.6001
K.WLELNSEYAK.T +250.230642.202451.94545.6203
K.YFSSEPGSGD.- +125.141534.109833.1503
M.TYVVTENCIK.C +132.98133.35539.701336.4948
M.TYVVTENCIK.C +233.62537.588349.7988
M.TYVVTENCIKCK.Y +127.1365
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA049116.112.09.38.918.2RPA0491 possible MgpS, ATP-dependent helicase 541410:544691 reverse MW:118664
K.ALAGEIDAR.A +239.0509
K.ALQATAQK.A +126.4874
K.IATEMKDLDQPSR.A +233.0261
K.ILGPLFELGK.A +130.316730.3342
K.ILGPLFELGK.A +234.918734.9568
K.ILGPLFELGKAEDVSGIAR.G +241.978833.7439
K.ILGPLFELGKAEDVSGIAR.G +354.8081
K.QDNVDLAALSSAQHLAGSGR.T +245.551155.806935.5939
K.QDNVDLAALSSAQHLAGSGR.T +346.206547.8569
R.ALASLLWAQK.Q +243.8797
R.ALASLLWAQKQDNVDLAALSSAQHLAGSGR.T +345.47754.162484.5511
R.FGAYHIYFPSLLKPAAR.A +240.396638.87338.8139
R.FGAYHIYFPSLLKPAAR.A +346.52954.366561.1377
R.GIAFQLIESLGVLER.A +235.2652
R.LADLIRPALAWR.E +230.5885
R.LADLIRPALAWR.E +349.637356.4196
R.LDGFTFAPDAAEAGSDAK.A +135.491236.573930.9616
R.LDGFTFAPDAAEAGSDAK.A +250.446550.556747.548840.9262
R.LVGSDDVLRPR.L +235.056537.9063
R.NRPQHGAPAGANEGESAEAKGDR.S +353.94
R.SFVVTQAMTSLTGSAGEDFASILK.A +230.586536.570438.9674
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA049354.562.438.651.573.3rpmB, L28 50S ribosomal protein L28 546167:546472 forward MW:10978
K.GAQVGHKVSHSNIK.T +147.9756.438550.6932
K.GAQVGHKVSHSNIK.T +253.110834.9567
K.KMAGEPVAAAS.- +126.894726.2824
K.MAGEPVAAAS.- +125.6359
K.RRFLPNLVNVTFLSDTLGR.A +356.509449.5999
K.SVDHRGGLDAYLLK.A +127.3225
K.SVDHRGGLDAYLLK.A +232.627237.5324
K.SVDHRGGLDAYLLK.A +346.707450.9826
R.EAELSPK.A +126.7826
R.FLPNLVNVTFLSDTLGR.A +268.473873.947866.815271.3922
R.FLPNLVNVTFLSDTLGR.A +377.31883.0569
R.GGLDAYLLK.A +127.343827.135630.059833.1246
R.GGLDAYLLK.A +255.310154.239848.473545.4727
R.LRVSTNALK.S +230.813133.4248
R.RFLPNLVNVTFLSDTLGR.A +235.735630.23636.9376
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA049819.016.313.38.819.0cobS2 cobS protein 553555:554550 reverse MW:36988
K.STHIEQVAAR.L +127.006426.631
M.TAATTTAPEITGLPDMK.V +127.797827.685836.246732.1686
M.TAATTTAPEITGLPDMK.V +248.677749.421851.3406
R.ATTLAILAGFAK.N +129.7386
R.ATTLAILAGFAK.N +259.866851.6532.482234.0429
R.NAFANGDLSTVMSPR.T +260.351550.934935.393
R.VNLDSHISR.I +242.9784
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA050826.948.426.947.261.9accA acetyl-CoA carboxylase carboxyltransferase alpha subunit 561895:562857 forward MW:34470
K.AQQALQDLYAALTPWQK.T +133.878646.590237.7307
K.AQQALQDLYAALTPWQK.T +249.778953.041652.543157.8542
K.FGDDEALVGGFGR.F +129.0524
K.FGVIDQILAEPK.G +128.591633.255931.244227.2683
K.FGVIDQILAEPK.G +252.711865.358249.675955.1109
K.GGAHRDPEAMIATAGDAIAAAFAELKGQGR.D +361.808492.193492.3099105.58
K.ITAQDLLK.F +125.642125.1459
K.VLMLEHAVYSVISPEAASSILWR.D +248.717838.763
K.VLMLEHAVYSVISPEAASSILWR.D +360.4103
R.HPQRPHCVDYIEGLIAEFTPLAGDRK.F +360.8784
R.LMEMADRFDLPVLSLVDTAGAYPGIGAEER.G +237.1704
R.SYLDFEKPVAELDSK.I +232.5072
R.SYLDFEKPVAELDSKIDELR.T +353.4042
R.TLAASGSDIHEEIEK.I +130.4435
R.TLAASGSDIHEEIEKIEEK.A +245.25153.44276.220860.6991
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA051020.513.423.616.529.1secA preprotein translocase secA 564875:567715 reverse MW:106712
K.EGEAIIHPWINK.A +131.9571
K.FFLSLEDDLMR.I +233.885841.3469
K.LGGSLEMR.I +230.0799
K.NLLKFDDVQNDQR.K +231.6434
K.RPGGLYIIGSER.H +230.8124
K.SILLQTLDHLWR.E +234.257
K.TLDDLLVPAFATVR.E +125.1742
K.TLDDLLVPAFATVR.E +237.7567
K.YAAILAEVER.A +232.246
R.AELAAGKTLDDLLVPAFATVR.E +243.518831.6764
R.AELAAGKTLDDLLVPAFATVR.E +348.4686
R.DAGQLRGESLYDVENVSVVHHVNQALR.A +356.268161.167171.5023
R.GHNFAIVDEVDSILIDEAR.T +256.459898.330584.5086
R.HTYIEDLVAK.Y +130.358627.622331.9626
R.HTYIEDLVAK.Y +231.311431.1147
R.IELMKEDSVAETVTDMR.H +275.61963.4731
R.IFGSDKLDTMLTR.L +126.307928.0152
R.IFGSDKLDTMLTR.L +248.430734.347148.251249.6048
R.IFGSDKLDTMLTR.L +345.0644
R.IQQEAAHITDEAER.A +139.031749.9623
R.IQQEAAHITDEAER.A +259.737746.742553.670543.4841
R.IQQEAAHITDEAER.A +350.352
R.LGLKEGEAIIHPWINK.A +233.5513
R.LGLKEGEAIIHPWINK.A +360.92570.326368.547964.12
R.MQPVLVGTASIEK.S +134.240235.669235.663725.5583
R.MQPVLVGTASIEK.S +230.767131.3333
R.SKFFLSLEDDLMR.I +127.2174
R.TPLIISGPLDDR.S +243.764235.3876
R.VAAINALEPEVAALSDEALR.A +268.327657.333870.702459.3743
R.VAAINALEPEVAALSDEALR.A +371.228972.8636
R.VVGLDIPVDEWAKEEGIADEELITR.L +241.8972
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA051142.157.647.346.361.7RPA0511 PpiC-type peptidyl-prolyl cis-trans isomerase 568058:568993 forward MW:33354
K.AAEDKKIQDNADFKK.R +130.8362
K.AATTDEAMKKVYDEAAK.Q +237.351247.7053
K.AQIEQYVTR.K +130.9888
K.AQIEQYVTR.K +241.826550.222947.884141.2785
K.AVAEELKKGADFAELAK.K +237.484531.1526
K.DQMVPEFSAAAFALEPGK.I +132.7586
K.DQMVPEFSAAAFALEPGKISDPIK.T +238.482538.6831
K.DQMVPEFSAAAFALEPGKISDPIKTQFGWHIIK.V +353.55757.1314
K.ENVLAFLIDMK.I +239.078148.7411
K.GADFAELAK.K +136.001231.681933.688531.6376
K.GADFAELAK.K +239.3387
K.IVAK.A +125.3495
K.KVYDEAAK.Q +129.7772
K.QISGEQEVHAR.H +231.5356
K.SKDPGASDGGDLGFFTK.D +137.185527.6271
K.SKDPGASDGGDLGFFTK.D +239.585246.4071
K.VYDEAAKQISGEQEVHAR.H +235.3145
R.HILVETEDEAK.A +142.366454.265345.153747.0182
R.HILVETEDEAK.A +262.208254.353764.181
R.HILVETEDEAKAVAEELKK.G +261.0462
R.HILVETEDEAKAVAEELKK.G +379.320772.8091
R.HILVETEDEAKAVAEELKKGADFAELAK.K +354.513848.2304
R.KAQSDYVSK.L +125.1147
R.KENVLAFLIDMK.I +146.661749.110347.61639.7832
R.KENVLAFLIDMK.I +263.485472.731565.223165.8433
R.KENVLAFLIDMK.I +374.282264.7558.8745
R.LLMDDVLAAEGK.A +146.927134.725637.034644.1766
R.LLMDDVLAAEGK.A +269.664669.658452.805765.9044
R.NRLLMDDVLAAEGK.A +258.523469.041648.945548.4517
R.NRLLMDDVLAAEGK.A +346.6732
R.QSDVDLAEQELGPSLAQLDPASR.K +258.922682.11182.918961.5925
R.QSDVDLAEQELGPSLAQLDPASR.K +358.3889
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA051357.058.250.552.564.4pcaF putative acetyl-CoA acetyltransferase 571985:573193 forward MW:41726
K.AGPITVDKDEHPRPETTLEGLAK.L +246.25844.56544.480444.5442
K.AGPITVDKDEHPRPETTLEGLAK.L +357.482461.637657.404759.0291
K.ILGLASAAVPPR.I +232.616
K.LKPIVRNPGTVTAGNASGVNDGAAALLIASEAAVK.K +377.1978
K.LKPIVRNPGTVTAGNASGVNDGAAALLIASEAAVKK.Y +372.306754.9996
K.QQYGVDSMPETGENVAEEFQISR.A +237.336751.251438.1836
K.VRTDDLAAVPIK.A +136.8402
K.VRTDDLAAVPIK.A +235.519640.77834.2937
M.ADVFVCDAVR.T +130.9914
M.ADVFVCDAVR.T +240.3776
R.ADQDAFAIR.S +128.483625.8913
R.ADQDAFAIR.S +245.471754.594535.2342
R.AGAAIAAGYFAEEIAPVTYAGGK.A +246.64242.816562.572357.9569
R.APFVQGK.A +131.3648
R.FINPLMK.Q +231.900938.9916
R.IMGIGPVPATR.K +130.993930.424729.0207
R.IMGIGPVPATR.K +236.610940.571140.606637.1841
R.LALTAVHGLEK.R +133.170734.197936.43137.2889
R.LALTAVHGLEK.R +239.849445.18336.878945.0753
R.LCASGLDAVGAAGR.A +126.987229.260928.350936.3485
R.LCASGLDAVGAAGR.A +258.260668.114657.098368.2478
R.MAALLAGLPDSVPGQTLNR.L +133.354226.725829.4889
R.MAALLAGLPDSVPGQTLNR.L +252.748557.37560.902351.4647
R.NPGTVTAGNASGVNDGAAALLIASEAAVKK.Y +245.109137.682857.447243.7783
R.NPGTVTAGNASGVNDGAAALLIASEAAVKK.Y +357.49255.335460.5515
R.QLGVADDADFVNPHGGAIALGHPLGMSGAR.L +232.036740.191830.8011
R.QLGVADDADFVNPHGGAIALGHPLGMSGAR.L +358.721459.131949.746955.5356
R.SADIFDTTIGWR.F +253.752256.860244.1396
R.TDDLAAVPIK.A +134.714335.249933.725834.6171
R.TDDLAAVPIK.A +231.433133.9495
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA051930.638.53.97.342.2gcpE gcpE, Essential bacterial protein, involved in density-dependent regulation of peptidoglycan biosynthesis 578344:579669 forward MW:47189
-.MSPKPDIR.T +130.4359
K.HANIGISLPGTGETPAAPVFVDGEK.F +244.37453.4139
K.HANIGISLPGTGETPAAPVFVDGEKFR.T +231.418441.5477
K.HANIGISLPGTGETPAAPVFVDGEKFR.T +364.378
K.LLAEYPACAEALDKYR.I +233.1086
K.LMDENAASANPR.D +245.7268
K.VSAVQDLIAVYQDLASR.S +127.7241
K.VSAVQDLIAVYQDLASR.S +270.126665.935549.138142.9446
K.VSAVQDLIAVYQDLASR.S +380.80583.858284.9559
R.EAMVQSALLSAAR.A +251.57748.6984
R.EVQVGQELLQTMGFR.T +240.993639.3437
R.IGANWGSLDQELLTK.L +237.328149.355940.9542
R.KLGLTTPIIGDFHYIGHK.L +234.778632.4802
R.SIQDFIRDEMPEWR.S +232.3121
R.TFVPLVAACPGCGR.T +245.848644.6213
R.YGATPKPDAAQMVPAAE.- +127.2594
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA052425.325.026.628.638.0RPA0524 putative geranyltranstransferase (farnesyl-diphosphate synthase) 584622:585548 reverse MW:32901
K.RLDTTAEETEALLGR.L +272.099366.67357.387564.9819
K.TTFVTQLGIDGAK.Q +131.959728.1369
M.ATGTSTIDFAK.R +135.1688
R.ALGEAFQIADDLLDVEGDAAALGKPAGADAALGK.T +250.644264.306856.926461.7869
R.ALGEAFQIADDLLDVEGDAAALGKPAGADAALGK.T +384.676490.502385.321796.1766
R.FGDREPVDVAR.L +232.6433
R.LLSDELMSDEIARPR.R +235.941432.340633.2522
R.YGCVAGAILGQASPDQYR.A +246.47541.0485
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA053042.342.345.542.345.5RPA0530 conserved unknown protein 590022:590690 reverse MW:25279
K.AGQNLLPTTFLR.Q +126.205429.495132.415429.6058
K.AGQNLLPTTFLR.Q +239.464435.323446.122638.1935
K.DGEDFLVYDAK.T +148.021848.378245.19248.6963
K.DGEDFLVYDAK.T +237.522941.231460.8858.0563
K.TGDDITR.S +127.1453
K.YLEQSIDSLTR.E +138.741129.405131.6001
K.YLEQSIDSLTR.E +264.98762.531868.061773.8583
K.YLEQSIDSLTREQEK.F +238.848148.16535.32842.5355
R.FYGDSMQMVVPK.Y +125.5333
R.FYGDSMQMVVPK.Y +262.601152.628664.961259.6323
R.LYNTGTSTYVTLEDLATMVK.D +251.999743.760366.765460.9722
R.LYNTGTSTYVTLEDLATMVK.D +370.1918
R.LYNTGTSTYVTLEDLATMVKDGEDFLVYDAK.T +234.935730.403236.15732.8862
R.LYNTGTSTYVTLEDLATMVKDGEDFLVYDAK.T +348.819955.346260.466863.2148
R.MSLEQPK.K +126.1176
R.MSLEQPKKDE.- +132.129439.417247.24837.5802
R.RLYNTGTSTYVTLEDLATMVK.D +251.341947.1883
R.RLYNTGTSTYVTLEDLATMVK.D +358.0307
R.RLYNTGTSTYVTLEDLATMVKDGEDFLVYDAK.T +230.196244.876940.1941
R.RLYNTGTSTYVTLEDLATMVKDGEDFLVYDAK.T +370.707355.778783.460878.0409
R.SVLAQIIFEQENK.A +151.135247.9007
R.SVLAQIIFEQENK.A +266.819553.592466.497759.1133
R.SVLAQIIFEQENKAGQNLLPTTFLR.Q +246.03746.398963.251352.9972
R.SVLAQIIFEQENKAGQNLLPTTFLR.Q +365.496555.359745.1488
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA053171.471.488.076.088.0RPA0531 beta-ketothiolase, acetoacetyl-CoA thiolase 590894:592072 forward MW:40553
K.AEAAQKAGKFKDEIVPVTIK.T +237.522537.2952
K.AGKFKDEIVPVTIK.T +149.670251.829345.7442.1475
K.AGKFKDEIVPVTIK.T +251.810555.288150.431848.3423
K.AGKFKDEIVPVTIK.T +352.318151.737864.453757.0214
K.AGWSVGDLDLIEANEAFAAQACAVNKDLGWDTSK.V +241.536930.3058
K.AGWSVGDLDLIEANEAFAAQACAVNKDLGWDTSK.V +350.622350.0788
K.DEIVPVTIK.T +129.355
K.DGLWDAFNGYHMGNTAENVAR.Q +256.380262.830664.676357.9633
K.DGLWDAFNGYHMGNTAENVAR.Q +360.459757.357471.6608
K.DGTVTAGSASGINDGAAAVVLMTAK.Q +256.024258.55258.6486
K.DLGWDTSK.V +135.4215
K.DLGWDTSKVNVNGGAIAIGHPIGASGAR.V +245.748451.702263.574736.4706
K.DLGWDTSKVNVNGGAIAIGHPIGASGAR.V +370.329152.075476.423574.6236
K.FKDEIVPVTIK.T +148.9942.417741.582645.3123
K.FKDEIVPVTIK.T +250.824158.508654.271957.0694
K.IMGSGPIPASR.A +129.671533.204433.249334.3983
K.IMGSGPIPASR.A +243.138546.723944.797141.8275
K.LGKKPLAR.I +134.6354
K.LGKKPLAR.I +236.185831.0755
K.LKPAFEKDGTVTAGSASGINDGAAAVVLMTAK.Q +253.27246.193763.529562.0067
K.LKPAFEKDGTVTAGSASGINDGAAAVVLMTAK.Q +369.934676.120889.555377.4946
K.MGAVELVDTMLK.D +141.640846.684351.7776
K.MGAVELVDTMLK.D +272.293469.58868.209471.3512
K.MGAVELVDTMLKDGLWDAFNGYHMGNTAENVAR.Q +232.15337.076536.837
K.MGAVELVDTMLKDGLWDAFNGYHMGNTAENVAR.Q +362.234258.354993.590780.8844
K.QAEKLGKKPLAR.I +236.0904
K.VNVNGGAIAIGHPIGASGAR.V +131.660435.5986
K.VNVNGGAIAIGHPIGASGAR.V +265.3161.628368.53356.8134
K.VNVNGGAIAIGHPIGASGAR.V +350.850860.4725
M.SDDVVIVSAAR.T +135.617337.247934.541240.159
M.SDDVVIVSAAR.T +255.769862.228956.8921
R.DQQDEFAVASQQK.A +153.988265.442653.547850.9461
R.DQQDEFAVASQQK.A +277.828170.818979.452476.7207
R.DQQDEFAVASQQKAEAAQK.A +256.711954.20561.532247.7807
R.DQQDEFAVASQQKAEAAQK.A +354.738150.5377
R.GGIDPAQVSEVIMGQILTAGQGQNPAR.Q +293.345989.160575.512381.0417
R.GGIDPAQVSEVIMGQILTAGQGQNPAR.Q +393.262985.9683102.57285.5189
R.HGATLEAMAK.L +140.356641.760741.124244.9811
R.HGATLEAMAK.L +270.260262.264960.533660.6542
R.IVSWGQAGVDPK.I +126.012627.044727.8443
R.IVSWGQAGVDPK.I +263.319164.08264.780568.2946
R.KGDIVVDTDEYPR.H +148.254149.258249.990555.8155
R.KGDIVVDTDEYPR.H +276.059582.123178.62680.5271
R.KGDIVVDTDEYPR.H +368.364365.908863.968159.317
R.KGDIVVDTDEYPRHGATLEAMAK.L +239.747136.958550.5278
R.KGDIVVDTDEYPRHGATLEAMAK.L +357.4278
R.QASIAAGIPVDSPAWGINQLCGSGLR.S +261.759759.902955.584641.8163
R.QASIAAGIPVDSPAWGINQLCGSGLR.S +358.888575.412259.7171
R.SVALGYQALMNGDSDIVIAGGQESMSMAPHAQYLR.G +364.7059
R.TAVGSFNGAFANTPAHELGAVAIK.A +248.374451.329455.345858.3902
R.TAVGSFNGAFANTPAHELGAVAIK.A +351.571452.806163.97871.5962
R.VLVTLLHEMQK.R +143.090945.404844.594446.4224
R.VLVTLLHEMQK.R +262.772461.931661.555261.6366
R.VLVTLLHEMQK.R +345.946351.633545.9168
R.VLVTLLHEMQKR.D +137.519137.733935.185435.0549
R.VLVTLLHEMQKR.D +260.663150.43355.387252.108
R.VLVTLLHEMQKR.D +357.779149.704546.41349.7919
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA053249.469.362.271.477.2RPA0532 beta-ketothiolase, acetoacetyl-CoA reductase 592255:592980 forward MW:25466
K.AGDIGFTK.A +131.817330.660929.051835.3765
K.AILPLIPCNR.L +126.906528.277329.9643
K.AILPLIPCNR.L +234.376336.262134.358835.4214
K.ALALENAR.G +234.8230.793642.2094
K.FKNETGIPVYK.W +130.5369
K.FKNETGIPVYK.W +241.905344.3574
K.GQFGQVNYSAAK.A +126.44233.188135.500733.2984
K.GQFGQVNYSAAK.A +248.806239.352941.4596
K.KVEAELGPVDVLVNNAGITR.D +261.681469.970178.453878.8707
K.MTLEQWNAVINTNLGSLFNMTR.Q +237.373762.085461.561660.5882
K.MTLEQWNAVINTNLGSLFNMTR.Q +346.7532
K.VAASYAGNDSAAEK.F +132.4813
K.VEAELGPVDVLVNNAGITR.D +128.7266
K.VEAELGPVDVLVNNAGITR.D +232.528752.907355.516750.7825
K.WDVSSFDACAEGVKKVEAELGPVDVLVNNAGITR.D +346.928862.3108
M.TRVALVTGGTR.G +248.280547.793647.8767
R.GGITVNVICPGYINTEMVQAVPKDVLDK.A +236.902538.502747.1227
R.GGITVNVICPGYINTEMVQAVPKDVLDK.A +350.810245.2572
R.GGITVNVICPGYINTEMVQAVPKDVLDKAILPLIPCNR.L +346.841259.898
R.GIGAAISK.A +129.106828.750529.1995
R.IVNISSINGQK.G +141.648637.054140.7438
R.IVNISSINGQK.G +255.170448.374451.414744.0576
R.IVNISSINGQKGQFGQVNYSAAK.A +236.4732
R.IVNISSINGQKGQFGQVNYSAAK.A +354.6552
R.LGEAEEIAR.A +136.196735.406738.650440.2256
R.LGEAEEIAR.A +267.648759.768360.133955.7955
R.VALVTGGTR.G +125.8542
R.VALVTGGTR.G +242.335437.4282
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA054322.334.933.128.040.6RPA0543 unknown protein 606652:607179 forward MW:18483
K.AAEAKPADAKPDAKPEAK.S +132.100148.112449.0431
K.AAEAKPADAKPDAKPEAK.S +242.743856.802952.3648
K.FAQEKPTLAR.L +134.13732.4807
K.FAQEKPTLAR.L +240.0639
K.SAAVPSVPQGPAVYPSAIDAK.F +246.741849.579249.093355.1816
K.SEAKPADSKPESK.S +142.4391
R.LHTCAQQWK.A +127.920430.6129
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA055772.969.979.573.879.5cysK cysteine synthase, cytosolic O-acetylserine(thiol)lyase 618596:619594 forward MW:34544
K.AEELVAATPNAVMPQQFK.N +141.228849.165446.710440.6029
K.AEELVAATPNAVMPQQFK.N +260.47465.159859.628863.4724
K.AEELVAATPNAVMPQQFK.N +345.021847.050649.7512
K.AVAEAPAHRPGR.G +233.915837.5251
K.GAVAKAEELVAATPNAVMPQQFK.N +262.006947.156666.835254.0341
K.GAVAKAEELVAATPNAVMPQQFK.N +351.0721
K.IPSATAIETSR.A +139.7795
K.IPSATAIETSR.A +249.429639.955643.335442.7199
K.IQGIGAGFVPDILDR.S +131.788432.359632.1356
K.IQGIGAGFVPDILDR.S +273.928682.158672.5469.4033
K.LEYFNPASSVK.D +136.843430.721529.169333.4078
K.LEYFNPASSVK.D +242.026150.039135.6217
K.LEYFNPASSVKDR.I +130.9661
K.LEYFNPASSVKDR.I +242.647549.8846.838948.8857
K.LVMPESMSIER.R +125.566425.9778
K.LVMPESMSIER.R +245.597240.736942.101739.822
K.MLAFLGAELVLTEAAK.G +237.162333.441234.52343.1513
K.MLAFLGAELVLTEAAK.G +355.6012
K.TIVAIVPSFSER.Y +128.380731.394928.640236.0242
K.TIVAIVPSFSER.Y +250.644164.538341.932550.5847
K.VVAVEPEESPVLSGGAPGPHK.I +256.707462.543271.925270.6384
K.VVAVEPEESPVLSGGAPGPHK.I +358.142156.862564.597567.8064
K.VVAVEPEESPVLSGGAPGPHKIQGIGAGFVPDILDR.S +231.395435.050431.539
K.VVAVEPEESPVLSGGAPGPHKIQGIGAGFVPDILDR.S +354.887163.082475.091872.5991
M.SSAATASIK.A +125.959
R.GRVYESIADAYGDTPLVR.L +249.273641.753253.887657.651
R.HEGIPGGISSGAAIAAAIELGKRPENAGK.T +254.872164.639566.124656.4694
R.HEGIPGGISSGAAIAAAIELGKRPENAGK.T +359.469473.326282.664187.9252
R.KASLKVVAVEPEESPVLSGGAPGPHK.I +252.177334.6061
R.KASLKVVAVEPEESPVLSGGAPGPHK.I +351.085552.7361
R.KASLKVVAVEPEESPVLSGGAPGPHKIQGIGAGFVPDILDR.S +347.177764.4748
R.LKLVMPESMSIER.R +133.679
R.LKLVMPESMSIER.R +234.505331.338635.15236.6187
R.LKLVMPESMSIER.R +366.126670.313449.5409
R.LNRLPQQHGVK.A +133.399639.9233.434833.5242
R.LNRLPQQHGVK.A +242.431640.732141.131835.7269
R.LNRLPQQHGVK.A +360.628748.028449.4269
R.RTTAEEIWNDTDGAVDIFVAGVGTGGTVSGVGQVLKPR.K +369.00850.1169
R.SVIDEVVK.I +127.548828.79427.455
R.SVIDEVVKIPSATAIETSR.A +246.371450.332750.442152.5515
R.SVIDEVVKIPSATAIETSR.A +368.796676.99979.432169.9726
R.TTAEEIWNDTDGAVDIFVAGVGTGGTVSGVGQVLKPR.K +356.557973.230470.225866.3258
R.VYESIADAYGDTPLVR.L +129.342631.66229.286425.2023
R.VYESIADAYGDTPLVR.L +275.479177.192472.344773.9487
R.YLSTVLFEGV.- +125.998425.5391
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA056636.743.250.464.064.0RPA0566 conserved unknown protein 629211:629630 forward MW:14799
R.AAGPVGAVVGGTIGGVVGGVAGILGVDDRPQFR.S +362.713651.161875.204476.0083
R.ASEYRYTVVNDR.T +233.6852
R.SYVVEQR.H +134.5949
R.THKVVEIIE.- +129.078225.5251
R.THKVVEIIE.- +235.79634.8296
R.TVLVDPR.T +234.7433.6071
R.VGVVLPGDGVTYYEVPDR.F +136.9031
R.VGVVLPGDGVTYYEVPDR.F +233.541252.346773.816591.0234
R.VGVVLPGDGVTYYEVPDRFGR.A +242.458939.6281
R.VGVVLPGDGVTYYEVPDRFGR.A +345.058652.4964
R.VGVVLPGDGVTYYEVPDRFGRASEYR.Y +351.3908
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA057153.342.953.346.753.3regR two-component transcriptional regulator RegR, Fis family 633579:634133 reverse MW:20139
K.AAPAFAVVDLR.L +128.207125.251435.1739
K.AAPAFAVVDLR.L +262.329361.256654.514848.6579
K.MGAVDYLSKPADADDVVAALLSTGTEK.S +284.288585.1587.481482.1831
K.MGAVDYLSKPADADDVVAALLSTGTEK.S +353.596461.147551.104
M.NAIPELNDHTDR.S +131.27429.8024
M.NAIPELNDHTDR.S +232.0351
R.GFAVTACDSVSSGLAQIGK.A +131.734227.9747
R.GFAVTACDSVSSGLAQIGK.A +234.292344.8281
R.LGDGNGLDVVSALKR.E +127.542326.4344
R.LGDGNGLDVVSALKR.E +232.661533.9283
R.LGDGNGLDVVSALKR.E +350.5954
R.SLLIVEDDKPFLDR.L +135.6437
R.SLLIVEDDKPFLDR.L +255.005852.742648.973950.2825
R.SLLIVEDDKPFLDR.L +351.705856.068148.5475
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA057510.47.525.619.528.3RPA0575 putative intracellular PHB depolymerase 637418:638746 forward MW:49786
K.GVGHYGVFNGSR.F +132.535
K.LAFKNPLNPWSHTEFGK.S +128.751827.0878
K.LAFKNPLNPWSHTEFGK.S +231.533545.136750.0474
K.LAFKNPLNPWSHTEFGK.S +374.472268.7097
K.SIAAACEVFER.T +251.818
M.PVVIGEFGRPPDMPAEVSPALTTPMYWFYEMAHASLNPAR.A +366.523347.8754
R.FRSEIVPR.I +239.502647.228448.3689
R.GTVEAFLPTHEVYITDWADAR.M +231.185935.679652.86847.0793
R.GTVEAFLPTHEVYITDWADAR.M +362.3109
R.LLIVAPMSGHYATLLR.G +238.3796
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA058039.250.068.766.370.7RPA0580 possible branched-chain amino acid binding protein, ABC transport system 643359:644579 reverse MW:44248
K.GIISVNYGKDPADPQWANDEGVK.K +239.3498
K.GIISVNYGKDPADPQWANDEGVKK.Y +238.298940.293453.686254.5485
K.GIISVNYGKDPADPQWANDEGVKK.Y +370.215479.6452
K.IGILFQNDDLGR.D +240.701740.803256.2943
K.IGILFQNDDLGRDYVTGLR.A +230.786332.4183
K.IGILFQNDDLGRDYVTGLR.A +347.677359.156360.811657.7093
K.IGQTVPFSGPASAYAGIGK.T +125.3331.614125.52
K.IGQTVPFSGPASAYAGIGK.T +233.054953.783257.916653.108
K.IGQTVPFSGPASAYAGIGKTQAAYMR.M +232.61843.687135.8667
K.KVADLGWNPVHILDINASPVSATLKPAGLDISK.G +239.429534.7591
K.KVADLGWNPVHILDINASPVSATLKPAGLDISK.G +377.612498.2995
K.KVPQLLASTGATR.F +128.447532.495841.1049
K.KVPQLLASTGATR.F +245.441341.4157
K.LKSAGATLLYNASTPR.F +249.732
K.NFPWTMGFNPNYQTEGR.I +248.906435.0451
K.NVVGDLSLPGMSVNTSPTDFR.V +237.044952.863
K.NVVGDLSLPGMSVNTSPTDFRVNK.Q +230.789232.127137.941234.5241
K.NVVGDLSLPGMSVNTSPTDFRVNK.Q +355.3018
K.QAANLKNVVGDLSLPGMSVNTSPTDFRVNK.Q +345.1428
K.SAGATLLYNASTPR.F +135.8103
K.SAGATLLYNASTPR.F +240.954937.152354.049754.9814
K.VADLGWNPVHILDINASPVSATLKPAGLDISK.G +243.288348.878549.0965
K.VADLGWNPVHILDINASPVSATLKPAGLDISK.G +367.454675.008799.284892.1819
K.YDPGASDTEIK.I +129.488429.781726.9163
K.YDPGASDTEIKIGQTVPFSGPASAYAGIGK.T +245.0958
K.YLNAK.K +127.367725.635625.4292
R.AALGDKADKMIVAEASYELTDPTVDSQIVK.L +267.776459.2526
R.AALGDKADKMIVAEASYELTDPTVDSQIVK.L +358.0424
R.FAAQAIK.K +128.651628.657529.93630.9173
R.FAAQAIK.K +240.4444.6875
R.FAAQAIKK.V +129.552527.647335.022134.1975
R.FAAQAIKK.V +245.167949.389350.922353.3153
R.KINLIQYDDAYSPPK.A +132.351
R.KINLIQYDDAYSPPK.A +231.634352.506457.0213
R.KINLIQYDDAYSPPKAVEQVR.K +255.005471.3542
R.KINLIQYDDAYSPPKAVEQVR.K +360.39
R.MINEQGGINGR.K +255.6849
R.WELFGPIIEDDAAM.- +135.071839.057337.0909
R.YILQHHPDAK.I +133.306238.782235.4124
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA059034.135.434.346.460.1prc putative carboxyl-terminal protease 657260:658600 reverse MW:46398
K.DGGLKGLVIDLR.N +232.76237.201
K.LKSDAKDGGLKGLVIDLR.N +234.4755
K.SATSAPIKADLIGKPEDAQLNAALALVLK.K +230.9159
K.SATSAPIKADLIGKPEDAQLNAALALVLKK.D +368.484875.389
K.VGTATTQGMSLR.N +235.1587
R.AKLEPGDLIIK.V +136.296729.564929.7339
R.AKLEPGDLIIK.V +243.083240.682836.68832.6469
R.AYVHPIPSDELTK.D +136.551732.1368
R.AYVHPIPSDELTK.D +238.6618
R.AYVHPIPSDELTKDALK.G +346.621
R.EQTAPADLDLIGGVIQLVQR.A +251.706134.035768.032571.8452
R.EQTAPADLDLIGGVIQLVQR.A +364.0389
R.ESALHGAIANPGQLGK.S +148.600456.815961.2028
R.ESALHGAIANPGQLGK.S +236.171446.63130.176
R.GKDEPFDVTLTR.E +125.0971
R.ISQFGADTADGFTAALTK.L +245.407460.0603
R.IVSPIDGTPAAR.A +242.151540.789141.21642.6071
R.NDPGGLLNAAVSVAGDLLDGGTVVSIR.G +266.132344.6754
R.NDPGGLLNAAVSVAGDLLDGGTVVSIRGR.Q +351.098746.325
R.NVVDMLR.G +129.2406
R.SIQDEGIVPDVIEEAPKDQQISGGPLIR.E +236.498149.925837.21244.8444
R.SIQDEGIVPDVIEEAPKDQQISGGPLIR.E +353.002161.472346.5308
R.VFSAPSKGDKLPGVPIVVLINGASASASEIVAGALQDR.K +347.5698
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA059235.153.326.415.055.0argJ putative glutamate N-acetyltransferase/amino-acid acetyltransferase 661788:663029 forward MW:42582
K.AFNAVLADLAEQVAR.D +130.4756
K.AFNAVLADLAEQVAR.D +272.369471.326258.566452.1828
K.AFNAVLADLAEQVAR.D +3103.161103.315
K.AGARDPSYNEKEVSAEMK.K +232.896
K.AGARDPSYNEKEVSAEMKKPVIQIK.V +233.314534.2758
K.AGARDPSYNEKEVSAEMKKPVIQIK.V +369.473964.8575
K.AGEPADRDKLSISFNGIR.V +233.3461
K.AIGCKPAEVFLASTGVIGEPLDATKFDGVLDALALDAGPDGWMDAAK.A +364.184877.6052
K.AIMTTDTFPK.V +246.113133.4784
K.IALSIANSPLVK.T +238.753347.1959
K.SGKQAATLTAQLAAK.A +130.043932.7234
K.SGKQAATLTAQLAAK.A +241.781446.9493
K.TAIAGEDANWGR.V +253.819342.2107
K.VALGLGK.G +129.7315
K.VSPLAPTDVPAMPMIAGVR.L +241.248939.086535.43238.1543
M.SSKVSPLAPTDVPAMPMIAGVR.L +263.198842.377
R.ALVVNSGNANAFTGK.S +129.211340.652425.8181
R.ALVVNSGNANAFTGK.S +275.422871.174250.106638.1643
R.KIALSIANSPLVK.T +132.007145.042441.234234.05
R.KIALSIANSPLVK.T +238.341933.9786
R.KLVEIIVEGAK.T +148.83942.3343
R.KLVEIIVEGAK.T +259.710858.6303
R.LATAAAGIR.Y +242.7001
R.VLTCDLTK.E +126.6113
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA060428.817.513.216.530.9lysC putative aspartokinase, alpha and beta subunits 670503:671756 forward MW:44630
K.TTDLTFTVPASDFAR.A +125.9663
K.TTDLTFTVPASDFAR.A +246.108742.706930.1803
R.AKQTITSAQDK.I +135.2904
R.AKQTITSAQDKIGYAR.F +240.588333.492247.3441
R.EVDAGHEVAVVVSAMSGK.T +230.7948
R.EYDAVVASGEQVTSGLLAIALQSLGIQAR.S +243.571146.564542.0977
R.EYDAVVASGEQVTSGLLAIALQSLGIQAR.S +357.7667
R.FDSETDVAK.V +127.5572
R.SHAGVAAQAFAALAAR.N +129.5359
R.SHAGVAAQAFAALAAR.N +233.774332.2343
R.SVELGMVHNMPIFVR.S +248.505939.395540.2921
R.SVELGMVHNMPIFVR.S +351.3848
R.TLHTLYGLDQV.- +144.148443.288237.9051
R.TLHTLYGLDQV.- +236.964740.786430.6232
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA061038.474.970.674.981.6RPA0610 putative glyoxalase II 678565:679332 forward MW:27574
K.FALGIEPDNAALQAR.A +136.866236.261534.8
K.FALGIEPDNAALQAR.A +265.434665.562169.349667.0762
K.IADADVR.L +125.5458
K.IADADVR.L +231.1909
K.LTDILVTHHHGDHVGGIAELK.K +239.631845.5065
K.LTDILVTHHHGDHVGGIAELK.K +346.9876
K.LYCGHEYTASNVK.F +136.307442.3496
K.LYCGHEYTASNVK.F +234.9459
R.ADVPSVAAAVGMPGAPAAEVFGEIR.E +233.653440.801952.816141.1092
R.ADVPSVAAAVGMPGAPAAEVFGEIRER.K +348.0984
R.AEGKPTIPVTLGEEK.Q +138.226527.931537.9139
R.AEGKPTIPVTLGEEK.Q +233.814546.040342.8952
R.AKQVESLRAEGKPTIPVTLGEEK.Q +244.792650.010543.762642.6753
R.AKQVESLRAEGKPTIPVTLGEEK.Q +346.660747.6343
R.ALPDDFKLYCGHEYTASNVK.F +233.726
R.IVPCLTDNFGYLVHDPATGATASIDAPEAAPLIAALDKEGWK.L +346.54869.073864.2869
R.LQEGDVVR.V +126.7329
R.LQEGDVVR.V +235.1633
R.VFEGTYPMMWESLLK.L +128.330831.27426.488
R.VFEGTYPMMWESLLK.L +252.551961.319966.859457.7366
R.VHAPHDANAK.I +133.450740.161636.9522
R.VLETPGHTLDHLSYVFDDDR.A +238.620258.683164.014962.5165
R.VLETPGHTLDHLSYVFDDDR.A +354.811759.564875.890356.4438
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA06126.719.96.727.630.4RPA0612 possible sugar kinase 679887:680825 reverse MW:32333
K.LAEEGIGSSGLIHMPGLVTPISAVLVDPTGER.T +235.145238.4022
K.LAEEGIGSSGLIHMPGLVTPISAVLVDPTGER.T +357.332353.5869
K.VALPDADTLLKDCDAILTESR.C +251.254334.175933.715237.6722
K.VALPDADTLLKDCDAILTESR.C +352.840766.235550.074147.7046
R.AEVDELLAK.S +129.1683
R.IEAVPGRGNKVPASSFGEICGGNALNAAIGIAR.L +346.9424
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA062611.419.919.215.319.9dapD 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase 693297:694142 reverse MW:29734
M.PLTALESTINAAFDAR.D +256.395142.099651.614356.1012
R.DASGAWTVNQWLK.K +136.539229.585
R.DASGAWTVNQWLK.K +235.4899
R.QAVEDALDLLDQGK.V +249.00230.5013
R.QAVEDALDLLDQGKVR.V +233.5304
R.QAVEDALDLLDQGKVR.V +346.302350.804
R.SKTSINELLRD.- +236.342435.623141.9045
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA062915.124.514.114.824.5argB putative acetylglutamate kinase 696146:697042 reverse MW:31485
K.RLLLLTDVPGVLDQNKK.L +232.7559
K.RLLLLTDVPGVLDQNKK.L +347.8203
M.TDAPVISPLDQAR.I +125.948526.1731
M.TDAPVISPLDQAR.I +231.065635.4591
R.DIVLLEQTAVNPVVVHGGGPQIAQMLK.R +230.483547.5777
R.DIVLLEQTAVNPVVVHGGGPQIAQMLKR.L +232.908
R.KLIADGTISGGMIPK.V +138.743338.686428.636325.0609
R.LLLLTDVPGVLDQNKK.L +235.622733.8269
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA066853.668.666.671.271.2hbaE putative ABC transporter subunit, substrate-binding component 736364:737542 reverse MW:40675
K.ADVLIGTVHSGVAMAMVK.I +146.40545.1901
K.ADVLIGTVHSGVAMAMVK.I +275.093250.1229
K.ADVLIGTVHSGVAMAMVK.I +346.1953
K.DYAAANLGIPLWGPGFLTDGVEAAAGPAGDGIK.T +238.388
K.ELNAAMAAASFASPR.G +131.317833.7462
K.ELNAAMAAASFASPR.G +231.763556.523365.749164.1962
K.FIKDYAAANLGIPLWGPGFLTDGVEAAAGPAGDGIK.T +254.29843.8486
K.FIKDYAAANLGIPLWGPGFLTDGVEAAAGPAGDGIK.T +358.594492.450872.5734
K.IAREDGIPTIVPNAGADIITR.A +275.993166.458663.993367.5572
K.IAREDGIPTIVPNAGADIITR.A +364.96761.817655.9095
K.IPPDVFAVQGWDAGQLLDAGVK.A +230.529743.920558.332878.6272
K.IPPDVFAVQGWDAGQLLDAGVK.A +396.2681
K.KAVTVTWK.Y +128.523133.2297
K.LIQSEKADVLIGTVHSGVAMAMVK.I +262.597146.43771.895762.3281
K.LIQSEKADVLIGTVHSGVAMAMVK.I +366.988755.865382.97487.3633
K.LSAAHNPVQNFYLR.E +136.916243.13
K.LSAAHNPVQNFYLR.E +256.278854.2033
K.LSAAHNPVQNFYLR.E +355.541553.7722
K.RKELNAAMAAASFASPR.G +237.722563.845867.925277.6251
K.RKELNAAMAAASFASPR.G +346.442661.228369.0566
K.SFEAAYK.I +128.3811
K.SFEAAYKIPPDVFAVQGWDAGQLLDAGVK.A +236.650935.734461.823357.6108
K.SFEAAYKIPPDVFAVQGWDAGQLLDAGVK.A +366.268283.184971.9155
K.SVNLGLAAPAVADEAIGCK.L +131.964536.856749.551555.5955
K.SVNLGLAAPAVADEAIGCK.L +242.373557.413649.84852.7875
K.SVNLGLAAPAVADEAIGCKLS.- +138.817352.085640.3323
K.SVNLGLAAPAVADEAIGCKLS.- +235.03243.379641.41834.1052
K.TVLHYVSDLDNAENQAFVK.S +274.370989.310389.301390.1626
K.TVLHYVSDLDNAENQAFVK.S +359.494962.508165.661161.8153
K.VDDESAPPKATELTTK.L +125.776433.062533.7948
K.VDDESAPPKATELTTK.L +252.184840.2849
K.VGLLLPYSGTYAPLGEAITR.G +264.063670.244780.903372.3272
K.VGLLLPYSGTYAPLGEAITR.G +361.84160.651250.406256.2358
K.YAAGEEMVSGFKK.S +147.121947.120340.117
K.YAAGEEMVSGFKK.S +251.568761.39154.267
R.AMCAPNVFR.T +125.215225.333330.859927.2194
R.AMCAPNVFR.T +237.950943.476744.808244.4043
R.EDGIPTIVPNAGADIITR.A +232.052347.271343.4869
R.GLELYVQSQGGK.L +137.031650.396246.7475
R.GLELYVQSQGGK.L +253.7393
R.GPFKLSAAHNPVQNFYLR.E +244.837338.295767.538874.9236
R.GPFKLSAAHNPVQNFYLR.E +348.337365.491876.528786.5079
R.SISFVK.V +125.0465
R.SISFVKVDDESAPPKATELTTK.L +252.973150.354366.559657.4237
R.SISFVKVDDESAPPKATELTTK.L +356.145652.099169.587357.6908
R.TSFANGQIGR.A +243.496735.3247
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA068114.022.431.134.039.2RPA0681 membrane permeases, predicted cation efflux pump 755856:756890 forward MW:37556
K.ASLSDATAAIDAAR.A +126.9454
K.ASLSDATAAIDAAR.A +250.349857.461138.6886
K.LAQAGEVLGAGSR.V +125.544434.765439.4113
K.LAQAGEVLGAGSR.V +262.137456.028651.7171
K.MDVSDIQAQLLAAEAQER.R +253.470736.685557.1809
R.AEALFEK.G +130.4779
R.IAEVLVKEGDEVEKGQLLVK.M +234.248859.4375
R.IAEVLVKEGDEVEKGQLLVK.M +350.841454.7249
R.LESEQVEIATK.L +125.4533
R.LILDAIPQYVVPAK.V +240.157139.892137.5231
R.LILDAIPQYVVPAKVTFVASEAQFTPK.A +359.0299
R.LILDAIPQYVVPAKVTFVASEAQFTPKAVETKDEREK.L +345.7391
R.QAAQNVADAALIAAK.A +236.240756.6678
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA071532.024.912.311.432.0cobW putative cobalamin synthesis protein cobW 785618:786622 forward MW:35110
K.LLNRDTPLDAIVIETSGLALPQPLLK.A +257.103354.447455.343958.4837
K.SDLVDPEQLAALEAK.L +129.237240.944733.7112
K.SDLVDPEQLAALEAK.L +233.665554.3067
R.DTPLDAIVIETSGLALPQPLLK.A +243.464537.1528
R.SHGTLAPSVLIGLDAEAENDLASR.I +230.143
R.VAGKPAPVVVQAVGSR.I +233.5029
R.VAGKPAPVVVQAVGSR.I +353.025354.6777
R.VGDALGLDGVLR.V +237.314851.126338.8501
R.VPVTVLTGFLGAGK.T +241.820347.8443
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA075060.268.750.250.871.7sbp sulfate ABC transporter, periplasmic binding protein component 829860:830849 reverse MW:35743
K.AQTEHFADGGVFDK.I +143.74743.075538.8694
K.AQTEHFADGGVFDK.I +259.831443.4329
K.AQTEHFADGGVFDKIYKN.- +254.882845.896151.410850.8212
K.AQTEHFADGGVFDKIYKN.- +367.240346.694
K.DSGNTVTIK.Q +128.848629.8
K.EFGADKFEIVAPSVSILAEPPVAVVDTVVDK.K +245.1105
K.EFGADKFEIVAPSVSILAEPPVAVVDTVVDKK.G +348.465346.233859.135
K.GIKDWDDLLK.S +139.562637.0376
K.GIKDWDDLLK.S +240.392945.691137.964241.1991
K.GLLAKDWQK.R +132.867638.554
K.GLLAKDWQK.R +239.4341
K.QVPVLDTGAR.G +231.8638
K.RLPQNSSPYTSTIVFLVR.K +241.240237.815659.467844.9822
K.RLPQNSSPYTSTIVFLVR.K +354.992450.407759.1054
K.SFAAAYQK.D +131.491131.996931.3954
K.SGVSVITPNPK.T +134.124628.73829.363634.6801
K.SGVSVITPNPK.T +239.055239.949837.036831.6462
K.VDLFTIDDVFGGWTK.A +139.300938.843943.054438.045
K.VDLFTIDDVFGGWTK.A +269.513873.776977.703569.3133
K.YLYSKDGQEIAAR.N +136.3381
K.YLYSKDGQEIAAR.N +251.186558.088433.8454
R.ATAEAYLK.Y +128.532130.183426.613127.2648
R.DFVGKLYK.Q +133.7091
R.ELYADFNK.S +130.116232.373727.074729.6217
R.GSTVTFVER.G +239.8424
R.NFYRPRDPEIAK.K +347.1833
R.SVIDGLQADVVTLALAYDIDAIANK.G +244.478538.015944.02833.1623
R.SVIDGLQADVVTLALAYDIDAIANKGLLAK.D +253.980245.707545.058743.4916
R.SVIDGLQADVVTLALAYDIDAIANKGLLAK.D +360.571750.181873.046456.6552
R.SVIDGLQADVVTLALAYDIDAIANKGLLAKDWQK.R +350.710346.66352.640454.6759
R.WNYLAAWGYALK.K +234.695238.7578
R.WNYLAAWGYALKK.S +132.053
R.WNYLAAWGYALKK.S +240.688143.338538.447140.5588
R.WNYLAAWGYALKK.S +347.530346.047
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA078218.818.826.426.426.4RPA0782 conserved unknown protein 866503:866937 reverse MW:16292
K.VLGIDEDAIAR.A +128.289430.8731
R.IAHDLGVTASDLDELVR.Q +146.044639.1014
R.IAHDLGVTASDLDELVR.Q +267.632886.743974.972987.7562
R.IAHDLGVTASDLDELVR.Q +363.873166.058262.472153.3073
R.LLETFADWLK.H +248.709640.293658.028561.5304
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA078427.134.641.434.645.4RPA0784 putative short-chain alcohol dehydrogenase-like protein 869122:869964 forward MW:28785
K.ALGLTTDAAEK.T +131.190330.887731.9034
K.ALIDTALDTFGR.L +129.1258
K.ALIDTALDTFGR.L +252.042766.908158.884161.6913
K.KQGAGSIINNGSIAGR.L +238.242332.4741
K.VAVITGATSGIGWR.T +245.0002
R.AGIPDDIAQAAVFLASDESTFINGHDLVVDGGITGGR.N +351.078350.741153.3938
R.LAGFSSSLVYGAAK.A +128.383641.277244.698136.4673
R.LAGFSSSLVYGAAK.A +248.653349.585241.653660.3533
R.SVMLGMK.H +125.675226.854329.671630.4958
R.VNSISPGAIATGIFGK.A +129.908726.287636.078626.1567
R.VNSISPGAIATGIFGK.A +237.231457.787631.294842.4799
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA079453.259.959.948.859.9acaP a-type carbonic anhydrase 881807:882565 reverse MW:27007
K.ADAGINPNALLPAK.L +128.13129.882726.4392
K.ADAGINPNALLPAK.L +233.769638.480337.514937.7456
K.IVATMPQSEGPAVK.A +136.710736.802834.915340.239
K.IVATMPQSEGPAVK.A +256.56359.375253.717158.6923
K.IVATMPQSEGPAVKADAGINPNALLPAK.L +235.656854.7592
K.IVATMPQSEGPAVKADAGINPNALLPAK.L +356.2938
K.LGGATFK.L +129.571128.744327.093829.1557
K.LVQFHFHRPSEHQIDGK.S +231.908941.2032
K.LVQFHFHRPSEHQIDGK.S +353.7307
K.SFPMEVHFVHR.M +125.949825.1575
K.SFPMEVHFVHR.M +232.484433.404438.1643
K.WGEIDPANQICSIGVQQSPVDIR.S +275.422479.371376.827784.7222
K.WGEIDPANQICSIGVQQSPVDIR.S +358.67253.3483
R.FVLQSN.- +127.559927.316727.597727.426
R.MDSGTLGVVGVLMQEGAANAAFAK.I +240.478750.527780.832977.4435
R.MDSGTLGVVGVLMQEGAANAAFAK.I +356.542385.3122
R.YEGSLTTPPCSEVVDWMVLTDPITVAAEDVAAFAK.L +233.587336.464439.090639.1895
R.YEGSLTTPPCSEVVDWMVLTDPITVAAEDVAAFAK.L +363.224459.467661.4032
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA080618.238.733.335.249.5RPA0806 possible high-affinity branched-chain amino acid transport system substrate-binding protein 894376:895596 forward MW:44249
K.FITLDDSYSAPK.A +140.142530.067129.0517
K.FITLDDSYSAPK.A +243.912240.9223
K.GFHSPYFLDGIDYSYTPDDYTPMK.T +241.21151.363641.9916
K.HVVAVKPDAK.V +135.91947.805241.9557
K.IAEIGWKPLHLLSAGSTGR.S +240.650744.203144.799234.6777
K.IAEIGWKPLHLLSAGSTGR.S +355.654157.9622
K.IGQTVPHSGPGSLYGVLGR.V +231.6202
K.KVPQLLLNTGASK.W +143.711133.8843
K.KVPQLLLNTGASK.W +236.6903
K.VAILYQNDDFGRDFLAPFKK.V +236.8475
K.VAILYQNDDFGRDFLAPFKK.V +346.4448
K.WTMAGLPLYPTEAR.I +234.983237.918735.365142.0152
K.YDPGASDTEIK.I +129.488429.781726.9163
K.YLPNVDKDNTIAYAGYGQAVTMAEILRR.C +346.5044
R.KIAEIGWKPLHLLSAGSTGR.S +241.945250.626341.5519
R.SILNAAGLDNAK.G +136.998437.53336.039625.9942
R.SILNAAGLDNAK.G +244.701654.102331.5962
R.SILNAAGLDNAKGIVAIR.Y +230.0088
R.VGEAYFQMLNEK.G +132.139331.614434.9705
R.VGEAYFQMLNEK.G +250.968240.9074
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA081613.811.718.111.222.5RPA0816 putative acyl-CoA dehydrogenase 909857:911647 forward MW:63864
K.FLVNPDGTVGAR.N +246.716337.730939.7145
K.GISLFVVPK.F +125.2998
K.GISLFVVPK.F +230.1938
K.IFISAGEHDMADNIIHLVLAR.I +239.568748.936639.7926
K.IFISAGEHDMADNIIHLVLAR.I +375.556462.310966.080472.4055
K.VAQDKIAAEGAKPFLTR.K +243.8407
M.TIYKAPVEEVGFLLNDVFQFDR.Y +234.322136.604544.0145
M.TIYKAPVEEVGFLLNDVFQFDRYNNLPGFADAAADVR.D +352.455952.1648
R.ALVLWTALK.S +253.5963
R.DAIINEAAR.L +126.8727
R.DAIINEAAR.L +253.985936.3161
R.LSEEVLHPLNGVGDHEGCTR.H +354.512661.1489
R.YNNLPGFADAAADVR.D +239.321
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA081754.757.278.668.979.9RPA0817 probable acyl-CoA thiolase 911818:913026 forward MW:42217
K.ADGSLHEVTALALATVPLK.A +130.373234.648837.370130.9872
K.ADGSLHEVTALALATVPLK.A +276.419378.168784.00581.8188
K.ADGSLHEVTALALATVPLK.A +361.900749.5582
K.ADGSLHEVTALALATVPLKALK.E +251.748769.905374.902172.5642
K.ADGSLHEVTALALATVPLKALK.E +362.368269.562574.494662.597
K.ADGSLHEVTALALATVPLKALKER.N +246.813161.7745
K.AGLGEAVPGIQISR.F +145.639140.633253.112428.5926
K.AGLGEAVPGIQISR.F +245.77450.409446.652442.237
K.DEHMRPSTTMQSLAQLQPSFAPIAAMGGFDAVAIQSHPEVEK.V +356.1868
K.ERNNLKQDVVDDVVMGVVDPVGEAGSDIAR.F +362.247176.738352.038
K.IRAFANIGSEPAMMLTGPVDVTNKLFER.S +234.5078
K.IRAFANIGSEPAMMLTGPVDVTNKLFER.S +351.891359.310891.411164.9596
K.SVVPVKDINGLTILAK.D +134.3332
K.SVVPVKDINGLTILAK.D +237.757437.4537
K.SVVPVKDINGLTILAK.D +345.2582
K.VNYVHHAGNSSGIVDGAGAVLLGSK.E +247.77773.956474.683163.3998
K.VNYVHHAGNSSGIVDGAGAVLLGSK.E +371.746646.559453.5178
K.VNYVHHAGNSSGIVDGAGAVLLGSKEAGEK.H +234.8879
K.YGFSRDDVDAYAVR.S +129.1077
K.YGFSRDDVDAYAVR.S +240.834651.936234.513848.478
K.YGFSRDDVDAYAVR.S +370.882452.571366.719255.1447
M.PEAYIYDHVR.T +132.543729.771629.0036
M.PEAYIYDHVR.T +248.47857.217558.293958.4513
M.PEAYIYDHVR.T +358.692153.4201
R.AFANIGSEPAMMLTGPVDVTNK.L +259.153460.797664.886860.5862
R.AFANIGSEPAMMLTGPVDVTNKLFER.S +242.583848.198250.076839.1495
R.AFANIGSEPAMMLTGPVDVTNKLFER.S +349.156353.540950.513346.7168
R.DDVDAYAVR.S +128.768431.786630.3367
R.DDVDAYAVR.S +255.453755.0563
R.FCASGLDAVNFAAAQIMSGQHELVIGGGAESMSR.I +236.29234.1934
R.FCASGLDAVNFAAAQIMSGQHELVIGGGAESMSR.I +348.980354.718965.5441
R.GKADGSLHEVTALALATVPLK.A +264.911262.106884.641479.0371
R.GKADGSLHEVTALALATVPLK.A +364.260253.919445.6747
R.GKADGSLHEVTALALATVPLKALK.E +253.947737.713562.667749.9207
R.GKADGSLHEVTALALATVPLKALK.E +351.403872.974
R.GKADGSLHEVTALALATVPLKALKER.N +239.703743.6493
R.GRGKADGSLHEVTALALATVPLK.A +238.2983
R.IGIGASGGAWPMDPSMAIPSYFMPQGISADLIATK.Y +242.541638.85542.882941.8683
R.IGIGASGGAWPMDPSMAIPSYFMPQGISADLIATK.Y +356.711777.59163.81755.7803
R.NNLKQDVVDDVVMGVVDPVGEAGSDIAR.F +267.933375.196776.017270.5011
R.NNLKQDVVDDVVMGVVDPVGEAGSDIAR.F +383.026494.6181100.199.2467
R.YMQAFEIDNDKINVNGGAIALGHPLGATGAMILGTVLDELER.T +357.858869.998954.0317
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA081840.945.455.747.665.3RPA0818 probable 3-hydroxyacyl-CoA dehydrogenase 913151:915367 forward MW:80102
K.AHCQSVIDGLIK.K +130.8332
K.ALKLVDAVVPAADLIK.T +135.663235.671744.537141.4556
K.ALKLVDAVVPAADLIK.T +242.129448.79259.603359.3173
K.AQPLLKEGAIFASNTSTLPINSLAEEFKDQSK.F +354.318473.721274.7279
K.ATEADLGEQAVDQQQK.K +130.813346.075849.158842.0014
K.ATEADLGEQAVDQQQK.K +264.940460.8862
K.ATEADLGEQAVDQQQKK.L +142.277339.736433.9259
K.ATEADLGEQAVDQQQKK.L +252.743148.379654.634964.291
K.ATEADLGEQAVDQQQKK.L +350.1067
K.DAFCAGADLSMLESMNQQFAQIRK.D +239.9049
K.EFVALCHKLEGK.F +132.7983
K.EGAIFASNTSTLPINSLAEEFKDQSK.F +348.269849.5902
K.FIGIHFFSPVEK.M +146.873738.666748.207648.7087
K.FIGIHFFSPVEK.M +261.079850.459651.029837.9595
K.GFKLPGGQVFSK.Q +125.160129.760735.7685
K.GFYVYPEK.G +132.5202
K.GFYVYPEKGKGQK.S +130.7906
K.GVVITSAK.D +126.091827.895
K.HLDPDTIDVEELK.Q +149.449637.718538.6215
K.HLDPDTIDVEELK.Q +264.263755.664465.292557.8817
K.HLDPDTIDVEELKQR.F +136.606832.1783
K.HLDPDTIDVEELKQR.F +251.957162.580565.2602
K.HLDPDTIDVEELKQR.F +383.487977.238178.967777.5605
K.IMKATEADLGEQAVDQQQKK.L +252.968568.3622
K.KLMVELVEK.Q +135.977830.6545
K.LLEDMAK.T +131.943231.199326.531128.6424
K.LLEDMAK.T +233.462
K.LMVELVEK.Q +126.674427.113928.2734
K.LVDAVVPAADLIK.T +143.543647.233543.2945.014
K.LVDAVVPAADLIK.T +256.760563.822151.742651.7103
K.MAGMPVGPLSLADEVALDLILK.I +270.288468.879276.142773.7404
K.MAGMPVGPLSLADEVALDLILK.I +387.221180.31791.573579.7097
K.MLFDESR.K +132.612932.686337.068232.0975
K.MLFDESR.K +240.288136.6346
K.NGKGFYVYPEKGKGQK.S +138.3566
K.QGMMMFPAGNAIYR.R +235.9737
K.SLWDGIAALQPK.H +137.963237.895137.025733.1056
K.SLWDGIAALQPK.H +266.007864.031458.466560.054
K.SMNVLDAATIEELGAIAEATTK.D +282.737161.397853.958186.6607
K.SMNVLDAATIEELGAIAEATTKDAAVK.G +242.461132.166552.557546.1704
K.SMNVLDAATIEELGAIAEATTKDAAVK.G +351.431251.443356.2361
K.SMNVLDAATIEELGAIAEATTKDAAVKGVVITSAK.D +233.748233.0675
K.SMNVLDAATIEELGAIAEATTKDAAVKGVVITSAK.D +347.342853.602771.4668
K.VGLFPGGGGTQR.I +233.5856
K.VGLFPGGGGTQRIPR.I +231.629533.0271
R.AIMSCVYEGLLVPIDVALR.I +235.2117
R.AKEADRDALMSR.I +128.243425.424627.2126
R.AKEADRDALMSR.I +233.1535
R.EADVGSILGFGFAPFTGGTLSYIDFMGTK.E +236.490333.9932
R.FLAVQAVEAAR.T +126.796135.613641.3819
R.FLAVQAVEAAR.T +272.614771.279852.929465.2208
R.FTAEGLEMLMEGVPAPMIETAAK.M +253.138851.047148.703151.1745
R.FTAEGLEMLMEGVPAPMIETAAK.M +348.7294
R.FTPPKLLEDMAK.T +134.22429.629
R.FTPPKLLEDMAK.T +233.2117
R.ITATPDFNAISDCDLVIEAVFEDR.K +239.744740.288
R.IVDPQNAMTILLK.G +128.557727.2602
R.IVDPQNAMTILLK.G +250.254763.929832.834457.9703
R.IVDPQNAMTILLKGDQIKLDK.A +239.986147.3949
R.QIGKTPIVVNDSR.G +235.689734.110238.140932.3404
R.SLFLSMQELNK.G +139.178433.101735.6577
R.SLFLSMQELNK.G +252.985557.020155.4766
R.SLFLSMQELNKGAR.R +236.0971
R.TVEDNVIVDPR.E +261.416452.479742.3889
R.YFAHVLQTK.E +140.34139.737537.788131.336
R.YFAHVLQTK.E +248.935641.078146.5557
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA084222.628.137.342.942.9RPA0842 conserved unknown protein 936587:937240 forward MW:22834
K.SLFGSSEKDQAPTVSNGPPVESQLTCPSVTVR.S +232.250438.8038
R.ECNLNTGVITAK.I +125.482531.0797
R.IIAGPAGAPTSVDVPLR.V +258.359654.26668.082851.5027
R.IIAGPAGAPTSVDVPLRVAVVQEGVSPK.T +237.475941.951546.233446.0854
R.IIAGPAGAPTSVDVPLRVAVVQEGVSPK.T +351.328654.0446.8899
R.SGASTYAVGLPGKEASGSDLR.Y +238.778454.770450.36149.0444
R.SGASTYAVGLPGKEASGSDLR.Y +345.932750.5527
R.VAVVQEGVSPK.T +131.0422
R.VAVVQEGVSPK.T +231.8118
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA084348.552.141.149.157.1atpF1 putative Fo ATP synthase B chain 937373:937864 reverse MW:17586
K.AKLEDFVAR.R +128.484634.965432.906530.4446
K.AKLEDFVAR.R +243.540.177638.1201
K.GNLADELLSK.G +131.199630.0286
K.GNLADELLSK.G +240.359352.205543.781240.7999
K.GNLADELLSKGIQEVR.G +345.284248.0388
K.IALAEAQALADVR.A +135.904132.674134.541335.1501
K.IALAEAQALADVR.A +276.107182.786473.885365.082
R.AAAAEAAVAAASR.I +133.71534.215943.0712
R.AAAAEAAVAAASR.I +267.125273.3681
R.ASAEREAQAIVDSAK.A +240.137543.208546.2213
R.ASAEREAQAIVDSAKADAER.I +230.3381
R.ASAEREAQAIVDSAKADAER.I +378.596286.9321
R.EAQAIVDSAK.A +144.892444.8713
R.EAQAIVDSAKADAER.I +125.713
R.EAQAIVDSAKADAER.I +247.632846.020148.4834
R.IAAEAK.A +129.1412
R.ILSESVKGNLADELLSK.G +138.804544.249641.382540.1163
R.ILSESVKGNLADELLSK.G +266.748169.775472.670363.3484
R.ILSESVKGNLADELLSK.G +362.237556.333447.176150.8585
R.ILSESVKGNLADELLSKGIQEVR.G +273.36770.0948
R.ILSESVKGNLADELLSKGIQEVR.G +359.306177.9676
R.KLKDEAAK.L +135.1223
R.RASAEREAQAIVDSAKADAER.I +233.4244
R.RASAEREAQAIVDSAKADAER.I +357.773966.4321
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA084440.550.841.135.156.8atpF2 putative FoF1 ATP synthase, subunit B' 937870:938427 reverse MW:19190
K.AVDSAVDASLKG.- +138.34632.878835.684228.3049
K.AVDSAVDASLKG.- +239.010147.895636.0643
K.AYEAELADAR.A +125.976427.3325
K.LADAEK.T +125.1326
K.LADAEKTIATTR.T +237.689731.4668
K.LKGEADDALKAYEAELADAR.A +268.966465.135185.537686.2888
K.LKGEADDALKAYEAELADAR.A +370.976761.411583.512779.8796
K.TIDGDLAAAQK.L +128.795435.6862
K.TIDGDLAAAQKLKGEADDALKAYEAELADAR.A +348.628169.035867.5661
R.AQAIGAETR.E +127.835728.0402
R.EKLNAQAEAERKTLEQR.L +238.8348
R.NIASDAASAIVQQLAGVTPDSK.A +266.121472.787968.486869.0353
R.NIASDAASAIVQQLAGVTPDSK.A +365.776877.982378.6873
R.NIASDAASAIVQQLAGVTPDSKAVDSAVDASLKG.- +245.440539.6265
R.NIASDAASAIVQQLAGVTPDSKAVDSAVDASLKG.- +377.175480.2141
R.QKTIDGDLAAAQK.L +230.8874
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA085239.631.636.940.943.6RPA0852 two-component transcriptional regulator, LuxR family 944214:944891 forward MW:24190
K.IGEVGSFEDLTAMLER.E +268.0361.231758.931863.8586
K.MPGISGFSGLIYLR.A +236.395546.688730.191830.0584
K.RFGVEK.L +129.0467
M.STPASTHLIIADDHPLFR.D +243.658257.07836.095853.7063
R.EGDVDLVLLDLK.M +139.295127.134138.7901
R.EGDVDLVLLDLK.M +240.2927
R.LAVASVVSSAK.I +126.2711
R.LAVASVVSSAK.I +251.994949.890941.965849.1835
R.SLDFGASGFVPK.R +125.468827.8327
R.SLDFGASGFVPK.R +241.036355.064843.336641.164
R.TQAVIAAAK.I +132.3756
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA085433.529.121.05.933.7hemO 5-aminolevulinic acid synthase (ALAS) 948749:949978 reverse MW:44754
-.MQYNQFFQDALTR.L +260.596636.469443.2294
K.ASDLLLEQHNIYIQPINYPTVAR.G +267.025368.266861.710554.3169
K.ASDLLLEQHNIYIQPINYPTVAR.G +350.146550.6956
K.AVLNNAGIPVMPTDTHIVPVFVGDAEK.C +234.908
K.KASDLLLEQHNIYIQPINYPTVAR.G +246.911534.865834.9945
K.LIAFESLYSMDGDTAPLAK.I +243.9279
K.VVGAMVETATR.I +264.2147.7537
R.HNDTAHLEELLIAAGPDRPK.L +270.971247.140537.1516
R.HNDTAHLEELLIAAGPDRPK.L +361.0029
R.NIAGTHHPLVQLEQEIASLHGK.E +239.390333.0294
R.VKAVLNNAGIPVMPTDTHIVPVFVGDAEK.C +358.416255.778145.9574
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA086526.114.74.811.126.1RPA0865 homospermidine synthase 961340:962770 reverse MW:53002
K.AKNPGGTTAVSTCGANPGMVSWFVK.Q +258.122155.31336.2538
K.AKNPGGTTAVSTCGANPGMVSWFVK.Q +359.1934
K.HTEGCQAAIYLLQPGANTR.V +248.7687
K.ITGPIVMIGFGSIGK.G +149.711740.479743.765851.6067
K.ITGPIVMIGFGSIGK.G +251.377541.656845.2895
K.ITGPIVMIGFGSIGKGALPLIER.H +238.474530.4212
K.ITGPIVMIGFGSIGKGALPLIER.H +356.318649.759
K.WHILDENEIVDGIDELGVLVYGHAK.N +260.5485
K.WHILDENEIVDGIDELGVLVYGHAK.N +350.3379
R.DTGLEFNEPK.S +132.2468
R.DTGLEFNEPK.S +235.2948
R.EGWGQLAQK.L +126.236626.7777
R.SNYALRETLLAAK.A +244.983248.533837.9387
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA086758.655.521.948.458.6RPA0867 Endoribonuclease L-PSP 963579:963965 reverse MW:13914
K.DADAVFAVCGEHLGEIRPAATIVAVAGLYKPEMK.I +359.491459.066671.665
K.EAGFAMEDIVR.A +230.1675
K.TIGAALKEAGFAMEDIVR.A +247.835133.277367.8183
K.TIGAALKEAGFAMEDIVR.A +369.7395
R.ATYYITDPK.D +127.7816
R.ATYYITDPK.D +243.03740.4256
R.LISTGSPFEK.T +132.772731.00933.081930.5027
R.LISTGSPFEK.T +239.171436.055735.9123
R.NCFKTIGAALKEAGFAMEDIVR.A +230.6604
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA088738.149.543.635.156.7exoN UTP-glucose-1-phosphate uridylyltransferase 984555:985430 reverse MW:32230
K.EMLTIVDRPLIQYVVDEAR.E +234.787236.737237.596235.0919
K.EMLTIVDRPLIQYVVDEAR.E +356.429454.3954
K.LGDKANVIAVEEVPADKTHQYGICGVGKR.D +350.2294
K.MFEIDGMVEKPAPGTAPSNLSISGR.Y +241.544550.459649.847551.2815
K.MFEIDGMVEKPAPGTAPSNLSISGR.Y +352.311565.043158.7469
R.AGLIEDMKR.Y +230.009
R.DIVGNEPFAVVLPDELVLNTPGCLK.Q +255.200959.826146.958947.4529
R.DIVGNEPFAVVLPDELVLNTPGCLK.Q +351.0703
R.EAGIEHFVFVTGR.N +131.5361
R.EAGIEHFVFVTGR.N +234.428137.1501
R.GAGGEIQLTDAMIGLSK.T +128.966238.3637.902642.1726
R.KAVFPVAGLGTR.V +231.4774
R.YILQPEIFQILATQER.G +126.489825.368128.132727.3073
R.YILQPEIFQILATQER.G +262.229880.669971.375869.0926
R.YILQPEIFQILATQER.G +363.004983.6521
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA089226.435.713.214.937.8gltD glutamate synthase (NADPH) small chain 993473:994927 forward MW:51807
K.NYNEFVVPLSEK.D +137.7629
K.QYDAVALTGGAEAPR.D +247.322543.572638.6756
K.SVTQIEIMPAPPERENK.A +237.969344.089938.029
K.TGQSVAVVGAGPAGLACAQQLAR.A +258.432762.848641.3105
K.TGQSVAVVGAGPAGLACAQQLAR.A +352.6099
R.AGHDVHVYEK.F +130.5761
R.FLMGATTLPR.- +240.793449.9589
R.GNVAADLSHFTTSVDKVFAAGDMR.R +248.801142.2779
R.GNVAADLSHFTTSVDKVFAAGDMR.R +345.128655.5195
R.GQSLVVWAIR.E +241.3181
R.TLHSTNNFPEFTGR.I +135.2038
R.TLHSTNNFPEFTGR.I +234.849749.7108
R.VAQMEAEGVTFHYGAPVGGSAPGAVDPAELLK.Q +231.817255.192746.04443.3339
R.VAQMEAEGVTFHYGAPVGGSAPGAVDPAELLK.Q +351.672457.340455.535546.8342
R.VSGEAVNGTDILAAGK.N +247.396
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA091526.826.850.331.656.9RPA0915 putative NADPH quinone oxidoreductase 1017873:1018871 reverse MW:34576
-.MEPIPSQMTVVGISKPGGPEVLLPETR.D +256.599250.523657.705147.9137
-.MEPIPSQMTVVGISKPGGPEVLLPETR.D +345.541557.66471.894270.1294
K.VAAAGVNRPDVAQR.S +238.8858
K.VITTVGSQDKADACLK.L +246.6651
K.VLPLLEQGR.I +234.020937.0369
K.VPAAYSMIEAGATPETLMTVWHNVFER.G +349.938863.215155.529453.4335
R.AINYKTEDFVAAVK.E +235.2837
R.DVPKPGPGEILVK.V +235.6522
R.IKPLIDGTFALR.D +130.18
R.IKPLIDGTFALR.D +231.0651
R.IVQIAFLGGAK.A +129.589825.369242.326638.8548
R.IVQIAFLGGAK.A +232.354936.615339.8101
R.SGSYPPPPGASDLPGLEIAGEVVALGDGASR.H +247.0933
R.SNADKAAMVAAIEAK.V +134.112248.63743.698640.1833
R.SNADKAAMVAAIEAK.V +245.9668
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA091886.776.053.376.086.7RPA0918 possible 50S ribosomal protein L31 1020328:1020555 reverse MW:8567
-.MKTEIHPDYHTITVVMTDGTEYQTR.S +248.64465.267567.687257.5824
-.MKTEIHPDYHTITVVMTDGTEYQTR.S +353.625556.231
K.EGDKLNLDIDPK.S +126.2345
K.FSGFLKKD.- +126.0675
K.SHPAWTGGTQQVLDR.G +126.490329.444426.7668
K.SHPAWTGGTQQVLDR.G +258.18157.224448.616753.3909
K.SHPAWTGGTQQVLDR.G +346.733159.2836
R.STWGKEGDKLNLDIDPK.S +132.183226.8028
R.STWGKEGDKLNLDIDPK.S +246.947733.405
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA093243.130.919.919.943.1RPA0932 conserved unknown protein 1032245:1032790 forward MW:19632
K.ESVAWFGPLAAPIER.I +236.9878
R.DIEIDGDMEAVVALR.N +236.0783
R.NAIDDSRVDFLKESVAWFGPLAAPIER.I +349.256
R.SLVGAQPGYREELGVGGGG.- +147.707949.480232.367334.5715
R.SLVGAQPGYREELGVGGGG.- +251.633358.8386
R.VDFLKESVAWFGPLAAPIER.I +233.625
R.YGLAPTDLPIAFVLEPR.R +126.9623
R.YGLAPTDLPIAFVLEPR.R +267.8861.558466.070567.5544
R.YGLAPTDLPIAFVLEPR.R +367.302748.0832
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA093347.433.517.218.248.3RPA0933 putative protease, putative 1032794:1033771 forward MW:35195
-.MELICPAGTPAALHDAVAAGADAIYCGFNDETNAR.N +247.777538.9794
-.MELICPAGTPAALHDAVAAGADAIYCGFNDETNAR.N +352.979958.5652
K.TFKDVLAALDDGRPLPVDALR.G +235.961441.147848.7079
K.TFKDVLAALDDGRPLPVDALR.G +358.603454.6002
R.AAGVAALKIEGR.Q +238.853651.9615
R.AVDDAVEAEADALILADVGVMDYCAK.T +237.5889
R.FYVDSFNAQR.V +238.1538
R.LGEFTINK.F +128.86633.1957
R.LGEFTINKFAK.G +126.963629.048
R.LGEFTINKFAK.G +241.262733.549830.8528
R.VLSVQEIAAITK.E +237.0137
R.VVKTFKDVLAALDDGRPLPVDALR.G +347.2252
R.YQTDEGCGYLFEDPASLDATTMLPDLR.A +244.317148.335748.332462.6973
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA093716.428.214.510.334.4RPA0937 extragenic suppressor protein SuhB; Inositol monophosphatase family 1037232:1038020 reverse MW:28472
-.MIHSALINVMVK.A +142.375541.415446.82940.0253
-.MIHSALINVMVK.A +237.7455
K.ARPGYGFLGEEGGVR.E +240.117
R.AEEMLYEDLSK.A +133.065533.5518
R.DFGEIENLQVSLKGPANFVSR.A +233.8439
R.EAGGTVGDINGGDVLK.T +242.446
R.NLSPWDIAAGIVMIR.E +233.011140.843244.1166
R.NLSPWDIAAGIVMIR.E +374.530547.7223
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA093915.115.126.915.126.9RPA0939 possible thiamine-phosphate pyrophosphorylase 1039233:1039892 reverse MW:22550
K.LLAAADIAAVLLR.L +268.787230.288654.803358.6587
R.IKAVAPVVQAGGAALLVDGHADLVAR.G +232.2792
R.LYLATPVTADPAALAAALPK.L +255.320456.062846.732451.8811
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA094056.467.262.264.280.2RPA0940 fructose-bisphosphate aldolase 1039898:1040932 reverse MW:37250
-.MNLADLNQIAR.A +126.344827.041532.875434.7051
-.MNLADLNQIAR.A +255.487158.873156.253252.3689
K.ACVPSAVPGIAFLSGGQSDEEATAHLDAMNK.I +242.616435.4484
K.AENVAAGQAAFTHR.A +131.3108
K.AENVAAGQAAFTHR.A +278.418172.266472.762173.0121
K.AENVAAGQAAFTHR.A +360.507159.104
K.GEWSAELETK.K +129.993133.469735.204932.6161
K.GILAADESSGTIK.K +132.883626.3894
K.GILAADESSGTIKK.R +230.8626
K.GILAADESSGTIKKR.F +233.080731.2127
K.IGGLPWGLTFSYGR.A +133.271725.551431.5115
K.IGGLPWGLTFSYGR.A +246.473658.542750.929345.4552
K.KASVQEVAEK.T +129.703433.343940.1182
K.LIEQAGSIPGIK.V +129.986127.0758
K.LIEQAGSIPGIK.V +240.497243.8101
K.LIEQAGSIPGIKVDEGTQPLPNCPGETITVGLDK.L +352.825657.377
K.LIEQAGSIPGIKVDEGTQPLPNCPGETITVGLDKLAER.L +346.517457.020746.6962
K.VDEGTQPLPNCPGETITVGLDK.L +233.072536.351
K.VDEGTQPLPNCPGETITVGLDKLAER.L +237.682133.427235.7334
R.ALQAAPQKAWSGKAENVAAGQAAFTHR.A +372.0839
R.AMVAPGKGILAADESSGTIK.K +231.536130.455956.7851
R.AMVAPGKGILAADESSGTIK.K +362.273569.7338
R.AVIDIDTAR.G +127.486430.828228.2753
R.AVIDIDTAR.G +238.656140.1421
R.GVPSHTAIMTNAHALAR.Y +128.407138.471740.1469
R.GVPSHTAIMTNAHALAR.Y +266.29958.846654.505154.9072
R.GVPSHTAIMTNAHALAR.Y +353.486755.50949.2698
R.SKEAMSDYVSGVILYDETIWQNAADGTPLVK.L +245.968858.152462.556256.6041
R.SKEAMSDYVSGVILYDETIWQNAADGTPLVK.L +354.69957.702155.328
R.VALEGMILKPNMAVPGK.K +347.9099
R.VALEGMILKPNMAVPGKK.S +250.364546.204462.202840.2543
R.VALEGMILKPNMAVPGKK.S +354.345970.9315
R.YAALCQQAQIVPIVEPEVLMDGAHDIDTCYNITEWVLK.E +349.7939
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA094353.062.165.666.367.1cbbK phosphoglycerate kinase 1041690:1042886 reverse MW:41884
K.AIAAMADGDILCLENTRFHPEEEKNDPAFVAK.L +354.077362.6839
K.ALEAPVKPVIAIVGGAK.V +137.730644.807841.463636.7096
K.ALEAPVKPVIAIVGGAK.V +263.962957.786761.647466.0166
K.ALEAPVKPVIAIVGGAK.V +377.900276.995874.886167.0993
K.DLAPTALR.I +125.059229.3784
K.GRDDKNSLKPVAAALADVIKKPVGFADDCIGEPAAK.A +362.584573.072668.0275
K.IDLLENLVTK.V +128.584231.443833.546330.9783
K.IDLLENLVTK.V +259.195365.465256.83159.1724
K.IDLLENLVTKVQALVIGGGMANTFLHAQGVK.V +360.568761.551647.9373
K.KPVGFADDCIGEPAAK.A +255.9815
K.LAELGDIWVNDAFSAAHR.A +257.493964.467160.753169.2289
K.LAELGDIWVNDAFSAAHR.A +358.401561.792777.329967.5075
K.NSLKPVAAALADVIKKPVGFADDCIGEPAAK.A +349.8385
K.SLCEKDLAPTALR.I +136.765941.232840.234938.1532
K.SLCEKDLAPTALR.I +260.266954.283648.870145.4478
K.SLCEKDLAPTALR.I +349.1985
K.VILLAHFGRPK.G +130.1338
K.VILLAHFGRPK.G +251.368944.789440.926455.1182
K.VQALVIGGGMANTFLHAQGVK.V +286.19366.710978.773780.7411
K.VQALVIGGGMANTFLHAQGVK.V +366.554675.961272.148865.0843
K.VSTKIDLLENLVTK.V +134.534239.465139.1456
K.VSTKIDLLENLVTK.V +241.855.554232.737649.353
K.VSTKIDLLENLVTK.V +352.5105
R.AHATTEGLGHKLPAYAGR.T +131.122532.816146.829630.7436
R.AHATTEGLGHKLPAYAGR.T +273.396373.821268.725772.3051
R.AHATTEGLGHKLPAYAGR.T +357.098355.824354.2461
R.FHPEEEKNDPAFVAK.L +144.145747.932139.9647
R.FHPEEEKNDPAFVAK.L +234.717936.428350.636437.3263
R.FHPEEEKNDPAFVAK.L +350.0289
R.IHAAIDDAATLVWNGPVGAFELTPFDKGTVEAAK.H +232.5156
R.IHAAIDDAATLVWNGPVGAFELTPFDKGTVEAAK.H +351.624957.573952.029
R.TLDDVDVK.G +141.131237.841539.366436.2812
R.TLDDVDVKGKR.V +129.902634.6844
R.TMQAELVALNK.A +134.409733.506534.986736.4047
R.TMQAELVALNK.A +271.8669.947363.960865.9776
R.TMQAELVALNKALEAPVKPVIAIVGGAK.V +347.3892
R.VDLNVPMDAGK.V +136.756439.413541.113538.8396
R.VDLNVPMDAGK.V +230.169746.778843.509447.7733
R.VDLNVPMDAGKVTDTTR.L +241.25432.649750.888751.5404
R.VDLNVPMDAGKVTDTTR.L +346.7068
R.VMPTITELSGK.G +136.93139.515234.115737.8888
R.VMPTITELSGK.G +233.400332.153536.9707
R.VMPTITELSGKGAK.V +141.315138.5173
R.VMPTITELSGKGAK.V +239.9454
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA094483.391.696.194.997.9cbbG glyceraldehyde-3-phosphate dehydrogenase(GAPDH) 1043108:1044115 reverse MW:35956
K.AATLLTAGAK.R +134.109525.243828.944629.1433
K.AATLLTAGAK.R +236.806741.602
K.AATLLTAGAKR.V +241.815938.700839.224439.6182
K.AIGLVLPELK.G +139.912939.562238.420937.5478
K.AIGLVLPELK.G +253.334253.83849.152949.9548
K.AIGLVLPELKGK.L +131.340436.0838
K.AIGLVLPELKGKLDGVAIRVPTPNVSVVDLK.I +355.120146.4596
K.ATTKEEINEAIKR.A +134.351233.372139.67743.5861
K.ATTKEEINEAIKR.A +257.936547.925657.707759.7097
K.ATTKEEINEAIKR.A +351.946549.835748.130360.7714
K.DHMVVSNGSCTTNCLAPVAK.V +277.855177.414155.087665.826
K.DIEVVAINDLGPVETNAHLLR.F +264.193868.379176.505385.9932
K.DIEVVAINDLGPVETNAHLLR.F +358.784470.296163.6913
K.EEINEAIKR.A +125.027631.918125.746
K.EEINEAIKR.A +233.582237.128941.1734
K.GILGYTNAPNVSIDFNHDPHSSTFHMDQTK.V +350.477761.978259.981759.0849
K.GILGYTNAPNVSIDFNHDPHSSTFHMDQTKVQNGTLVR.V +350.986154.423553.2583
K.GKLDGVAIR.V +244.220744.070934.4815
K.GKLDGVAIRVPTPNVSVVDLK.I +260.150569.494762.436963.9019
K.GKLDGVAIRVPTPNVSVVDLK.I +370.702876.652975.017884.6184
K.IIAKK.A +126.057625.4791
K.IKVTAIKDPSALPYK.E +135.5114
K.IKVTAIKDPSALPYK.E +239.9275
K.IKVTAIKDPSALPYKEVGVDIALECTGIFTAR.D +234.071932.6228
K.IKVTAIKDPSALPYKEVGVDIALECTGIFTAR.D +374.8515
K.KATTKEEINEAIK.R +132.5628
K.KATTKEEINEAIKR.A +144.238542.425244.897747.4042
K.KATTKEEINEAIKR.A +251.911348.122764.772953.837
K.KATTKEEINEAIKR.A +347.4301
K.LDGVAIRVPTPNVSVVDLK.I +251.144647.796661.834244.4611
K.LDGVAIRVPTPNVSVVDLK.I +361.182
K.RVLVSAPSDGADATIVYGVNHETLSK.D +238.919851.54653.1443
K.RVLVSAPSDGADATIVYGVNHETLSK.D +374.585446.982681.651962.5257
K.RVLVSAPSDGADATIVYGVNHETLSKDHMVVSNGSCTTNCLAPVAK.V +345.318
K.VDGDTIDAGR.G +125.475627.767
K.VDGDTIDAGR.G +249.7041
K.VDGDTIDAGRGK.I +129.432736.126836.8069
K.VLNDTVGIETGFMTTIHAYTGDQPTLDTMHKDLYR.G +345.66856.862776.893957.0945
R.AAAMSMIPTSTGAAK.A +143.338135.103739.563636.8503
R.AAAMSMIPTSTGAAK.A +258.713854.475261.151361.7492
R.AAEQELK.G +127.585929.986927.8283
R.AAEQELKGILGYTNAPNVSIDFNHDPHSSTFHMDQTK.V +346.7492
R.AIYESGRK.D +230.4125
R.AIYESGRKDIEVVAINDLGPVETNAHLLR.F +245.551145.737245.637551.0863
R.AIYESGRKDIEVVAINDLGPVETNAHLLR.F +376.058586.3838113.07109.928
R.DKAATLLTAGAK.R +146.572242.531644.697743.0821
R.DKAATLLTAGAK.R +256.045353.282151.613456.4036
R.DKAATLLTAGAKR.V +133.072931.925333.874429.825
R.DKAATLLTAGAKR.V +264.744469.433762.986165.8648
R.DKAATLLTAGAKR.V +371.168463.502658.103768.4237
R.FDSVHGRFPFEVK.V +135.000827.736626.5605
R.FDSVHGRFPFEVK.V +247.472345.57352.04949.3983
R.FDSVHGRFPFEVK.V +354.732549.348947.8509
R.FDSVHGRFPFEVKVDGDTIDAGR.G +239.208339.7067
R.FDSVHGRFPFEVKVDGDTIDAGR.G +348.6339
R.FDSVHGRFPFEVKVDGDTIDAGRGK.I +231.836837.1608
R.FDSVHGRFPFEVKVDGDTIDAGRGK.I +368.659578.469872.1411
R.FPFEVK.V +133.5495
R.FPFEVKVDGDTIDAGR.G +239.1654
R.FPFEVKVDGDTIDAGRGK.I +234.0822
R.GRAAAMSMIPTSTGAAK.A +230.9398
R.KDIEVVAINDLGPVETNAHLLR.F +269.414171.461168.82276.2564
R.KDIEVVAINDLGPVETNAHLLR.F +390.324399.4295115.134105.695
R.MADTAVAIGK.L +140.125136.60333.964736.0734
R.MADTAVAIGK.L +254.614858.699957.576656.0195
R.MADTAVAIGKLI.- +140.61840.800639.4640.0464
R.MADTAVAIGKLI.- +251.035857.391940.665949.1345
R.NVLR.A +126.387629.1878
R.VAINGFGR.I +125.7008
R.VAINGFGR.I +244.025242.201433.889742.6835
R.VLVSAPSDGADATIVYGVNHETLSK.D +251.318655.152148.134751.0673
R.VLVSAPSDGADATIVYGVNHETLSK.D +347.959147.846
R.VLVSAPSDGADATIVYGVNHETLSKDHMVVSNGSCTTNCLAPVAK.V +347.308947.980152.0108
R.VMSWYDNEWGFSNR.M +125.92328.896832.8152
R.VMSWYDNEWGFSNR.M +258.660749.353953.266659.8284
R.VMSWYDNEWGFSNR.M +354.1017
R.VPTPNVSVVDLK.I +140.062548.40345.297241.0929
R.VPTPNVSVVDLK.I +258.116952.868238.439854.0861
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA09454.510.116.27.720.1cbbT2 transketolase 1044331:1046316 reverse MW:70382
K.AHGEPLGAEELAGAKK.A +134.8002
K.ALGWDYGPFEIPDDVLSAWR.N +232.38437.237942.173346.9683
K.LLEVQGVAAR.V +241.2034
R.KASELALEALTPVVPELLLGSADLTPSNNTR.V +236.018650.909837.4895
R.KASELALEALTPVVPELLLGSADLTPSNNTR.V +352.8653
R.VFRPADAVETAECWQLALENTNGPTLLALSR.Q +230.8256
R.VVSVPSLDLLLAQDDATR.A +235.6642
R.YIHYGIR.E +125.2559
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA095815.312.86.98.917.9RPA0958 putative acyl-CoA dehydrogenase 1059297:1061078 reverse MW:62131
K.GISLFLVPK.F +248.23
R.AIGSAGPGSDPIIKHPDVKR.T +240.520859.305
R.AYQQALAYAQER.K +258.161143.9257
R.FFAETVAVQAPALER.S +230.7554
R.GALLTPIAK.A +127.4495
R.IAPIYEGTNGIQAIDLVTR.K +267.063147.05342.100934.0164
R.YLLDKLGSDTNDALAGATPYLR.L +269.188149.414352.023353.3579
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA098542.657.968.769.583.3RPA0985 putative branched-chain amino acid transport system substrate-binding protein 1088146:1089318 forward MW:41577
K.AFLALLQK.G +137.341732.0367
K.AFLALLQK.G +244.281848.6403
K.ALAQELIVK.E +243.777433.6871
K.AYIDNGLK.A +125.1051
K.KVAIAVSDYGPGIDAETAFKK.T +259.343344.567268.7995
K.LGDVTMTSVAAYDGAR.L +234.089668.569839.9117
K.LINKEIETFKDQPDWGLVKQ.- +243.029949.592840.2603
K.LINKEIETFKDQPDWGLVKQ.- +367.29252.6398
K.LMSTGDVVTEPDLPNIGDSGIGILSTYHYAVSHDSPENK.A +358.5199
K.MGIDAWVAEHGNK.V +133.2425
K.MIEATGGKQDPEKAIAAVK.D +247.9144
K.SPYIVR.T +128.584225.9652
K.SPYIVR.T +233.88
K.TFEAEGGSVVEAVR.M +125.1966
K.TFEAEGGSVVEAVR.M +275.8312
K.VGGHTVEFVYRDEVSPNPAQSK.A +238.14341.028952.842339.3162
K.VGGHTVEFVYRDEVSPNPAQSK.A +347.261955.4608
K.VGVIGTMSGPYALFGQNFK.M +131.881836.585139.845
K.VGVIGTMSGPYALFGQNFK.M +262.297771.529162.256458.338
K.VPMVVLNAATSSITEK.S +262.248558.3441
K.VPMVVLNAATSSITEKSPYIVR.T +238.9817
K.VPMVVLNAATSSITEKSPYIVR.T +345.234752.773849.8479
K.VQYIAGLYFTPNAMAVAPLLQEAK.V +252.127349.966350.93941.8988
K.VQYIAGLYFTPNAMAVAPLLQEAKVPMVVLNAATSSITEK.S +348.645846.5102
R.GPVSIDPTTR.H +242.844738.499834.674937.4464
R.HITQSVYLR.E +126.467134.0999
R.HITQSVYLR.E +233.790631.169131.8967
R.IKDSGADMIFTFLPAGPPTLGFVK.A +262.293158.227664.143363.2732
R.IKDSGADMIFTFLPAGPPTLGFVK.A +347.743553.138450.6675
R.MPLATTDFGPIMQR.I +260.535464.770171.190868.9915
R.TSFTMFQNTVPAAK.V +246.367742.53958.543352.5634
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA100636.870.725.645.182.0RPA1006 possible protocatechuate 4,5-dioxygenase small subunit (AB035121) 1108128:1108529 forward MW:14155
K.FAGILGLNMQDIGALQTGMTVEQFK.A +230.4383
K.LLAAR.D +125.120125.0817
K.LLDEGGNAYYLAK.F +134.887838.763527.476529.0519
K.LLDEGGNAYYLAK.F +282.76576.239445.346463.1613
K.MCFSFNDAGAR.A +242.8351
R.AAFVKDEAAYCAR.Y +128.560238.503
R.AAFVKDEAAYCAR.Y +246.080761.44551.8835
R.AAFVKDEAAYCAR.Y +352.347557.908
R.AKREIFGTPIFGPESAQK.G +234.1829
R.DLLKLLDEGGNAYYLAK.F +243.1847
R.EIFGTPIFGPESAQK.G +140.912933.1547
R.EIFGTPIFGPESAQK.G +238.23435.0965
R.EIFGTPIFGPESAQKGYALNK.M +230.3214
R.YGLTAAQTEAILK.R +125.672134.0041
R.YGLTAAQTEAILKR.D +251.340146.25441.4404
R.YGLTAAQTEAILKR.D +352.478969.886
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA100747.740.040.028.456.5mhpB possible 2,3-dihydroxyphenylpropionate 1,2-dioxygenase 1108545:1109402 forward MW:31141
K.GLQKDPYWAPFFDGFDAPCR.W +235.935136.8628
K.GLQKDPYWAPFFDGFDAPCR.W +372.2713
K.MPTFAVGAAPEYR.N +245.605432.8621
K.VVVIGTGGLSHQLEGQR.A +233.6113
M.ATIIGGLAASHVPAIGGAMAK.G +128.9573
M.ATIIGGLAASHVPAIGGAMAK.G +252.031463.721559.798262.0334
M.ATIIGGLAASHVPAIGGAMAK.G +382.314382.576481.880253.0744
R.AHDIPTVPVVVNTVQHPLPSLR.R +233.4947
R.AIESYPEDLKVVVIGTGGLSHQLEGQR.A +248.841148.336633.792433.7117
R.AIESYPEDLKVVVIGTGGLSHQLEGQR.A +369.550558.687154.1552
R.GALTGDVHELHR.N +136.62436.6909
R.GALTGDVHELHR.N +263.001649.790651.7543
R.NYHLPISNTASGIMLIENRPK.L +264.149658.246749.346830.1073
R.NYHLPISNTASGIMLIENRPK.L +353.534462.993955.7331
R.WLEAAKPDAAVVIYNDHGLNFFLDK.M +353.3729
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA103711.611.617.216.825.5RPA1037 possible electron transfer flavoprotein dehydrogenases 1139064:1140722 forward MW:59954
K.VADMQLQK.T +130.8133
R.AITEGGYQSVPR.L +132.8749
R.AITEGGYQSVPR.L +251.044845.973240.6722
R.DSGVGKDLFR.V +231.6578
R.IKGVHNAIGSGMLAAEHVAAALAAGR.S +358.5111
R.LKQINPELSVVVVEK.G +128.339735.1584
R.LKQINPELSVVVVEK.G +236.038450.037637.9631
R.LKQINPELSVVVVEK.G +346.0689
R.LSSVFLSNTNHEEDQPVHLK.V +235.6877
R.LTFPGGALIGCAAGFVNVPR.I +260.178551.390974.212358.2963
R.LTFPGGALIGCAAGFVNVPR.I +353.536256.1044
R.SNDEPVDYENAWR.D +126.3458
R.YCPAAVYEWVEEPTGPR.F +134.7364
R.YCPAAVYEWVEEPTGPR.F +253.195547.792463.7243
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA104011.98.014.318.218.2RPA1040 octaprenyl-diphosphate synthase 1143914:1144924 reverse MW:36218
K.TALEQVVAFCLAR.S +242.02737.8796
M.AVIVPFEGPSTASIDQLVELVAADMER.V +267.659562.301464.57856.5888
M.AVIVPFEGPSTASIDQLVELVAADMER.V +352.503360.2454.1662
R.MLWGNEASVLVGDFLLGQAFR.M +253.068142.4583
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA105160.253.650.353.072.1RPA1051 pyruvate phosphate dikinase 1156005:1158746 forward MW:99423
K.AGDIITIDGGTGQVLAGK.M +125.37932.51141.894142.0041
K.AGDIITIDGGTGQVLAGK.M +271.191336.168633.588141.3688
K.AGKWVYTFGDGK.A +131.359142.0932
K.AGKWVYTFGDGKAEGR.A +130.9188
K.AGKWVYTFGDGKAEGR.A +258.464666.852347.8844
K.AGKWVYTFGDGKAEGR.A +358.2184
K.FGAEGIGLCR.T +244.0147
K.FGDAKNPLLVSVR.S +125.057429.44533.475529.0231
K.FGDAKNPLLVSVR.S +254.281958.112953.687839.7854
K.FGDAKNPLLVSVR.S +361.7322
K.GANLAEMANLGLPVPPGFTIPTSVCTYFYANGK.T +236.771939.6586
K.GFTLDTDLDADDWVDLVGQYKEAVAR.E +245.94837.641834.166742.6426
K.GFTLDTDLDADDWVDLVGQYKEAVAR.E +360.6634
K.GIFTVDPFVSVDRDGVGELVR.I +231.612930.2763
K.GIFTVDPFVSVDRDGVGELVR.I +347.406
K.KFGDAKNPLLVSVR.S +245.41730.5077
K.KFGDAKNPLLVSVR.S +351.0921
K.LSMEMAMPEAFKELTR.I +234.793
K.LSMEMAMPEAFKELTR.I +346.6043
K.LTNKKFGDAKNPLLVSVR.S +256.90145.842444.6201
K.LTNKKFGDAKNPLLVSVR.S +346.2168
K.MPMIEPELSGDFNTLMGWADEVR.K +258.696658.7194
K.MPMIEPELSGDFNTLMGWADEVRK.L +247.978241.4091
K.MPMIEPELSGDFNTLMGWADEVRK.L +347.138960.205164.909
K.NPLLVSVR.S +127.492330.450733.2596
K.NPLLVSVR.S +243.468441.1972
K.TYPKELQSQVER.A +129.1511
K.TYPKELQSQVER.A +254.172342.600639.174134.5694
K.WVYTFGDGKAEGR.A +245.538437.93
K.YQVGTMIELPR.A +131.6918
K.YQVGTMIELPR.A +251.144657.524642.4851
R.ADFVELFEIMK.G +136.292238.570438.286
R.ADFVELFEIMK.G +258.230559.686157.061957.7752
R.ADFVELFEIMKGLPVTVR.L +252.918960.124743.492433.376
R.ADFVELFEIMKGLPVTVR.L +371.531875.218349.204
R.AEFELVK.A +247.347734.264
R.AIFEAAVEAEKR.T +129.786125.4569
R.AIFEAAVEAEKR.T +262.218847.283753.458247.0314
R.AIFEAAVEAEKRTGEQVGLEVMVPLIATR.A +353.5262
R.ALDHVGKLTNKK.F +139.681
R.ALDHVGKLTNKKFGDAK.N +128.3553
R.ALDHVGKLTNKKFGDAK.N +246.6045
R.ALDHVGKLTNKKFGDAK.N +348.8673
R.ALDHVGKLTNKKFGDAKNPLLVSVR.S +265.7471.830660.380860.0442
R.ALDHVGKLTNKKFGDAKNPLLVSVR.S +372.170776.135680.906572.3331
R.ANMRDLLGGK.G +129.0743
R.ANMRDLLGGK.G +249.602138.8712
R.ARELAEFNPMLGFR.G +265.071260.433542.513146.0034
R.ARELAEFNPMLGFR.G +357.1018
R.ARELAEFNPMLGFRGCR.L +347.1642
R.ASMPGMMDTVLNLGLNDQTVEALAEK.S +256.814351.105249.892347.0123
R.ASMPGMMDTVLNLGLNDQTVEALAEK.S +375.407367.019481.3346
R.DDAASFLGTYIEK.G +143.841640.163945.178642.669
R.DDAASFLGTYIEK.G +279.12359.7809
R.DMQDMEFTIEQGKLWMLQTR.G +246.520553.661749.940556.7168
R.DMQDMEFTIEQGKLWMLQTR.G +348.12
R.DTGSNLKYQVGTMIELPR.A +231.582630.1443
R.DVIATGLPASPGAASGEIVFSSDEAAK.L +236.8751
R.ELAEFNPMLGFR.G +131.348334.583736.005935.6617
R.ELAEFNPMLGFR.G +253.710655.022157.263435.2261
R.EMILAEDEQSR.R +130.793636.2041
R.EMILAEDEQSRR.S +230.860931.8974
R.ETGEDFPQDPHAQLWGAIGAVFSSWMNAR.A +348.1645
R.GGMTSHAAVVAR.G +133.649633.109633.2841
R.GGMTSHAAVVAR.G +245.1405
R.GMGKPCVSGCGAIR.V +128.5935
R.GMGKPCVSGCGAIR.V +345.0181
R.GTMMIGNR.T +126.4369
R.IAVELANEGLINR.K +259.580833.2564
R.IAVELANEGLINRK.D +125.3614
R.IAVELANEGLINRK.D +248.585652.951955.144850.2743
R.IAVELANEGLINRK.D +347.1062
R.IAVELANEGLINRKDAVTR.I +230.5842
R.IAVELANEGLINRKDAVTR.I +347.622
R.IDATAQAVNRDTGSNLK.Y +252.139132.1286
R.IDATAQAVNRDTGSNLKYQVGTMIELPR.A +376.440464.490960.4536
R.IEPGSLDQLLHPTIDPNAK.R +237.535141.613647.084942.8134
R.IEPGSLDQLLHPTIDPNAKR.D +237.892239.176236.38836.012
R.IESGSDKLSMEMAMPEAFKELTR.I +262.340467.657763.78264.4161
R.IESGSDKLSMEMAMPEAFKELTR.I +361.959565.57368.950572.0584
R.IETSPEDIHGMHASEGILTTR.G +265.62660.545166.195165.8291
R.IETSPEDIHGMHASEGILTTR.G +353.20958.03558.483464.6501
R.IYTLLEK.H +128.909630.92629.299230.6108
R.IYTLLEK.H +238.232836.2164
R.LAAAQAALGK.G +133.221533.392434.994535.7502
R.LAAAQAALGK.G +240.347742.228140.6358
R.LAAAQAALGKGIASQA.- +162.428659.443154.4444
R.LAAAQAALGKGIASQA.- +265.577871.876156.3436
R.LAAAQAALGKGIASQA.- +358.310162.4765
R.LAIAYPEIAEMQAR.A +139.703632.64533.825741.4495
R.LAIAYPEIAEMQAR.A +258.193862.510941.841648.209
R.LLDPPLHEFLPHTQAEIEEVAR.A +245.408435.119842.4885
R.LLDPPLHEFLPHTQAEIEEVAR.A +371.554258.489977.471256.9031
R.LYGEFLINAQGEDVVAGIRTPQDITEHAR.I +345.5361
R.TAIKFGAEGIGLCR.T +139.553429.1009
R.TAIKFGAEGIGLCR.T +235.979743.3315
R.TAIKFGAEGIGLCR.T +367.066673.1339
R.TEHMFFEETR.I +128.548238.766629.717427.0668
R.TEHMFFEETR.I +245.2671
R.TFKAGDIITIDGGTGQVLAGK.M +235.1241
R.TGEQVGLEVMVPLIATR.A +137.422926.265830.91126.3265
R.TGEQVGLEVMVPLIATR.A +259.170260.05432.210840.9603
R.TPQDITEHAR.I +125.5936
R.VDYGRGTMMIGNR.T +238.428
R.VNADTPADAR.T +234.9821
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA10689.921.220.516.438.2RPA1068 Glycine cleavage T protein (aminomethyl transferase) 1177844:1178725 reverse MW:31062
K.IVTDFLITELPAEDDGGFLLDCPKPLSEALATK.L +231.3376
R.ILVPEILATATAEALGATMVAADEYEAHR.I +250.271146.236535.898140.8773
R.ILVPEILATATAEALGATMVAADEYEAHR.I +367.465168.424362.03177.3829
R.LSGVDFNKGCYIGQEVVSR.M +232.4971
R.VTFDGPAPQPGSEINAGDKSVGTMGSSATGR.G +349.3217
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA106917.818.748.639.048.6pyrC possible dihydroorotase 1178873:1180207 forward MW:48616
K.AKTYPASPSGMTGVQTLVPTMLDHVNAGR.L +348.1245
K.GGTIVNQDGEGVGDIGIKDGR.I +233.070649.5685
K.TYPASPSGMTGVQTLVPTMLDHVNAGR.L +244.335834.6295
K.VFIGSSTGSLLVEDDPSLKR.I +238.169540.0566
M.TGTFDTILKGGTIVNQDGEGVGDIGIKDGR.I +345.0917
R.DGIWHGLAQGVVDVLGSDHAPHTLEEK.A +244.849738.006244.9784
R.DGIWHGLAQGVVDVLGSDHAPHTLEEK.A +352.427357.931983.460370.2441
R.EHKDVASVEVTPHHLTLVAPDCYER.L +233.564935.971430.892
R.FVDLTSAGPAR.L +126.3857
R.FVDLTSAGPAR.L +252.515557.951753.895452.5932
R.GLHVLPGVIDTQVHFREPGLTHKEDLETGSR.S +355.594349.2629
R.IAALGSLGAEK.A +134.420232.543935.083336.5044
R.IAALGSLGAEK.A +234.698735.4222
R.IHVLHVSTR.Q +125.132229.957431.4263
R.IHVLHVSTR.Q +236.867538.032933.1318
R.SETITNDWVASR.A +240.4766
R.VTGWPVGTFVR.G +234.568
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA109337.923.828.224.137.9ribB possible GTP cyclohydrolase II, riboflavin biosynthesis 1197881:1198990 forward MW:39822
K.GAQVVAFAK.K +126.7414
K.LAGLPPVGVISELMNDDGTVTK.G +262.975640.679472.285566.6575
K.LVTIADLIAHR.Q +245.694940.425636.6535
K.LVTIADLIAHR.Q +353.7875
R.DGAAGVPVSPIDEQK.T +128.654443.55139.76643.7045
R.EGGVLLR.S +126.0432
R.EIGVGAQILR.D +133.364626.8819
R.HLTTSQIDYK.G +126.0308
R.HLTTSQIDYK.G +231.925333.725543.3211
R.SGHTEAAVDLCK.L +128.216328.445635.799135.692
R.SPFDEIAHIAFVFNGVGDGKNVLTR.F +350.288286.8569
R.VATFPVESPIGVMQGYAYR.S +248.582342.386967.234448.8755
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA109447.549.041.130.957.4RPA1094 glutaryl-CoA dehydrogenase 1199051:1200265 forward MW:44561
K.DKPAQASFKWDDPLLLEDQLTEDER.M +235.939139.376438.0506
K.DKPAQASFKWDDPLLLEDQLTEDER.M +351.876453.853551.436162.1273
K.LASGEWVGCFGLTEPDAGSDPGGMK.T +249.859967.096542.7869
K.LASGEWVGCFGLTEPDAGSDPGGMKTK.A +231.8333
K.MAPEMISIVK.R +126.554226.104432.6736
K.MAPEMISIVK.R +233.695230.1234
K.MAPEMISIVKR.N +230.0461
K.MWISNAPIADVFVVWAK.S +140.944936.215437.8839
K.MWISNAPIADVFVVWAK.S +250.840758.138166.19331.8796
K.MWISNAPIADVFVVWAK.S +364.832
K.QFNRPLAATQLVQK.K +239.018543.80832.4426
K.WDDPLLLEDQLTEDER.M +125.099833.4422
K.WDDPLLLEDQLTEDER.M +265.839985.546768.464272.5651
R.AITGLQAFS.- +125.41725.533825.3827
R.AQTKDKPAQASFKWDDPLLLEDQLTEDER.M +346.503
R.ASITGEIVMDGVVVPEDALLPNVSGLKGPFGCLNR.A +356.7036
R.AYAQDKLLPR.I +127.3437
R.AYAQDKLLPR.I +242.112830.250942.1508
R.DMHGGNGIQIEYHVMR.H +230.68447.2096
R.HAQNLETVNTYEGTHDVHALILGR.A +259.794172.60366.957774.517
R.HAQNLETVNTYEGTHDVHALILGR.A +388.9191.6362106.203106.916
R.INQAYLEEK.T +135.792936.010336.381
R.INQAYLEEK.T +261.015844.8748
R.KQFNRPLAATQLVQKK.L +231.616837.0995
R.LMDEGK.M +127.5522
R.SMNSVQSSLVMYPIYAYGDENQR.K +256.678755.039641.582551.8972
R.SMNSVQSSLVMYPIYAYGDENQR.K +347.6628
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA109713.333.19.79.736.7RPA1097 DUF28 1203352:1204098 forward MW:26941
K.LGTPDPAMNPR.L +236.2911
M.AGHSQFKNIMHR.K +232.5919
R.KAAVIWKPQNTVAVDDETGEK.L +262.267262.589154.7007
R.KAAVIWKPQNTVAVDDETGEK.L +365.082845.0323
R.KAAVIWKPQNTVAVDDETGEKLFK.L +244.900360.626846.0159
R.KAAVIWKPQNTVAVDDETGEKLFK.L +382.884654.468660.757650.2145
R.LRAAVLAAR.A +241.1957
R.SFFTK.S +125.4341
R.TGIIEYDADK.A +132.8467
R.YEGYGPGGVAVIVEALTDNR.N +247.3069
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA112023.231.332.220.545.9TolB putative tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins 1221477:1222811 forward MW:48348
K.ITNIDVPPQFK.S +230.2251
R.EIVGNFPGMSFAPR.F +235.7512
R.FSPTNQEITYMEFGQGEPR.V +241.606632.2875
R.GDYIAFTK.Q +125.320725.5553
R.GSDLVLTPR.F +127.5563
R.GSDLVLTPR.F +231.1922
R.IAHIISDQIYER.L +125.4223
R.IAHIISDQIYER.L +232.083447.337554.0035
R.ILTSGFHNEGPTFAPNGR.V +240.197844.781631.4533
R.ISFGDGSYSTPVWSPR.G +249.356645.986345.3678
R.LTDTPAIDTSPSYAPDGSR.I +125.123
R.LTDTPAIDTSPSYAPDGSR.I +247.788266.939270.104658.7343
R.NELRVPTPGYASDPAWSPLLS.- +237.57
R.SGLFAPIDQAAYLEK.I +143.308837.535340.6027
R.SGLFAPIDQAAYLEK.I +249.204550.410649.198360.8502
R.VQITEGNVAPLPIAIPNFVAGTPSDAEVGTGVSQVITNNLKR.S +360.426945.8872
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA112610.011.013.010.315.8ftsH metalloprotease (cell division protein) FtsH 1229602:1231518 forward MW:69829
K.VTSGAASDIEQATK.L +140.399645.722536.2561
K.VTSGAASDIEQATK.L +249.040953.389533.3519
R.EKVTSGAASDIEQATK.L +142.9384
R.EKVTSGAASDIEQATK.L +239.2818
R.GVLLVGPPGTGK.T +135.191837.960626.325127.7273
R.GVLLVGPPGTGK.T +233.491530.1233
R.KVPLAPDINLK.N +136.812331.5311
R.KVPLAPDINLK.N +236.9449
R.KVPLAPDINLKNIAR.G +349.9307
R.RADLEALAK.G +130.378530.583428.5714
R.RADLEALAK.G +241.004642.86134.4308
R.TQNASEATIQKIDAEIK.R +235.853232.869
R.TQNASEATIQKIDAEIKR.L +257.480645.0785
R.VTFEDVAGVDEAKQDLQEIVEFLR.D +238.475
R.VTFEDVAGVDEAKQDLQEIVEFLRDPGK.F +230.3819
R.VTFEDVAGVDEAKQDLQEIVEFLRDPGK.F +361.657862.269
R.VTFEDVAGVDEAKQDLQEIVEFLRDPGKFQR.L +354.52446.3057
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA11338.08.023.123.123.1RPA1133 unknown protein 1237981:1238919 forward MW:31489
K.APAVKPAAPKPKPASR.K +126.316832.4927
K.APAVKPAAPKPKPASR.K +245.387
K.KPAPVAVEPEEAWHEAVSEPVAK.A +240.482239.582555.260730.9364
K.KPAPVAVEPEEAWHEAVSEPVAK.A +393.463173.7684
R.AKKPAPVAVEPEEAWHEAVSEPVAK.A +250.360258.740974.063662.8578
R.AKKPAPVAVEPEEAWHEAVSEPVAK.A +384.834789.7226101.913104.941
R.KAPKPAEAAPSAAAEPVAPPPAAPK.K +265.457262.9387
R.KAPKPAEAAPSAAAEPVAPPPAAPK.K +365.5448
R.KAPKPAEAAPSAAAEPVAPPPAAPKKPR.K +264.02457.6628
R.KAPKPAEAAPSAAAEPVAPPPAAPKKPR.K +376.79162.072
R.KAPKPAEAAPSAAAEPVAPPPAAPKKPRKPR.A +363.07860.1196
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA11395.512.612.19.619.1RPA1139 conserved unknown protein 1246445:1247638 reverse MW:42006
K.AFPGVAAAGWTNGIVDMDR.T +260.5136
K.LASAVWDDASGK.L +126.1952
R.AAAVIAK.A +127.7719
R.LGLNDDAPGEEEGEPR.T +128.217927.2112
R.LGLNDDAPGEEEGEPR.T +244.338544.7499
R.TDGGAVAALAK.E +127.195627.069127.931926.7415
R.TDGGAVAALAK.E +245.2603
R.VALEGASDFLK.T +137.555240.935534.588335.6444
R.VALEGASDFLK.T +247.182947.132249.463948.0916
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA114077.089.276.186.191.6groEL1 chaperonin GroEL1, cpn60 1247853:1249496 reverse MW:57626
K.ADAPAMPAGGGMGGMGGMGF.- +142.145643.401245.247445.9433
K.ADAPAMPAGGGMGGMGGMGF.- +243.259143.1064
K.ALEAPIR.Q +126.61229.9767
K.ALEAPIRQIAENAGVEGSIVVGK.I +245.162239.050559.583362.9562
K.ALEAPIRQIAENAGVEGSIVVGK.I +356.588146.4113
K.AMLEDIAILTGGQLISEDLGIK.L +251.737462.776363.489271.0226
K.AMLEDIAILTGGQLISEDLGIK.L +353.582764.24664.6012
K.AMLEDIAILTGGQLISEDLGIKLETVTLK.M +230.718235.5788
K.AMLEDIAILTGGQLISEDLGIKLETVTLK.M +345.6631
K.AQIEETSSDYDREK.L +126.571927.6466
K.AQIEETSSDYDREK.L +253.768756.179354.082142.7127
K.AQIEETSSDYDREKLQER.L +244.778533.966736.6434
K.AVAAGMNPMDLK.R +146.256839.925842.578639.4229
K.AVAAGMNPMDLK.R +265.490966.683460.265260.3578
K.AVAAGMNPMDLKR.G +135.358836.791830.851830.024
K.AVAAGMNPMDLKR.G +269.785762.411357.912459.8272
K.AVAAGMNPMDLKR.G +345.073447.997946.8954
K.DGVTVAK.E +125.709926.0826
K.DGVTVAKEVELEDKFENMGAQMVR.E +258.820968.008159.065164.2209
K.DGVTVAKEVELEDKFENMGAQMVR.E +368.909970.290380.345882.9229
K.DRVEDALNATR.A +126.8101
K.DRVEDALNATR.A +239.311452.681150.8805
K.EKKDRVEDALNATR.A +135.012227.2169
K.EKKDRVEDALNATR.A +230.2323
K.EVELEDKFENMGAQMVR.E +260.338762.23462.001876.1248
K.EVELEDKFENMGAQMVR.E +360.945451.462162.534151.9525
K.FDRGYLSPYFVTNAEK.M +130.4004
K.FDRGYLSPYFVTNAEK.M +241.916361.512153.8458.345
K.FDRGYLSPYFVTNAEK.M +353.546
K.GIVDPAK.V +128.489330.27232.049333.0796
K.ILENK.T +126.3582
K.ILENKTETFGFDAQTEEYVDMLAK.G +231.9402
K.KDRVEDALNATR.A +232.284430.485631.202731.4225
K.KDRVEDALNATR.A +350.3696
K.KLSGLQSMLPVLEAVVQSGKPLLIIAEDVEGEALATLVVNR.L +364.597967.3677
K.KVVIDKENTTIVNGAGKKPEIEAR.V +242.382560.641571.6599
K.KVVIDKENTTIVNGAGKKPEIEAR.V +362.058860.039857.8468
K.LAGGVAVIR.V +127.1779
K.LAGGVAVIR.V +257.727858.474245.92753.43
K.LETVTLK.M +130.6685
K.LQER.L +128.7918
K.LSGLQSMLPVLEAVVQSGKPLLIIAEDVEGEALATLVVNR.L +360.125765.0824
K.MIAQAMQK.V +138.904636.119934.429639.4555
K.MIAQAMQK.V +249.09144.4777
K.MTVELDDAYILLHEK.K +143.661543.773443.33251.1456
K.MTVELDDAYILLHEK.K +271.407973.428873.199972.7509
K.MTVELDDAYILLHEK.K +357.346265.403670.993671.0911
K.MTVELDDAYILLHEKK.L +137.549834.388939.6314
K.MTVELDDAYILLHEKK.L +263.958354.714466.383562.5497
K.MTVELDDAYILLHEKK.L +345.183348.2094
K.RAKPVASSAEIAQVGTISANGDAPIGK.M +250.902939.396239.34647.3456
K.RGIEIAVAAVVKDIQKR.A +363.7295
K.SFGAPR.I +136.09526.816327.5316
K.SLETEVDIVEGMK.F +136.536639.525251.063645.2474
K.SLETEVDIVEGMK.F +269.227670.680167.455663.798
K.SLETEVDIVEGMKFDR.G +236.8006
K.TNDLAGDGTTTATVLAQAIVR.E +274.612168.680586.082776.5311
K.TNDLAGDGTTTATVLAQAIVR.E +362.5563
K.VGNEGVITVEENK.S +133.64446.232440.834340.7491
K.VGNEGVITVEENK.S +265.437453.347647.628363.7306
K.VGNEGVITVEENKSLETEVDIVEGMK.F +259.05856.216861.6198
K.VGNEGVITVEENKSLETEVDIVEGMK.F +383.01977.914762.2621
K.VGNEGVITVEENKSLETEVDIVEGMKFDR.G +351.475957.9014
K.VSAVKAPGFGDR.R +125.3982
K.VSAVKAPGFGDR.R +236.669336.0748
K.VTLGPK.G +128.712225.843229.137829.3739
K.VVIDKENTTIVNGAGKKPEIEAR.V +254.537747.755369.10467.8245
K.VVIDKENTTIVNGAGKKPEIEAR.V +352.663662.081447.128
R.AAVQEGIVPGGGVALLR.A +148.354837.027335.952533.3711
R.AAVQEGIVPGGGVALLR.A +269.960660.780962.224253.8403
R.AAVQEGIVPGGGVALLR.A +364.393158.1028
R.AKKVVIDKENTTIVNGAGKKPEIEAR.V +253.356866.590865.158640.8762
R.AKKVVIDKENTTIVNGAGKKPEIEAR.V +364.713477.642493.6664
R.AKPVASSAEIAQVGTISANGDAPIGK.M +286.873381.337486.68985.082
R.AKPVASSAEIAQVGTISANGDAPIGK.M +354.865961.384671.958366.3499
R.EVASKTNDLAGDGTTTATVLAQAIVR.E +236.5143
R.GGLKVSAVK.A +232.2341
R.GIEIAVAAVVKDIQKR.A +254.996644.528662.652854.9373
R.GIEIAVAAVVKDIQKR.A +348.550449.9044
R.GVDVLANAVK.V +131.363942.003834.276432.3457
R.GVDVLANAVK.V +259.402862.517954.636758.4104
R.GVDVLANAVKVTLGPK.G +126.0423
R.GVDVLANAVKVTLGPK.G +240.168240.1831
R.GYLSPYFVTNAEK.M +146.818246.338240.362236.2348
R.GYLSPYFVTNAEK.M +263.162670.117970.731471.9174
R.ISNDNPDVQAGINIVLK.A +130.272336.630739.2193
R.ISNDNPDVQAGINIVLK.A +238.942846.033937.350335.6169
R.ITKDGVTVAK.E +132.028635.552732.283835.6284
R.ITKDGVTVAK.E +243.761744.503531.8899
R.ITKDGVTVAKEVELEDKFENMGAQMVR.E +250.323340.143463.90959.0688
R.ITKDGVTVAKEVELEDKFENMGAQMVR.E +375.202591.974492.794.4218
R.KAMLEDIAILTGGQLISEDLGIK.L +254.544958.999890.482279.3382
R.KAMLEDIAILTGGQLISEDLGIKLETVTLK.M +251.1504
R.KAMLEDIAILTGGQLISEDLGIKLETVTLK.M +357.301661.272966.26673.6696
R.MLRGVDVLANAVK.V +252.351734.002656.027354.7244
R.MLRGVDVLANAVK.V +346.380754.0656
R.NVLIEK.S +128.276336.25233.275831.9252
R.TALQDASSVASLLVTTEAMVAELPK.A +279.103472.162371.952177.1236
R.TALQDASSVASLLVTTEAMVAELPK.A +385.909181.76390.690997.6773
R.TALQDASSVASLLVTTEAMVAELPKADAPAMPAGGGMGGMGGMGF.- +357.227365.50663.162462.8033
R.VEDALNATR.A +247.438848.7033
R.VGGATEVEVK.E +129.781232.31533.279132.0812
R.VGGATEVEVK.E +256.8344.605530.9543
R.VGGATEVEVKEKKDR.V +129.2822
R.VGGATEVEVKEKKDRVEDALNATR.A +242.565338.039145.545440.998
R.VGGATEVEVKEKKDRVEDALNATR.A +357.42764.206876.887363.6331
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA114165.360.256.167.376.5groES1 chaperonin GroES1, cpn10 1249536:1249832 reverse MW:10624
K.EKPQEGQVIAVGPGGR.D +232.901735.374936.198830.8319
K.EKPQEGQVIAVGPGGRDETGK.L +231.1099
K.EKPQEGQVIAVGPGGRDETGKLTPIDVK.V +240.530538.082136.211833.789
K.EKPQEGQVIAVGPGGRDETGKLTPIDVK.V +345.311852.2789
K.GGIIIPDSAK.E +142.177941.079433.987236.3467
K.GGIIIPDSAK.E +230.605533.2572
K.GGIIIPDSAKEKPQEGQVIAVGPGGRDETGKLTPIDVK.V +347.849854.681247.7632
K.LDGEELLIMK.E +133.285436.164729.918634.5592
K.LDGEELLIMK.E +261.443562.035253.506348.8094
K.TKGGIIIPDSAK.E +145.034645.412839.767337.0067
K.TKGGIIIPDSAK.E +253.294152.11543.858446.766
K.TKGGIIIPDSAKEKPQEGQVIAVGPGGRDETGKLTPIDVK.V +350.322747.36
K.VGDRVLFGK.W +244.043541.3879
M.AKINFRPLHDR.V +348.8544
R.DETGKLTPIDVK.V +133.648842.137533.649537.7521
R.DETGKLTPIDVK.V +239.811231.4115
R.VLFGK.W +128.5427.861431.358132.6098
R.VVVKR.I +128.9858
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA114614.419.714.119.719.7RPA1146 conserved unknown protein 1253883:1254737 reverse MW:29041
R.IAPNAIYGLVQTVLVQDEALK.R +259.250960.913352.140643.7766
R.IAPNAIYGLVQTVLVQDEALK.R +368.2104
R.IAPNAIYGLVQTVLVQDEALKR.A +241.659939.207347.0818
R.IQELEADHAPQSQER.G +128.500931.9849
R.LEATPRDPEAAAAITQGLR.I +230.380433.272846.846852.3432
R.LEATPRDPEAAAAITQGLR.I +356.242853.7053
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA115020.410.29.26.029.6RPA1150 putative histidyl-tRNA synthetase 1257854:1259002 reverse MW:40285
K.AAGQPVGFCYLGPVFR.Q +234.796739.2553
K.AALALVTDLMSIAGATTLGGR.S +345.0151
K.ALRALAADAK.L +129.190729.457928.7209
K.SLYLTTDASGEELCLRPDLTIPVAR.E +231.1741
R.AAADAEMLALALGATTALK.A +255.3682
R.FLAITGAPTDALK.A +258.573535.151831.5597
R.FLEQSTLK.S +125.0835
R.KAALALVTDLMSIAGATTLGGR.S +233.0689
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA115514.415.122.825.628.6RPA1155 putative pmbA protein, maturation of antibiotic MccB17 1262616:1264013 forward MW:48746
R.AAEAAALAVPGINK.S +130.445537.3205
R.GVSSSPSPGPYNLHLEAGPLSPAELIADIK.Q +238.642133.6518
R.RAGADQADAVAVR.G +235.1764
R.SLSSPSVDSALFDQSALSDLAQR.L +233.705963.384351.1633
R.SQAFDAEGVAVKPLSIVDDGVLTSWLLDCATAR.E +230.171641.714839.2393
R.SQAFDAEGVAVKPLSIVDDGVLTSWLLDCATAR.E +345.732966.802859.5897
R.VAGSLVGHLVGAANGASIAR.K +247.189862.412667.265
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA115767.180.567.167.180.5RPA1157 conserved unknown protein 1264853:1265101 forward MW:9441
K.VDIVGVYPNYATAYAAWK.A +242.925934.870740.772849.6176
M.SDNAQQLLHLVIGGELEDLENVTFR.D +251.4145
M.SDNAQQLLHLVIGGELEDLENVTFRDLEK.V +239.2787
M.SDNAQQLLHLVIGGELEDLENVTFRDLEK.V +362.397555.754559.085287.4235
R.AHQTVDNAHMR.Y +126.9651
R.YFIVHLHR.L +125.308830.834330.025730.0118
R.YFIVHLHR.L +246.070940.94940.6854
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA117330.230.264.073.373.3cspA1 cold shock DNA binding protein 1281878:1282138 reverse MW:9299
K.FFNGER.G +126.483129.9883
R.AGLKDLTEGQR.I +134.218832.46543.692342.4312
R.AGLKDLTEGQR.I +242.908346.574250.8402
R.AGLKDLTEGQR.I +367.030557.7065
R.GYGFIKPDDGGR.D +133.0387
R.GYGFIKPDDGGR.D +247.0612
R.GYGFIKPDDGGRDVFVHITAVER.A +240.653337.9034
R.GYGFIKPDDGGRDVFVHITAVER.A +357.968858.9031
R.ISFEVEPDKK.G +134.5358
R.ISFEVEPDKK.G +234.8988
R.ISFEVEPDKKGKGPK.A +142.478849.257943.104442.7386
R.ISFEVEPDKKGKGPK.A +237.006243.669651.796148.1598
R.ISFEVEPDKKGKGPKAVNLVISP.- +232.8625
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA117573.373.329.839.773.3RPA1175 response regulator receiver (CheY-like protein) 1283518:1283913 forward MW:14439
K.IEAVFPDHVAA.- +130.970431.0076
K.IEAVFPDHVAA.- +235.1366
K.KAGVNNYIVKPFNAATLK.T +139.119
K.KAGVNNYIVKPFNAATLK.T +239.119
K.KAGVNNYIVKPFNAATLK.T +355.544151.8162
K.KYGLVISDWNMEPMTGYDLLK.E +234.721135.6397
K.QLGFENIDDASDGSAALAK.M +249.920752.198948.646954.5388
K.TKIEAVFPDHVAA.- +139.880439.787436.3726
K.TKIEAVFPDHVAA.- +233.6005
K.YGLVISDWNMEPMTGYDLLK.E +254.85352.475258.31756.6944
K.YGLVISDWNMEPMTGYDLLKEVR.A +234.081937.4126
K.YGLVISDWNMEPMTGYDLLKEVR.A +345.5684
R.ADPNLSQTPFIMITAESK.T +244.808245.9582
R.NLLKQLGFENIDDASDGSAALAK.M +248.210551.7985
R.NLLKQLGFENIDDASDGSAALAK.M +358.8553
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA117821.425.415.76.127.5RPA1178 putative histidyl-tRNA synthetase 1284950:1286521 reverse MW:57222
K.AGIR.A +125.6253
K.VQELLQR.R +234.9504
R.AELYLGNPK.H +131.098427.386326.023527.1312
R.AELYLGNPK.H +242.766838.083
R.AIDKSDKFAPEEIKK.L +135.6131
R.FRGEPVPATGFSIGVSR.L +235.082231.706540.8682
R.GLADRGPAEIAATR.A +246.756840.0762
R.NSPCAIIQGSDEK.Q +133.4905
R.STADNETLKQGCDELAVIADLLDACGYGATSANPDVR.V +351.259153.837748.7218
R.YDLTAPLAR.Y +233.235645.9321
R.YGFEPVETPAFEYTDALGK.F +253.590655.267463.435954.8706
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA117952.956.645.244.856.6RPA1179 beta-alanine-pyruvate transaminase 1286629:1288083 forward MW:51752
K.AFELASR.I +129.268227.8584
K.AQADELDFSPPFQFGQPK.A +263.35467.31749.8066
K.EIAEAIKAQADELDFSPPFQFGQPK.A +246.718148.678436.397537.8676
K.EIAEAIKAQADELDFSPPFQFGQPK.A +349.6215
K.FAEAVMSLK.S +138.345240.539834.413541.0367
K.FAEAVMSLK.S +254.533756.604648.312638.9688
K.IAVAYQQIK.G +137.398932.070436.280839.0916
K.IAVAYQQIK.G +247.330841.2331
K.IAVAYQQIKGQGSR.T +250.788536.1455
K.IIDAASGMWCTNAGHGR.K +347.9953
K.IKPTSAVNAPNDLNAFWMPFTANR.A +262.242975.509660.324561.6516
K.IKPTSAVNAPNDLNAFWMPFTANR.A +369.525761.322958.697249.8115
K.MFGPLLNGVDHLPATYDR.D +257.153450.83435.7827
K.MFGPLLNGVDHLPATYDR.D +354.320755.590246.9458
K.MVVGAEGMHYITADGR.K +253.438349.895449.0889
K.MVVGAEGMHYITADGR.K +352.435254.3535
K.MVVGAEGMHYITADGRK.I +235.042850.699133.8998
K.RGFEAMNAGFHDHELMLR.I +241.422735.3738
K.RGFEAMNAGFHDHELMLR.I +354.497761.345
K.SAPNVVDIR.T +126.644927.1345
K.SAPNVVDIR.T +242.656344.938138.8121
R.GFEAMNAGFHDHELMLR.I +133.4471
R.GFEAMNAGFHDHELMLR.I +261.41458.971856.203132.6343
R.GFEAMNAGFHDHELMLR.I +346.784
R.GYHGVGFGGTAVGGIGNNRK.M +277.055980.700478.188578.689
R.GYHGVGFGGTAVGGIGNNRK.M +353.749248.2488
R.IADLAPEGLDHVFFCNSGSEAGDTALK.I +246.640159.866153.816464.1606
R.IADLAPEGLDHVFFCNSGSEAGDTALK.I +393.724987.938976.668548.514
R.IAGDTLALTPPLILSEDHIGEIVDK.V +242.419247.832342.025635.2887
R.IAGDTLALTPPLILSEDHIGEIVDK.V +354.527253.5444
R.IAGDTLALTPPLILSEDHIGEIVDKVGK.V +244.196634.719832.1805
R.IAGDTLALTPPLILSEDHIGEIVDKVGK.V +349.452456.396649.018950.0063
R.KEIAEAIKAQADELDFSPPFQFGQPK.A +242.6113
R.KIIDAASGMWCTNAGHGRK.E +255.8029
R.LGYAFASER.Y +126.142127.647
R.LGYAFASER.Y +248.5348
R.TVGLTAGIDLASIADAVGKR.G +261.798551.241658.565157.9841
R.TVGLTAGIDLASIADAVGKR.G +347.561850.4027
R.YGVTPDMITFAK.G +140.733738.935740.938537.4284
R.YGVTPDMITFAK.G +244.851446.267738.7055
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA118516.114.233.221.538.7RPA1185 putative methanol dehydrogenase regulator 1296628:1297731 reverse MW:39412
R.FIAGPVFAQLLMADEINR.A +242.680832.8839
R.HDLPKPFHVLATQNPLEQEGTYPLPEAQLDR.F +348.0027
R.ILFDTTGAEQAAPR.A +240.2374
R.LAPSIDDVLDLAEPILK.H +132.435634.765838.7314
R.LAPSIDDVLDLAEPILK.H +265.606559.188970.29562.3891
R.LAPSIDDVLDLAEPILK.H +365.0306
R.RLPVGDSVVEAILSLVR.S +256.994238.053253.747546.766
R.RLPVGDSVVEAILSLVR.S +358.860465.622656.437960.8511
R.TQSALLQAMQEQHITVAGAR.H +237.1427
R.VVENTLVTILSGGHALLIGVPGLAK.T +241.202130.818532.0784
R.VVENTLVTILSGGHALLIGVPGLAK.T +358.8707
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA119312.56.718.618.618.6RPA1193 cytochrome b/c1 precursor 1303042:1305108 forward MW:77000
K.DISTFLVWASEPHMEAR.K +250.612538.5818
K.EIAAAAQIK.D +132.445733.8363
K.EIAAAAQIKDGPNDQGEMFERPGR.L +230.214838.187938.9788
K.EIAAAAQIKDGPNDQGEMFERPGR.L +350.3895
K.MPPPIQAGMVSYDDGTPETLEQYAK.D +261.244159.8205
M.SGPSTYQPQSPLMK.W +127.525336.909337.4888
M.SGPSTYQPQSPLMK.W +244.173351.217149.3448
R.AANGGAAPPDMSLLAK.A +139.161539.407436.65540.4056
R.AANGGAAPPDMSLLAK.A +230.627836.129834.7477
R.LADTFHSPFPNEQAAR.A +129.789939.601734.8046
R.LADTFHSPFPNEQAAR.A +247.175240.513547.774751.4895
R.LADTFHSPFPNEQAAR.A +362.193659.62875.243255.8993
R.NLAEPGGPGFTVEQAK.E +136.782536.211136.1347
R.NLAEPGGPGFTVEQAK.E +251.362662.900859.2067
R.NLAEPGGPGFTVEQAKEIAAAAQIK.D +245.9319
R.NLAEPGGPGFTVEQAKEIAAAAQIKDGPNDQGEMFERPGR.L +348.1821
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA119530.235.330.234.139.1fixR1 short-chain dehydrogenase 1306424:1307200 reverse MW:27613
K.GSVVNVTSIAGSR.V +235.069
R.LDGGVLHALVNNAAISPK.A +149.565846.43728.4376
R.LDGGVLHALVNNAAISPK.A +266.015962.365668.211366.6216
R.LDGGVLHALVNNAAISPK.A +371.417762.7289
R.LGTIDTEIDTWEHVFR.V +243.4375
R.LGTIDTEIDTWEHVFR.V +348.662346.495447.253
R.RTMILTGASR.G +230.5749
R.VHPFAGAAYATSK.A +142.54945.793847.021236.4407
R.VHPFAGAAYATSK.A +235.5706
R.VNFFAPILMAR.G +253.342952.634650.314544.7017
R.VNSIAPGEIDTSILSPGTEK.I +246.234244.56359.320256.1541
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA119933.033.723.129.736.6RPA1199 enoyl-acyl carrier protein reductase 1309856:1310677 forward MW:29288
K.NPDAPDISLGGKD.- +126.0924
K.RGVILGVANNR.S +251.484151.019235.551835.3437
M.STASGLMQGK.R +134.698127.540326.9275
M.STASGLMQGK.R +238.275634.3768
R.GVILGVANNR.S +234.0764
R.GVTGEVHHVDSGYHVVGMKNPDAPDISLGGKD.- +230.641344.929836.8791
R.GVTGEVHHVDSGYHVVGMKNPDAPDISLGGKD.- +369.711363.454290.702386.9539
R.SIAWGIAK.A +125.034325.017
R.TVTIEEVGDSALYFLSDLSR.G +242.735144.744243.286933.6499
R.VNAISAGPIK.T +125.4914
R.YLAADLGEK.N +130.123342.0643
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA120121.029.825.432.632.6aroC chorismate synthase 1311494:1312582 forward MW:38512
K.ILSGVMVHPETGVQVTTGTPIALLIENTDQR.S +238.6553
K.ILSGVMVHPETGVQVTTGTPIALLIENTDQR.S +352.316359.333469.930552.6294
K.LDGDLAAALMSINAVK.G +129.2163
K.LDGDLAAALMSINAVK.G +240.035336.200137.187
K.LDGDLAAALMSINAVK.G +349.7006
M.SFNTFGHLFR.V +247.0391
R.AVPVGEAMVACVLADHLLR.H +237.842433.766352.9344
R.FAVKPTSSILTPR.K +236.729435.42537.2296
R.TGNHGPAFLSNHAGGILGGISTGQPVVAR.F +230.996736.33958.230458.8601
R.TGNHGPAFLSNHAGGILGGISTGQPVVAR.F +374.3181
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA121210.013.931.126.941.7RPA1212 Alpha/beta hydrolase fold 1325781:1326776 reverse MW:36657
K.LQPSDVGKPTLAHSV.- +137.213126.3965
K.TIDEPMVDYDYATTHQPGAR.Y +244.910843.0508
M.PLISGQAIETTR.I +233.024645.626451.7383
R.AATEAPQAFR.S +127.182726.5288
R.GRSWIIDTLR.V +236.1947
R.IHGEQPVDALALSLASEFLAR.A +289.0862.971595.46690.5337
R.IHGEQPVDALALSLASEFLAR.A +346.045545.812649.9804
R.RIHGEQPVDALALSLASEFLAR.A +254.31139.0639
R.RIHGEQPVDALALSLASEFLAR.A +348.423348.0861
R.SLGLISPTGFEGK.A +125.2492
R.SWIIDTLR.V +130.4635
R.VAGRPNWTLVQFDAGAFPHFEVLDQVVSSYNQFLGK.L +354.3151
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA121821.842.357.561.663.3RPA1218 putative ABC transporter periplasmic protein 1333792:1335405 forward MW:59038
K.AQPIVAAQLLR.D +139.133533.033128.725531.5747
K.AQPIVAAQLLR.D +270.395363.65863.422267.1331
K.AVYVKNPDYIPR.K +132.155326.3974
K.AVYVKNPDYIPR.K +257.872843.2813
K.ELSGIVHGPATPVFWNIDK.Q +234.477162.456556.3402
K.ELSGIVHGPATPVFWNIDKQGD.- +251.713150.174265.700762.1855
K.FVASEFQPGVK.A +128.694434.49741.0023
K.FVASEFQPGVK.A +250.371656.685557.2264
K.IAEEIQKEVYEQVIYIPLGQYTAPSVWR.K +252.561446.4107
K.IAEEIQKEVYEQVIYIPLGQYTAPSVWRK.E +231.0694
K.IAEEIQKEVYEQVIYIPLGQYTAPSVWRK.E +376.4135
K.ICGAVFGCGTPLETDVGSETLVK.G +251.065769.248170.6376
K.KGGWFGWAEDAK.V +126.5198
K.KGGWFGWAEDAKVEELRDKFVR.A +348.6958
K.KLLAESGYDGTPIALMAPGDVVTLK.A +269.068678.042678.882969.1529
K.KLLAESGYDGTPIALMAPGDVVTLK.A +345.647757.207849.6005
K.LKEPYALVLESIGKPSSLVPFMMPK.R +253.331954.052661.137161.0666
K.LKEPYALVLESIGKPSSLVPFMMPK.R +351.702175.973172.004976.1438
K.LLAESGYDGTPIALMAPGDVVTLK.A +246.779350.447764.583959.1376
K.RIAETPADKPIPEQIGSGPFK.F +248.271342.01650.3868
K.RIAETPADKPIPEQIGSGPFK.F +362.7563
K.RIAETPADKPIPEQIGSGPFKFVASEFQPGVK.A +347.7541
K.WHDGTPVTAEDCVASLKR.W +232.524846.256931.6952
K.WHDGTPVTAEDCVASLKR.W +363.741378.3628
R.AAFLAMSQKPVLDALVGNPK.Y +257.526254.2283.603188.1668
R.AAFLAMSQKPVLDALVGNPK.Y +359.231664.635150.717769.2317
R.ANSPDEQKK.I +126.6457
R.AVMHSDLR.I +125.61629.5715
R.DGLKWHDGTPVTAEDCVASLKR.W +238.0151
R.DGLKWHDGTPVTAEDCVASLKR.W +359.659446.5331
R.DHGYMVYDTLLAMDSK.F +158.766851.5912
R.DHGYMVYDTLLAMDSK.F +230.852866.691670.0352
R.IAETPADKPIPEQIGSGPFK.F +236.013160.114746.2478
R.IAETPADKPIPEQIGSGPFK.F +358.628951.9749
R.IAETPADKPIPEQIGSGPFKFVASEFQPGVK.A +360.3447
R.IIDPGLTTAYITR.D +268.328969.804272.276368.6418
R.KELSGIVHGPATPVFWNIDK.Q +249.411838.5589
R.KELSGIVHGPATPVFWNIDKQGD.- +367.883851.8597
R.MNFLHPPFDNPK.V +126.9384
R.MNFLHPPFDNPK.V +236.614442.6606
R.RAAFLAMSQKPVLDALVGNPK.Y +241.677334.893767.102470.7778
R.RAAFLAMSQKPVLDALVGNPK.Y +353.126155.453889.477384.2245
R.RASQKPPSEGGWNMFFTNWAGPDILNPVANVSVGGQGK.K +366.876358.3346
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA122040.830.518.916.949.4RPA1220 CBS domain 1337065:1338081 forward MW:37008
-.MKAADVMTTAIVTVQPETPVHAIAETLLK.H +349.2628
K.HGISAVPVVDGAGVPLGIVSEGDLMPR.A +254.098973.364851.172430.0478
R.AGHIVGIVSR.A +136.895940.500138.1184
R.AGHIVGIVSR.A +242.4559
R.AVNAPDPEWPSTLR.G +234.3689
R.HDWWLQMLSEGEAVHPDYVR.F +233.5067
R.HDWWLQMLSEGEAVHPDYVR.F +369.820358.645848.081568.7768
R.LASDMLASHLTDETWQK.L +247.09263.136233.6356
R.LASDMLASHLTDETWQK.L +350.434969.1352
R.TAKDVMVGPVVTVEETTALADIADLLVEKR.I +361.408
R.VVDFPDGIPGDIGLFLTWGK.T +230.1615
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA12247.76.610.511.018.9iorA putative indolepyruvate ferredoxin oxidoreductase, alpha subunit 1340580:1342406 forward MW:65175
K.ELRPLTGNEAIAR.A +233.006835.850134.042
K.FGVVTAGTCYPYLR.E +230.0223
K.KVDSYDLAATHQALR.E +232.6037
K.LKDYLATADITR.V +242.41732.3393
K.TLRGEPAPQVDYEALIK.A +234.67346.5775
R.AGEFSPEVVR.A +127.6711
R.EVLPNATVLK.L +125.3478
R.IYGQLASIPVLEPSDAQEAYDFTK.L +233.006340.919539.137
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA122627.431.527.68.043.4RPA1226 putative 2-oxoglutarate ferredoxin oxidoreductase, alpha subunit 1343344:1344507 forward MW:41346
K.AILVPELNIGQLR.L +129.571928.5084
K.AILVPELNIGQLR.L +242.171842.588533.2845
K.FFAGYPITPSSEIAER.L +231.8903
K.KVGLFRPVTLWPFPEIALR.E +232.632930.9097
K.KVGLFRPVTLWPFPEIALR.E +346.764451.2936
K.VGLFRPVTLWPFPEIALR.E +241.360937.248556.423546.6143
K.VGLFRPVTLWPFPEIALR.E +347.9628
R.AFDLAELCR.T +244.518644.5848
R.HRDLIDSYEAVR.C +240.0528
R.LSTMLPAAGGVFIQMEDEIAAMAAVVGASMGGVK.S +368.3205
R.RVEGLHLISGEPITPAQIAAAATK.L +233.784542.5603
R.RVEGLHLISGEPITPAQIAAAATK.L +365.514851.3646
R.THTTGLTHSETGFPSQDPETVTR.N +231.616447.3821
R.VEGLHLISGEPITPAQIAAAATK.L +243.725640.4351
R.YGSHGDYPMIVLAPASAR.E +258.841536.458256.0515
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA123523.223.221.712.235.7RPA1235 possible Leucine-Binding Protein (LBP) 1352737:1353942 forward MW:43375
K.ALTTESLMTALESGETFDDIFGGAPISFSK.D +244.220146.954150.51649.6718
K.AMNIPSATMVSFK.R +127.8501
K.AMNIPSATMVSFKR.G +232.1901
K.KAVLITQK.L +126.9684
K.LAIAQINDDGGINGR.K +234.374246.160541.5072
K.LGWKPTFVVSSPSYVPDFPQLGK.E +233.434236.1796
K.TQPKKPCIVYQDDEMGKNFTDAYTDQLK.A +350.3375
R.ESVGITTAAQK.L +129.465627.961936.3489
R.LKFNMFSPYYDTMR.L +232.774236.6117
R.LKFNMFSPYYDTMR.L +347.6195
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA125914.718.87.47.824.4RPA1259 putative cation-transporting P-type ATPase 1378745:1381489 forward MW:97684
K.MITGDHAATAEAIAR.Q +134.360143.57331.6309
K.MITGDHAATAEAIAR.Q +261.662274.718162.539259.2415
K.MITGDHAATAEAIAR.Q +353.0219
R.HATDSGAQVIFVK.G +133.1771
R.HATDSGAQVIFVK.G +242.2902
R.LLAMCATQVGPGGALHPIDQEFWTAQIAR.A +350.407249.2229
R.QLNLTDHPDVVTGADLDRTPDSGFVELAR.R +353.150560.868447.191952.3309
R.RIVTADHTILVSGSGYVPKGDLTVDGKDNPEAVSSAMQLVR.S +345.3507
R.RLPAVETLGATSVICSDKTGTLTR.N +350.1384
R.SALLCNDAQLRPVDGHYVVDGDPMEGALVALAIK.A +352.741256.3798
R.SDEIPFDAQHR.F +238.0244
R.VVLPAEELVPGDVVMIEAGDRVPADLR.L +346.186445.8939
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA126067.460.855.150.867.8RPA1260 Universal stress protein (Usp) 1381578:1382483 forward MW:32630
K.EGAGPATDIIEAATELRPDLVVIGTHAR.R +351.246148.05861.562550.0863
K.SLAPVDLTDCSAQALETAR.Q +130.438927.496929.9958
K.SLAPVDLTDCSAQALETAR.Q +285.137585.070685.716381.6608
K.SLAPVDLTDCSAQALETAR.Q +374.411656.4091
K.TSLDDYLVDTR.T +244.715533.575741.654
K.VVLAATDFSAR.S +263.451759.297654.957230.4766
M.NELPRPDMMFGLK.V +233.301941.509231.9012
R.AFLRDIFAGTTAER.V +239.726438.6812
R.AFLRDIFAGTTAER.V +346.009646.3459
R.DIFAGTTAER.V +127.757231.1536
R.DIFAGTTAER.V +259.990142.522742.2547
R.DILVVPVR.D +136.9849
R.DILVVPVR.D +233.753230.181431.2154
R.DILVVPVRDAGS.- +139.327843.615641.743742.6991
R.DILVVPVRDAGS.- +239.979948.424130.265131.0598
R.EHTYLAGLQCTPLVLLGTPFDAIVR.A +252.032848.0036
R.FLEPLRLDDVDYSTVVK.E +246.356252.144351.698255.248
R.FLEPLRLDDVDYSTVVK.E +353.430655.9868
R.LDDVDYSTVVK.E +129.9223
R.LLLSSVTEEVLR.R +128.662934.400439.9797
R.LLLSSVTEEVLR.R +270.034265.89773.486569.8234
R.LLLSSVTEEVLRR.L +234.052830.1619
R.LVIAHVVDDDQPEHIVAVEVELAESALADAIR.E +241.606931.337544.303239.4142
R.LVIAHVVDDDQPEHIVAVEVELAESALADAIR.E +382.165273.387861.253269.351
R.TDAVRDLVR.F +233.0041
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA127624.725.915.422.928.7carA carbamoyl-phosphate synthase small subunit 1396520:1397713 reverse MW:42616
K.VIETGVPTFGICLGHQMLGLALGGK.T +231.4344
K.VTVVPATTSAEDILAMKPDGVFLSNGPGDPAATGK.Y +230.601940.6604
K.VTVVPATTSAEDILAMKPDGVFLSNGPGDPAATGK.Y +345.543349.942347.5398
R.EWPGLEGMDLVPMVTSAQR.F +232.448530.457137.4437
R.FTWDETPWAWGESFGR.Q +239.8258
R.GIIGLSGIDTR.A +251.833235.2205
R.HLDAWLK.A +131.467626.907
R.HLDAWLK.A +234.272231.8483
R.KVIETGVPTFGICLGHQMLGLALGGK.T +234.657645.8775
R.KVIETGVPTFGICLGHQMLGLALGGK.T +360.510253.837160.9476
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA127815.231.131.144.450.3RPA1278 GatB/Yqey 1398724:1399179 forward MW:16225
-.MLRDDINNAVK.E +139.9163
-.MLRDDINNAVK.E +248.921340.0516
-.MLRDDINNAVKEAMK.A +237.1732
-.MLRDDINNAVKEAMK.A +355.610460.7036
K.NADIEAR.G +132.413
K.YAGQMDFGK.A +127.7853
R.AEIAVIQAYLPQQMSDDEVK.A +246.1555
R.GQGKPPLSDGDLLSLLQK.M +134.7584
R.GQGKPPLSDGDLLSLLQK.M +236.320651.080850.3811
R.GQGKPPLSDGDLLSLLQK.M +351.59556.8327
R.MVNSTIKNADIEAR.G +251.703739.455953.429341.0441
R.MVNSTIKNADIEAR.G +352.2811
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA128824.634.031.734.046.1rpoD RNA polymerase sigma 70 subunit, RpoD 1406728:1408824 forward MW:78741
K.IAKEPLSLETPVGDEEDSHLGDFIEDK.N +234.130448.682735.1674
K.IAKEPLSLETPVGDEEDSHLGDFIEDK.N +352.806682.755886.1926
K.LQEQDIANQLQNEQLSPSQER.K +242.630934.8764
K.NAVLPIDAAIQSNLR.E +230.1532
K.NNIGEPGEEAAAEGEGGAPAHVAPPAAPPSATPFRPAQQR.G +366.19255.5798
K.TVQVQDKDKDDKVDAPEKDSVDAPSPLLDLSDAAVKK.M +345.6175
K.VVETFDKIADNYKK.L +234.9547
R.DIIDLEATYAGPEGK.N +136.51235.3008
R.EGEIAIAK.R +126.5808
R.FGIGMNTDHTLEEVGQQFSVTR.E +264.09465.99672.777974.6896
R.FGIGMNTDHTLEEVGQQFSVTR.E +369.567368.443166.814767.1875
R.GAAPAEAEGEGAPEGDGDDDEFENQMSLAAIEAELKPK.V +357.679167.83468.255977.6658
R.GLQFLDLIQEGNIGLMK.A +145.934341.7939
R.GLQFLDLIQEGNIGLMK.A +270.977649.947964.660247.9062
R.GLQFLDLIQEGNIGLMK.A +368.634371.5625
R.IDSLVEQLYDINK.K +128.0735
R.IDSLVEQLYDINKK.L +130.578433.0453
R.IDSLVEQLYDINKK.L +251.119653.307247.1719
R.KLQEQDIANQLQNEQLSPSQER.K +273.312574.254680.278875.048
R.KLQEQDIANQLQNEQLSPSQER.K +367.111
R.KLQEQDIANQLQNEQLSPSQERK.Y +245.635
R.LVISIAK.K +125.418725.8974
R.MRFGIGMNTDHTLEEVGQQFSVTR.E +353.9977
R.QMLNEIGREPTPEELAEK.L +234.760431.0799
R.TIRIPVHMIETINK.I +245.3254.603642.8057
R.TIRIPVHMIETINK.I +355.5102
R.TIRIPVHMIETINKIVR.T +351.947845.818159.188274.737
R.VLASLTPR.E +239.949139.5723
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA129814.311.121.611.124.8RPA1298 putative 3-oxoacyl-acyl carrier protein synthase III 1417955:1419070 reverse MW:40270
-.MRPAVIAATGLYTPPDSVSNAELVEAFNTYVANFNAANK.A +348.8312
R.DKADKLFVQQGR.K +234.7492
R.IEAGEIEPLQPSSSEFIEK.A +240.882542.988351.156635.9109
R.SNDELSILAEMAVTAAEQAIER.W +268.583239.689748.036154.6472
R.SNDELSILAEMAVTAAEQAIER.W +376.002346.396585.6425
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA141517.115.011.811.426.1RPA1415 possible branched-chain amino acid transport system substrate-binding protein 1566319:1567563 forward MW:45001
K.GLQFAEDR.L +236.2501
K.IQLLQADDASQPAR.T +127.5316
K.IQLLQADDASQPAR.T +259.422269.1989
K.SLEPDALLEAFK.S +137.865936.6225
K.SLEPDALLEAFK.S +240.937245.0933.063
R.IGQGAVQYAQGAR.V +126.377231.8167
R.IGQGAVQYAQGAR.V +253.992657.74653.496131.8007
R.LLTDGSAMMIQWMPDQSQEVVFPK.E +230.3918
R.NLFGMTGFSAGAK.M +129.9465
R.SLKPDVVTGLVTPR.D +239.1716
R.VLQQVLENAK.S +131.339328.268635.2499
R.VLQQVLENAK.S +241.496850.288636.861
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA142880.575.185.679.886.4RPA1428 possible lipoprotein 1582970:1583743 forward MW:27813
K.ALADLK.Q +128.571
K.ALADLKQGATVAIANDPSNGAR.G +251.691765.452363.788754.6984
K.ALADLKQGATVAIANDPSNGAR.G +353.6896
K.ELEANSFQHEPYLK.A +239.485350.9997
K.FVELDAAQLPR.S +141.927537.47444.249440.2572
K.FVELDAAQLPR.S +272.847571.412171.486872.1036
K.LKDGVGATATVADIIDNPK.K +126.33542.596235.638244.307
K.LKDGVGATATVADIIDNPK.K +287.431494.127390.77892.0491
K.LKDGVGATATVADIIDNPK.K +365.324151.4805
K.LKDGVGATATVADIIDNPKK.L +242.952965.205661.6634
K.LKDGVGATATVADIIDNPKKLK.F +267.790367.18665.540962.1574
K.LKDGVGATATVADIIDNPKKLK.F +349.978462.6056
K.QGATVAIANDPSNGAR.G +239.199134.2106
K.QLIDAYHSDPVK.Q +127.85726.4981
K.QLIDAYHSDPVKQFVETR.F +241.04838.911345.106637.1323
K.QLIDAYHSDPVKQFVETR.F +349.0931
K.VANTIASPQGVYSVK.V +132.614336.929433.058530.5447
K.VANTIASPQGVYSVK.V +250.856442.781233.201946.5709
K.VANTIASPQGVYSVK.V +346.9992
K.VKALADLK.Q +129.165625.5995
K.VKALADLKQGATVAIANDPSNGAR.G +237.4322
R.EEDKDKPWVK.Q +132.6329
R.ENVEGPWVNIIAVR.E +241.587161.844951.455951.0619
R.ENVEGPWVNIIAVREEDKDKPWVK.Q +347.57
R.FKGTYIPAW.- +126.887626.16525.0335
R.FKGTYIPAW.- +238.543440.321935.7825
R.GLDVKPVEFTDYVVPNQALAQK.E +242.075456.449659.575952.553
R.GLDVKPVEFTDYVVPNQALAQK.E +347.831859.896552.0746
R.GLDVKPVEFTDYVVPNQALAQKELEANSFQHEPYLK.A +358.30454.868957.613867.8827
R.GLDVKPVEFTDYVVPNQALAQKELEANSFQHEPYLKAQVAK.T +349.104354.3448
R.GLQILALHGLIK.L +142.158744.572245.727143.4446
R.GLQILALHGLIK.L +270.831165.137456.417161.1116
R.GLQILALHGLIK.L +357.711650.294950.3296
R.SLQDVDLVSINNNYAVQAGLDPSKDALAR.E +230.076835.697139.9199
R.SLQDVDLVSINNNYAVQAGLDPSKDALAR.E +345.3557
R.VGVTAGPHAEILDVVK.K +144.135946.051440.25138.2757
R.VGVTAGPHAEILDVVK.K +262.948360.965858.390546.1007
R.VGVTAGPHAEILDVVK.K +348.2806
R.VGVTAGPHAEILDVVKK.V +138.851745.294736.693341.8649
R.VGVTAGPHAEILDVVKK.V +263.263360.787856.202441.6881
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA143041.859.838.330.359.8RPA1430 putative outer membrane protein 1585538:1586323 reverse MW:28190
K.ATIADIAENPK.H +125.778130.060435.68
K.ATIADIAENPK.H +243.64751.309
K.ATIADIAENPKHLK.I +132.0716
K.ATIADIAENPKHLK.I +239.516848.2013
K.FVEIYRSPEVK.A +127.806329.5137
K.FVEIYRSPEVK.A +239.1651
K.ITEFTDYTVPNAALAQDDLDINNFQHQPYLDNQVAQR.G +348.066348.1729
K.IVELDAAQLPR.S +130.106325.565433.2999
K.IVELDAAQLPR.S +274.447770.937760.794556.9149
K.LKPGIGIK.A +125.497525.605827.8711
K.RFNGTILTTW.- +232.4844
K.SIIVPIGIYSNK.V +131.7237.146431.6952
K.SIIVPIGIYSNK.V +239.457240.9417
K.SIIVPIGIYSNKVK.T +134.820634.529332.6223
K.SIIVPIGIYSNKVK.T +240.767933.4235
K.TLTDIKDGASAAIPNDPSNGAR.A +257.625564.229163.154456.8847
K.TLTDIKDGASAAIPNDPSNGAR.A +347.191249.2558
R.ALQLFEK.A +131.331431.738533.30330.4313
R.ALQLFEK.A +234.7997
R.GYDIVSIAK.S +133.350630.331929.931326.9589
R.GYDIVSIAK.S +233.1952
R.IGTTAGPYAEILR.Y +127.6946
R.IGTTAGPYAEILR.Y +237.039
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA144126.425.645.119.447.6RPA1441 possible uridylate kinase 1597783:1598604 reverse MW:28717
K.HNGTLPLDR.A +126.6591
K.HNGTLPLDR.A +231.1854
K.LIAETSYADLAK.H +137.1935.744944.934840.3429
K.LIAETSYADLAK.H +267.314361.696541.478259.6548
K.SGKLTAALRGQHVGTLIK.T +231.483634.1838
M.ADTNHIKHVASPLAR.Q +231.5451
R.ALFDVMANAR.H +130.938334.8831
R.ALFDVMANAR.H +248.842934.07454.5556
R.ALLPEHR.L +231.1829
R.AVVASAFPPYHNHEFPGAR.L +347.0472
R.GAEAILPIVDELR.A +146.595341.318240.374742.9235
R.GAEAILPIVDELR.A +247.133140.147540.33431.7687
R.GQHVGTLIK.T +127.900230.5021
R.ILPWLQVVK.I +132.807333.6979
R.ILPWLQVVK.I +231.690235.312943.5523
R.LLILTGAGVR.A +248.317452.866154.843
R.VQVVNGLK.S +126.1173
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA144265.676.780.480.483.0RPA1442 possible uridine monophosphate kinase 1598614:1599426 reverse MW:28801
K.AKGLHDSILEFPVLDLLK.S +244.892754.53152.174456.5954
K.AMIYVK.D +126.0113
K.AMIYVKDENGLYTENPKTSK.N +253.466639.7582
K.GLHDSILEFPVLDLLK.S +154.43255.191347.245148.9873
K.GLHDSILEFPVLDLLK.S +271.555961.364966.452564.3013
K.GLHDSILEFPVLDLLK.S +360.173557.434966.389963.122
K.HGISSVGDAGLSAVPLYLK.E +135.736935.636753.225735.4666
K.HGISSVGDAGLSAVPLYLK.E +277.262783.883287.191689.2313
K.HGISSVGDAGLSAVPLYLK.E +353.4316
K.IGGQSMIDR.G +127.086225.8716
K.IGGQSMIDR.G +252.650945.50332.2861
K.ISVDEMK.A +130.958133.8893
K.LLIGTGAGTR.A +241.529140.661236.306936.8224
M.AHTPAELEALLMQR.S +141.604343.069941.097838.7078
M.AHTPAELEALLMQR.S +247.701356.84235.073859.3183
M.AHTPAELEALLMQR.S +357.813165.07569.573
R.AAVYPLVEEIVSAR.K +132.7584
R.AAVYPLVEEIVSAR.K +265.806761.015339.143740.0334
R.ALAGEHVGTIITAN.- +132.029138.590934.68437.101
R.ALAGEHVGTIITAN.- +236.610433.848536.4439
R.ARHLYSIAAGLNLPAGVLSQLGASVASQNAEMLGQLLAK.H +376.224879.180569.25187.7089
R.EVQVVNGLVPGNLTR.A +129.089234.863729.269927.1944
R.EVQVVNGLVPGNLTR.A +256.904151.673457.798134.857
R.HLYSIAAGLNLPAGVLSQLGASVASQNAEMLGQLLAK.H +255.000355.521663.435561.2266
R.HLYSIAAGLNLPAGVLSQLGASVASQNAEMLGQLLAK.H +357.267884.244166.224170.5043
R.HVREVQVVNGLVPGNLTR.A +234.607534.4101
R.ILPDATVIK.I +129.154931.62929.2131
R.SMSDPELLAATEAATDYR.I +131.800326.548432.224225.6605
R.SMSDPELLAATEAATDYR.I +287.733494.834282.222285.4695
R.SMSDPELLAATEAATDYR.I +348.7841
R.TDAGCYLMAEQFGCK.A +126.531638.890531.127
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA146323.911.024.313.435.3ilvD2 dihydroxy-acid dehydratase 1621994:1623850 forward MW:65722
K.ACALITDGR.F +244.4781
K.IAPSVSDVHMEDVHR.A +233.5862
K.THAVDLIDAMVAAADSAMSDEDVQTMER.S +272.231176.386971.221861.0426
K.THAVDLIDAMVAAADSAMSDEDVQTMER.S +356.789758.4936
R.AAPGGVPSQTAFSQDR.R +236.3353
R.AGGIMAILGELDR.A +264.467157.920260.335455.7189
R.AGLLDTSCTTVHSETLGAALAR.W +250.025
R.AGLLDTSCTTVHSETLGAALAR.W +345.2931
R.ATGMKDSDFGKPIIAVVNSFTQFVPGHVHLKDLGQLVAR.E +354.9607
R.FSGGTSGLSIGHVSPEAAEGGLIGLVR.D +246.555456.508557.897151.3114
R.FSGGTSGLSIGHVSPEAAEGGLIGLVR.D +354.711564.342275.118252.3129
R.GGPGMQEMLYPTSYLK.S +232.6765
R.LFVEAGHTIVDLAR.R +128.4939
R.LFVEAGHTIVDLAR.R +238.300741.4152
R.NIANFK.A +128.657
R.TISLDVSEAELAK.R +127.0225.7919
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA14849.518.216.011.320.0pgm2 phosphoglucomutase 1646478:1648130 forward MW:58363
K.LGIDPLGGAAVHYWQPIIER.Y +235.289543.71839.798647.6171
K.LGIDPLGGAAVHYWQPIIER.Y +352.1839
K.TVDPNSLVNVPR.L +241.85231.730651.086634.2595
R.ARKASCVHRRDYITPYVEDLANVVDMEAIR.S +352.0574
R.DYITPYVEDLANVVDMEAIR.S +245.002148.250949.490754.271
R.GGYTPTPVISHAILTHNR.G +240.107537.4728
R.LTAELGAPFYAR.I +236.1263
R.LVTAYFAGKPDPAVATER.V +230.6475
R.LVTAYFAGKPDPAVATER.V +346.762
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA149427.332.423.620.832.4RPA1494 unknown protein 1657406:1658056 forward MW:22587
K.AGVSRAEAATLADYLKK.G +352.7642
K.ILDGYGPNPISLK.S +142.316238.843339.857540.3898
K.ILDGYGPNPISLK.S +260.438959.067441.851545.3423
K.ILDGYGPNPISLKSSSSSR.A +232.9713
R.AEAATLADYLK.K +137.333634.195632.791229.8888
R.AEAATLADYLK.K +255.085863.259948.57636.7624
R.AEAATLADYLKK.G +241.026944.57437.8095
R.LSALESDLK.S +128.022626.802726.8633
R.LSALESDLK.S +238.5764
R.LSALESDLKSNSFK.Y +147.927349.939132.1453
R.LSALESDLKSNSFK.Y +243.945444.071234.049
R.LSALESDLKSNSFKYAVVTAGR.S +270.727654.93
R.LSALESDLKSNSFKYAVVTAGR.S +345.6524
R.SSAEETAAALLK.A +139.020628.32130.99828.0828
R.SSAEETAAALLK.A +258.777764.077561.475149.769
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA149580.492.826.843.392.8RPA1495 unknown protein 1658072:1658365 forward MW:10836
K.GEYQSFSGTPLILK.Q +129.9542
K.GEYQSFSGTPLILK.Q +247.542565.4859
K.GEYQSFSGTPLILKQEGEYRGFSGAPLILK.Q +350.9109
K.GYSGTPLILEQK.G +127.0434
K.QEGEYKGYSGEPLILK.Q +243.713230.282930.1513
K.QEGEYRGFSGAPLILK.Q +230.1883
K.QEGEYRGFSGAPLILKQDGEYK.S +237.826846.8431
K.QEGEYRGFSGAPLILKQDGEYK.S +348.793951.4484
K.SFSGYPLLLNI.- +125.861328.352926.523126.3997
K.SFSGYPLLLNI.- +262.521249.241
M.SEEYKGHSGHPLILK.Q +140.98635.582933.326431.359
M.SEEYKGHSGHPLILK.Q +253.282749.950645.591244.3289
M.SEEYKGHSGHPLILK.Q +364.768356.476
M.SEEYKGHSGHPLILKQEGEYK.G +251.6315
M.SEEYKGHSGHPLILKQEGEYKGYSGEPLILK.Q +230.3969
M.SEEYKGHSGHPLILKQEGEYKGYSGEPLILK.Q +347.809860.4138
R.GFSGAPLILK.Q +129.8868
R.GFSGAPLILK.Q +238.395731.8538
R.GFSGAPLILKQDGEYK.S +134.5122
R.GFSGAPLILKQDGEYK.S +249.4117
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA150060.355.366.863.366.8RPA1500 unknown protein 1665626:1666225 reverse MW:21445
K.AIAGIPSISSTLSAQR.A +135.02135.9067
K.AIAGIPSISSTLSAQR.A +239.029175.110767.408
K.GLTSLFR.D +237.821937.1103
K.IALMEQQK.A +136.226528.403334.278535.7953
K.IALMEQQK.A +238.845245.818248.0444
K.IALMEQQKAAYEAAT.- +128.0281
K.TLHTSEIDAR.N +127.541935.01938.7752
K.TLHTSEIDAR.N +242.096354.285
K.TLHTSEIDAR.N +355.2193
K.YDDALK.A +125.1737
K.YDDALKAIAGIPSISSTLSAQR.A +250.0921
R.DMIALHHGNAEELAGMLINAGETADDSGSFMSVVHR.T +372.218294.6487117.726118.037
R.NGYEEALEDAEGK.G +154.706949.7373
R.NGYEEALEDAEGK.G +275.535270.2015
R.NGYEEALEDAEGKGLTSLFR.D +230.504141.527269.470966.3738
R.NGYEEALEDAEGKGLTSLFR.D +350.96767.782368.0403
R.NLSKYDDALK.A +130.560639.639.9253
R.NLSKYDDALK.A +248.940854.1369
R.NLSKYDDALKAIAGIPSISSTLSAQR.A +241.754572.334863.6416
R.NLSKYDDALKAIAGIPSISSTLSAQR.A +385.378675.8051
R.SLFDGLDGSVLPGLIDGEK.R +138.982230.5815
R.SLFDGLDGSVLPGLIDGEK.R +249.808448.9805
R.SLFDGLDGSVLPGLIDGEKR.N +241.303846.953466.827567.2685
R.SLFDGLDGSVLPGLIDGEKR.N +349.39654.811766.135770.2486
R.TIMSVR.S +127.779430.133
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA150559.959.963.964.272.2RPA1505 putative porphobilinogen deaminase 1671137:1672120 forward MW:35601
K.DMPANEETPGLIVAATLAR.D +130.129830.4183
K.DMPANEETPGLIVAATLAR.D +264.995339.191338.7693
K.FETVGDSDQISK.L +130.541634.593937.657236.8869
K.FETVGDSDQISK.L +248.964358.01245.5319
K.GAAAVIEK.T +136.400533.481930.3472
K.GLTLEELKK.S +125.204928.9051
K.GLTLEELKK.S +231.7844
K.LLPHGGKGGAFVAEIR.A +256.316350.365241.578535.0575
K.LLPHGGKGGAFVAEIR.A +352.022853.899554.4276
K.QLSAAASELDPQIIK.F +128.849228.416226.476329.179
K.QLSAAASELDPQIIK.F +260.724560.649742.5545
K.QLSAAASELDPQIIKFETVGDSDQISK.L +242.580848.824748.676337.833
K.QLSAAASELDPQIIKFETVGDSDQISK.L +374.816879.5177.657552.6087
K.QRMPDGSEVGPADALIMAR.A +230.8011
K.QRMPDGSEVGPADALIMAR.A +345.672959.7223
K.RLFPEVEVIHFR.G +255.619151.547554.498249.5651
K.RLFPEVEVIHFR.G +375.736677.134172.130483.8193
K.SVMALAQTEDIAK.Q +136.331736.60641.786438.1418
K.SVMALAQTEDIAK.Q +272.635868.750468.483960.3079
R.DPACDSLVLR.K +132.896336.683629.479934.6752
R.DPACDSLVLR.K +254.729451.405656.745352.8804
R.DPACDSLVLRK.G +233.099756.2876
R.EVLWVLNGHCNSPIAAHSVITGDEMTLR.A +241.817240.0944
R.EVLWVLNGHCNSPIAAHSVITGDEMTLR.A +367.6254
R.GELHCAMHSLK.D +136.3271
R.GELHCAMHSLKDMPANEETPGLIVAATLAR.D +249.214357.116655.205262.2178
R.GELHCAMHSLKDMPANEETPGLIVAATLAR.D +364.842963.779193.416990.574
R.GKGYTIGTNAVR.R +126.3161
R.IAHDFTPEEMLPAAGQGIVAVECPVHEWK.T +235.103169.873655.519244.3656
R.IAHDFTPEEMLPAAGQGIVAVECPVHEWK.T +366.325970.878781.237193.1323
R.KGLTLEELKK.S +127.2824
R.KGLTLEELKK.S +241.463148.06534.6131
R.KSVMALAQTEDIAK.Q +145.539948.831651.337947.53
R.KSVMALAQTEDIAK.Q +271.146283.856267.934763.2056
R.KSVMALAQTEDIAK.Q +346.1785
R.LFPEVEVIHFR.G +136.936133.679837.1842
R.LFPEVEVIHFR.G +249.098250.028433.288342.9205
R.MPDGSEVGPADALIMAR.A +126.6602
R.MPDGSEVGPADALIMAR.A +243.852246.388158.563364.11
R.QYLALIDNHQSR.L +243.791
R.TVGLELLDK.G +127.787436.694629.585
R.TVGLELLDK.G +231.3785
R.TVGLELLDKGAAAVIEK.T +138.241431.514633.7254
R.TVGLELLDKGAAAVIEK.T +257.525671.820862.445265.8312
R.TVGLELLDKGAAAVIEK.T +349.545758.676
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA150638.545.632.942.450.3bchI putative Mg chelatase subunit Bchl 1672126:1673148 forward MW:37203
K.AFEPGLLAR.A +129.5546
K.AFEPGLLAR.A +246.463546.356638.432633.7124
K.ERLPEVTVSDAALER.A +244.616265.162453.966555.4548
K.ERLPEVTVSDAALER.A +353.0291
K.LALLIAAVDQK.V +239.276932.005649.647
K.TAQVPVPVVDLPLGATEDR.V +264.680275.724162.468349.3067
K.TAQVPVPVVDLPLGATEDR.V +351.61957.0991
K.TAQVPVPVVDLPLGATEDRVVGALDLER.A +230.398236.3173
K.TPDTLPER.I +232.6289
K.VGGVLAFGDR.G +136.172925.1958
K.VGGVLAFGDR.G +245.352445.6176
M.ATVFPFSAIVGQEEMK.L +126.782831.364431.8411
M.ATVFPFSAIVGQEEMK.L +256.841357.386651.731830.1556
R.ALAALEHDKTVTDEHLK.R +132.1197
R.ALAALEHDKTVTDEHLK.R +239.364835.955237.6337
R.ALAALEHDKTVTDEHLKR.I +264.914873.564867.673861.2552
R.ALAALEHDKTVTDEHLKR.I +361.69367.288962.9684
R.ALAALLPK.M +127.7204
R.DAFENDPAAFVADWSK.E +144.698348.384732.7808
R.DAFENDPAAFVADWSK.E +231.520970.3447.099652.6619
R.GFLYIDEANLLEDHLVDLLLDVAASGENVVER.E +244.517834.8922
R.GFLYIDEANLLEDHLVDLLLDVAASGENVVER.E +345.496250.9756
R.LPEVTVSDAALER.A +249.745337.490632.2077
R.VVGALDLER.A +125.863525.9655
R.VVGALDLER.A +240.425151.5823
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA150938.827.117.821.538.8hemE uroporphyrinogen decarboxylase 1676073:1677050 reverse MW:35798
K.VAIQGNLDPLLLIAGGSALDQGVDDVLNNFSSGR.H +273.158763.519873.147968.6542
K.VAIQGNLDPLLLIAGGSALDQGVDDVLNNFSSGR.H +378.366772.9889102.95587.2933
R.FEVGEGPRLDPLNSPDLVGTLNNAIDLSKLEPVFEALR.I +346.8322
R.GAGALLPAFVER.T +129.198826.1064
R.GAGALLPAFVER.T +233.135936.949130.5136
R.HIFNLGHGITPDAPIAHVEQMIK.R +253.296256.407760.930733.2789
R.HIFNLGHGITPDAPIAHVEQMIK.R +367.4165.709955.773366.401
R.HIFNLGHGITPDAPIAHVEQMIKR.V +237.996243.982243.712449.2799
R.HIFNLGHGITPDAPIAHVEQMIKR.V +359.429189.592289.321668.5035
R.TGVDAVSIDWTAEPAFVR.E +256.210946.8469
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA151514.021.932.732.732.7RPA1515 conserved unknown protein 1683019:1683855 reverse MW:29194
K.IHGHAAQAVPSSSGDDPADLIR.S +255.80875.829268.5473
K.IHGHAAQAVPSSSGDDPADLIR.S +354.7175
R.DLAIAGHDTGFGGSQEPLSAMIAK.L +235.550841.96161.853969.839
R.TLVLLGDTPSSLAAR.A +130.899629.4695
R.TLVLLGDTPSSLAAR.A +234.599339.517242.420635.2098
R.TPRPLIVCPDELPAGDAVLIAYDGSLPAMR.A +239.242334.5453
R.TPRPLIVCPDELPAGDAVLIAYDGSLPAMR.A +351.965545.2474
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA152219.614.88.48.422.6bchX bacteriochlorophyllide reductase subunit BchX 1690207:1691205 forward MW:34988
K.ATPTIIETSSK.K +128.005131.430431.316530.2452
K.ETQIIAIYGK.G +127.6519
K.SDTTSLLFGGK.A +130.774130.5526
K.SFTLANLSYMMAQQGKK.V +230.455
K.VLLIGCDPK.S +237.6064
R.AEASVEPDAPVTTPVTK.E +132.672739.705937.137
R.AEASVEPDAPVTTPVTK.E +239.718846.383338.238241.4402
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA153574.174.171.271.274.1cycA cytochrome c2 1703088:1703507 reverse MW:14633
K.ADQAVGVTK.M +136.176635.626139.368742.7961
K.ADQAVGVTK.M +254.533546.3758
K.AGEAVFK.Q +134.886435.680234.683533.8685
K.AGEAVFK.Q +246.3241
K.AGTAAGFTYSPLNHNSGEAGLVWTADNIINYLNDPNAFLK.K +351.986171.540476.0603
K.AGTAAGFTYSPLNHNSGEAGLVWTADNIINYLNDPNAFLKK.F +363.384245.093572.066663.8297
K.DVVAYLATLK.- +141.624336.68442.130543.0265
K.DVVAYLATLK.- +249.963849.262249.062846.1458
K.FLTDK.G +128.318628.48528.5151
K.FLTDKGK.A +133.067932.740333.561738.7479
K.FLTDKGK.A +234.606631.4713
K.FLTDKGKADQAVGVTK.M +155.341261.587452.259146.4865
K.FLTDKGKADQAVGVTK.M +274.560372.241873.834778.0967
K.FLTDKGKADQAVGVTK.M +359.017953.175857.977161.2322
K.GKADQAVGVTK.M +139.889243.019545.37539.6525
K.GKADQAVGVTK.M +254.044
K.KFLTDKGK.A +131.9391
K.KFLTDKGKADQAVGVTK.M +148.13361.016558.971151.6956
K.KFLTDKGKADQAVGVTK.M +269.753969.200164.792762.3369
K.KFLTDKGKADQAVGVTK.M +355.245654.303545.648765.23
K.LANEQQR.K +133.718930.180230.777531.8636
K.LANEQQR.K +231.802133.562933.2277
K.LANEQQRK.D +128.143927.7959
K.LANEQQRK.D +232.5993
K.LANEQQRKDVVAYLATLK.- +248.275757.18851.822554.4953
K.LANEQQRKDVVAYLATLK.- +356.171360.088167.4417
K.MTFKLANEQQR.K +140.600426.0955
K.MTFKLANEQQR.K +253.112
K.MTFKLANEQQR.K +348.1038
K.MTFKLANEQQRKDVVAYLATLK.- +232.2247
K.NMVGPALGGVVGR.K +125.91531.46331.609228.6447
K.NMVGPALGGVVGR.K +245.392654.776956.025261.3722
K.NMVGPALGGVVGRK.A +230.963834.986635.6973
R.ADKNMVGPALGGVVGR.K +133.662439.857232.472938.7522
R.ADKNMVGPALGGVVGR.K +260.558862.055863.136767.4438
R.ADKNMVGPALGGVVGR.K +368.302268.064678.036772.1503
R.ADKNMVGPALGGVVGRK.A +255.79554.597456.599545.2998
R.ADKNMVGPALGGVVGRK.A +356.473166.220464.066873.166
R.KAGTAAGFTYSPLNHNSGEAGLVWTADNIINYLNDPNAFLK.K +367.110688.9647
R.KAGTAAGFTYSPLNHNSGEAGLVWTADNIINYLNDPNAFLKK.F +357.517248.775975.554376.2827
R.KDVVAYLATLK.- +146.578242.320243.244343.2477
R.KDVVAYLATLK.- +270.072171.793469.187871.3057
R.KDVVAYLATLK.- +372.74178.671174.52974.0721
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA154868.657.362.060.080.0puhA H subunit of photosynthetic reaction center complex 1719692:1720459 forward MW:27242
K.GMFLDPR.D +234.94135.865532.2888
K.GMFLDPRDPNPVGMPVVGCDGVVGGTVTEVWVDR.A +350.9517
K.IGVPAPPDPK.T +130.517528.795228.750227.8962
K.IGVPAPPDPK.T +239.900243.025532.6962
K.LEEDKICAYYGAGTLYATPLR.S +245.1047
K.LEEDKICAYYGAGTLYATPLRSESLV.- +253.617951.355
K.TVPSTSNDRPNVALTPAAPWPGAPFVPTGNPFADGVGPGSYAQR.A +360.401365.108671.893451.4361
K.TYLLR.G +125.6541
K.TYLLRGGATK.T +129.775940.3326
K.TYLLRGGATK.T +250.603844.5193
K.VSVDAIR.G +231.8463
K.VSVDAIRGDQFAGVPTTSK.G +237.2463
K.VSVDAIRGDQFAGVPTTSKGDQVSK.L +240.295563.017845.8523
K.VSVDAIRGDQFAGVPTTSKGDQVSK.L +352.2354.2264
R.ADVPELGLDNLPIIVPLR.A +138.706241.397645.427938.9193
R.ADVPELGLDNLPIIVPLR.A +267.826872.590677.777671.0728
R.ADVPELGLDNLPIIVPLR.A +378.568375.446982.226466.6057
R.ADVPELGLDNLPIIVPLRAAK.G +254.938349.65245.174249.403
R.ADVPELGLDNLPIIVPLRAAK.G +353.763960.813552.8007
R.AEVLAR.Y +128.2866
R.DPNPVGMPVVGCDGVVGGTVTEVWVDR.A +236.724238.7412
R.DPNPVGMPVVGCDGVVGGTVTEVWVDRAEVLAR.Y +346.3566
R.GDQFAGVPTTSKGDQVSK.L +130.2713
R.GDQFAGVPTTSKGDQVSK.L +232.256149.1221
R.KRVLLPVPFALINDPFGK.V +237.427434.6173
R.VLLPVPFALINDPFGK.V +125.284
R.VLLPVPFALINDPFGK.V +244.115448.15535.0663
R.VLLPVPFALINDPFGK.V +3101.67583.3161
R.YLEVEVAK.S +140.32534.718636.64336.887
R.YLEVEVAK.S +246.396341.832635.513
R.YLEVEVAKSR.K +139.3782
R.YLEVEVAKSR.K +253.2648
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA156926.020.417.611.639.0RPA1569 O-acetylhomoserine sulfhydrylase 1742405:1743700 reverse MW:45789
K.AVDWVLHPTLENHPDYELAK.T +353.9997
K.AVLDFLQANK.A +242.9126
K.IPLLIDNTFATPYLSKPIELGADIVMHSVTK.W +345.0053
K.TLVIHPASTTHQQMSAEQLEAAGIGEELIR.L +236.271944.7423
K.TLVIHPASTTHQQMSAEQLEAAGIGEELIR.L +366.969765.9584
M.AAPKPPGFETLSLHAGQHPDPLTGSR.A +231.2193
M.AAPKPPGFETLSLHAGQHPDPLTGSR.A +348.8631
R.LSVGIETADDIIADLAQALR.V +272.221744.969832.786346.2681
R.LSVGIETADDIIADLAQALR.V +370.346
R.LTSHLANVGDAK.T +129.734438.2308
R.LVIGETIGNPGLEVLDIPK.V +246.4898
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA157216.823.517.514.830.8RPA1572 putative carbon-monoxide dehydrogenase large subunit 1747205:1749535 forward MW:81725
K.GCGESGAIGGPPCVVHGVLDALAPLGVTTLNTPLTPEK.V +348.0533
K.GCGESGAIGGPPCVVHGVLDALAPLGVTTLNTPLTPEKVWR.A +354.8414
K.GMPGVEAVLTGADLIADDVGTIPTLPIFK.R +269.563741.778956.675465.5026
K.GMPGVEAVLTGADLIADDVGTIPTLPIFK.R +368.7683
K.TGVYPEDALVAYAAVK.L +126.177831.6572
K.VDAAFASAAHTVSLDLVSQR.L +248.2489
R.ADNLPPINVTLDPSAPCKTNPLGAK.G +233.447636.902332.059247.5276
R.DALAEAILK.R +234.1688
R.GAGRPEAVYIVER.L +233.3688
R.KINYIKPSQLPYTNAVGQVYDSGAFAHMMDR.A +351.0509
R.LILHTQSQTPGQTR.D +152.9324
R.LILHTQSQTPGQTR.D +245.3811
R.LLTGHGGYLDDK.A +127.45
R.LLTGHGGYLDDK.A +233.7868
R.LLTGHGGYLDDKAAEGALWLVVMR.S +247.409745.9898
R.LLTGHGGYLDDKAAEGALWLVVMR.S +356.8699
R.SPHAHADIVSIDTEAAK.G +133.51327.7574
R.SPHAHADIVSIDTEAAK.G +246.467744.028233.2665
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA157323.515.226.033.334.3RPA1573 LemA family 1749613:1750227 forward MW:22473
K.FQQAQGELSSALSR.L +247.703570.032471.041
K.GFAQQEKDVLLGVTNAR.A +254.624848.431264.8857
K.SDELFK.N +129.731129.0349
K.VGSIQATPEVLNDPAAFQK.F +230.548254.124252.0543
R.AKVGSIQATPEVLNDPAAFQK.F +254.866
R.LLIVTENYPQLK.S +129.578731.5817
R.LLIVTENYPQLK.S +240.709748.1717
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA158634.233.833.827.147.4RPA1586 putative short-chain dehydrogenase/reductase 1765532:1766332 forward MW:28088
K.DALQGIEQETFLILPHPQVIDYMR.K +245.025740.955745.641339.5149
K.DALQGIEQETFLILPHPQVIDYMR.K +353.210861.117952.011646.5872
K.HGAVGFAESLAIAHK.A +363.7505
K.VVVADLDQAR.A +127.8029
K.VVVADLDQAR.A +265.705755.33750.583
K.VVVVTGGGNGIGQALCEAFHK.A +236.8148
R.AEAVAASIGGAAFK.C +136.1742
R.AEAVAASIGGAAFK.C +240.7681
R.GGGYFLNTISAAGLLSQVGSPAYSATK.H +258.229653.001343.829348.3811
R.VSILCPQGVDTNMLR.S +251.662548.286653.5688
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA158971.272.745.443.472.7rpsD 30S ribosomal protein S4 1768213:1768830 reverse MW:23559
K.EASKQLAFVLEASQLAER.D +256.273559.8984
K.EASKQLAFVLEASQLAER.D +345.8907
K.FARIPALSDVPFAVQMEPHLIVEFYSR.- +365.7451
K.GKLSDFGVQLR.A +245.896447.8340.837449.505
K.GKLSDFGVQLR.A +357.5668
K.GYYANISER.Q +130.665
K.GYYANISER.Q +238.256545.4591
K.LKGYYANISER.Q +134.789439.66627.938227.9277
K.LKGYYANISER.Q +247.701251.805244.314
K.LKGYYANISER.Q +354.697652.5624
K.LSDFGVQLR.A +128.74129.906227.0912
K.LSDFGVQLR.A +256.532655.94156.035551.9398
K.QKLKGYYANISER.Q +234.2788
K.QLAFVLEASQLAER.D +259.322944.5366
K.RVNIPSYKVR.V +231.1961
K.RVNIPSYKVR.V +349.2232
R.AKQKLKGYYANISER.Q +131.1963
R.AKQKLKGYYANISER.Q +242.5311
R.DVPDYIEVDHNK.M +142.249146.565649.423544.1192
R.DVPDYIEVDHNK.M +240.106630.835348.712850.1937
R.DVPDYIEVDHNKMTAK.F +128.567437.2896
R.DVPDYIEVDHNKMTAK.F +249.376445.032635.4817
R.IPALSDVPFAVQMEPHLIVEFYSR.- +248.946655.357247.055530.407
R.IPALSDVPFAVQMEPHLIVEFYSR.- +379.708878.43956.450175.3763
R.LDAVVYR.A +235.3072
R.LKGDSGENLIGLLER.R +140.718440.594734.330629.269
R.LKGDSGENLIGLLER.R +278.278276.379682.487275.6054
R.LKGDSGENLIGLLER.R +353.838664.779256.030346.5746
R.MGQNIWGRPK.S +236.502834.6836
R.QFHAIYVEATR.L +129.9698
R.QFHAIYVEATR.L +236.2131
R.QFHAIYVEATR.L +345.2801
R.RLDAVVYR.A +125.909725.22925.999
R.RLDAVVYR.A +249.612145.299552.744352.9264
R.VGDVIEVK.E +129.215930.726530.718425.0272
R.VGDVIEVK.E +254.143845.308550.6063
R.VGDVIEVKEASK.Q +136.553545.2947
R.VGDVIEVKEASK.Q +236.4716
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA159720.922.128.39.543.6purQ phosphoribosylformylglycinamide synthetase 1775573:1777783 forward MW:78471
K.EADLLAVK.T +128.1586
K.GLPTKAPWVLQGPGENAGVIDIGDNQAVVFK.M +245.2401
K.GWLGQSVYLR.E +241.324
K.ITPELIASHGLKPDEYQR.I +241.697841.9583
K.ITPELIASHGLKPDEYQR.I +349.8229
K.MESHNHPSYIEPYQGATTGVGGILR.D +234.400535.421243.5187
R.DINAPMGAAEALEK.L +151.422141.629846.234850.3437
R.DINAPMGAAEALEK.L +267.993938.610537.4134
R.DVFTMGARPIACLNALSFGDPSHPK.T +345.432
R.GILPTPSIGGVGVLDDFTK.S +135.750234.7562
R.GILPTPSIGGVGVLDDFTK.S +249.579852.706241.6242
R.HLVSGVVAGVGGYGNSFGVPTVGGQTR.F +274.0266
R.ILDLIGREPTFTELGIFSAMWNEHCSYK.S +345.6944
R.NITAVGGKPLAITDNLNFGNPERPEIMGQLVGCLK.G +357.662546.100963.1485
R.WVWEQYDHVIGGNTVQRPGGDAAVVR.I +347.5583
R.YCEADPFEGGK.Q +129.1302
R.YDGNILVNAMAVGLADADKIFLAAASGVGMPIVYLGSK.T +346.954246.2412
R.YVVTVK.E +126.069
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA160050.087.289.789.789.7RPA1600 BolA-like protein 1779811:1780047 forward MW:8390
K.AAIPDAEVTIRDLAGDGDHYAATVISETFR.G +348.696371.509965.2117
K.AAIPDAEVTIRDLAGDGDHYAATVISETFRGK.S +355.288349.71953.2441
R.DIEAMIK.A +133.742331.980130.681432.8093
R.DLAGDGDHYAATVISETFR.G +231.048742.84843.599431.6845
R.DLAGDGDHYAATVISETFRGK.S +352.4579
R.VQQHQIVYQSLQGQMGGVLHALALQTGVPEA.- +238.504441.631136.5909
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA160635.473.234.640.973.2RPA1606 conserved unknown protein 1786040:1786423 forward MW:14105
K.ANDVVLFMK.G +136.602130.981634.6062
K.ANDVVLFMK.G +251.062353.410132.0935
K.GEFVGGCDIVR.E +128.414228.7869
K.GEFVGGCDIVR.E +231.422334.034138.7532
K.GTPQFPQCGFSGQVVQILDHIGVPYKGHNVLENAELR.D +351.0601
K.LFTDK.G +128.318628.7656
K.LFTDKGIK.A +135.288633.9186
K.LFTDKGIK.A +235.491240.030731.7792
K.VYSNWPTIPQLYVK.G +128.005229.65731.07637.4352
K.VYSNWPTIPQLYVK.G +231.062731.4109
R.DGIKVYSNWPTIPQLYVK.G +230.26636.2509
R.EMFQAGELQK.L +135.142840.74242.814538.1885
R.EMFQAGELQK.L +241.330345.737147.167334.7315
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA160836.242.550.752.354.2RPA1608 Beta-lactamase 1787022:1788302 forward MW:47784
K.DMTTDHIAPNSGVER.D +134.444232.9603
K.DMTTDHIAPNSGVER.D +235.33140.581946.76334.4177
K.IIAEGKIPGAIVYIER.H +231.590831.923246.2839
K.IIAEGKIPGAIVYIER.H +345.6839
K.IPGAIVYIER.H +129.007925.262428.6842
K.IPGAIVYIER.H +245.005148.295833.1189
K.IYDGDPSNAEFAER.I +128.1246
K.IYDGDPSNAEFAER.I +265.420966.45975.422265.8694
K.KLVYEALDN.- +127.039325.451829.019828.6766
K.KWESGGGGLTSTPSDVIR.F +258.410650.666458.04557.4912
K.LPLQEQPGTLWDYGNSYEVLGR.V +248.083345.397645.1018
K.LVYEALDN.- +132.097328.382125.467929.2115
K.RPILVSDLLLHTSGITYGFYGDSLVR.K +383.700677.3891
K.RPILVSDLLLHTSGITYGFYGDSLVRK.T +352.971970.6875
K.WESGGGGLTSTPSDVIR.F +232.930446.541346.5241
K.YIPAFADTK.V +127.096228.297828.148326.1736
K.YLDFVAPK.R +130.6627
R.DVATKEPMTDDTIFR.L +134.888331.720937.5767
R.DVATKEPMTDDTIFR.L +235.791547.536847.755850.826
R.DYFYFPGDGFGYGYGLGVR.T +237.928662.091334.4951
R.IAKLPLQEQPGTLWDYGNSYEVLGR.V +240.879444.960251.602547.8254
R.IAKLPLQEQPGTLWDYGNSYEVLGR.V +379.0909106.915105.35390.4689
R.IDEFFNK.I +133.6148
R.MAQPMPNDADFR.V +239.622641.84836.5406
R.MLHNKGELDGKR.Y +128.92330.967832.0722
R.MLHNKGELDGKR.Y +237.3716
R.VIEVASGK.S +133.270337.003136.8873
R.YLSEAVFK.D +132.97827.364728.858826.6233
R.YLSEAVFKDMTTDHIAPNSGVER.D +248.086632.360542.776639.455
R.YLSEAVFKDMTTDHIAPNSGVER.D +358.030845.3458
R.YYLATDEQK.A +125.160227.029234.389337.8698
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA161450.856.442.138.569.5ivd2 isovaleryl-CoA dehydrogenase 1795195:1796367 forward MW:42136
-.MMSNAQSLFNFDLGETADAIRETVR.D +349.3388
K.ACDRGETTREDAAGAILYAAER.A +350.9553
K.LGALGLHGITVEEDYGGAGLGYLEHCIAMEEISR.A +254.517133.1695
K.LGALGLHGITVEEDYGGAGLGYLEHCIAMEEISR.A +354.129356.259985.379285.5117
K.LISGEHVGALAMSEPGAGSDVVSMK.T +262.734977.546480.778383.9791
K.LISGEHVGALAMSEPGAGSDVVSMK.T +346.685655.495566.037746.6053
K.LYEIGAGTSEIRR.M +232.805
K.MWITNGPIAETLVVYAK.T +250.496645.7754
R.AEAIDKTNTFPR.D +125.1647
R.AEAIDKTNTFPR.D +239.584936.2965
R.ATQCALDAIQLLGGNGYINDYPTGR.L +236.1004
R.AVLAAGPVGIMQACMDVVLPYVHER.K +264.697263.515673.209757.5319
R.AVLAAGPVGIMQACMDVVLPYVHER.K +364.993167.597778.213973.0206
R.ETVRDFAANEIAPR.A +239.2722
R.GITAFLIEK.G +134.128833.706732.5912
R.GSDTGELLFEDCEVPEENVLGEVGR.G +247.725568.781461.217239.0039
R.GSDTGELLFEDCEVPEENVLGEVGRGVNVLMSGLDYER.A +354.6306
R.GVNVLMSGLDYER.A +131.8335
R.GVNVLMSGLDYER.A +265.49165.694743.365
R.KQFGEPIGTFQLVQGK.V +250.838540.446831.7611
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA161818.924.112.816.032.9ilvX putative acetolactate synthase large subunit 1798909:1800453 forward MW:53599
-.MNGAESLVR.T +244.953538.8948
K.SSPAQIATLILPADTAWNEADGVADVPEDSQRPTYSPHAVEAAAR.V +345.0939
R.AEDMLTLDRPDLDWVALAK.G +246.851834.4968
R.AEDMLTLDRPDLDWVALAK.G +348.299554.2074
R.DGAAAIAAAK.S +130.661829.9225
R.DGAAAIAAAK.S +232.6665
R.IPYVVDAALPILK.Q +141.19337.1202
R.IPYVVDAALPILK.Q +272.421668.928148.924137.6495
R.MKGTPASTLLHLGPGLANGLANLHNAK.K +230.4082
R.SGEPTLLLLSGAALTEHGLALAQR.I +268.04174.675662.839857.1685
R.SGEPTLLLLSGAALTEHGLALAQR.I +369.567860.6595
R.VTEIGENSVAALEALAGALGAK.A +250.07938.8813
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA162079.279.240.679.279.2RPA1620 unknown protein 1801160:1801480 reverse MW:11535
K.AKLEGALQDNAIESLSGWGEATAAAR.- +245.558281.176867.3236
K.ETEEFLLLSPLVR.A +125.8938
K.ETEEFLLLSPLVR.A +231.6446
K.INALLEQETSLRQWLEQIR.A +233.3188
K.INALLEQETSLRQWLEQIR.A +357.080968.126163.901369.2471
R.AFDSGMTADHAAAVR.A +127.105831.069427.2577
R.AFDSGMTADHAAAVR.A +264.40379.271755.9463
R.AFDSGMTADHAAAVR.A +348.7454
R.GATVIAGLTQK.E +125.233334.04931.4036
R.GATVIAGLTQKETEEFLLLSPLVR.A +261.193980.254658.909961.016
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA162644.021.128.021.150.9RPA1626 conserved unknown protein 1806403:1807059 forward MW:23104
K.LLLNMLVIAQQTIPR.G +232.7504
M.SDTQSPAVQAPAPDALELAALLCSR.V +233.1136
R.GGTLTIDPIGEGDNLSFR.I +253.180743.191452.499434.2279
R.GHLEDDKTKLTWNLPR.L +230.4894
R.IVAAGINAR.T +238.4011
R.TPHNIVDLLNGTQSGPIESHGVQPYYTR.L +239.3849
R.TPHNIVDLLNGTQSGPIESHGVQPYYTR.L +359.782351.35375.485170.0977
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA1627
RPA1676
4.87.522.925.629.1
29.1
cheA2 multidomain chemotaxis histidine kinase CheA2 (Hpt, CheA, CheW, & Resp. Reg. Rec. domains) 1807250:1810063 forward MW:100762
cheA3 multidomain chemotaxis histidine kinase CheA3 (Hpt, CheA, CheW, & Resp. Reg. Rec. domains) 1864447:1867260 forward MW:100762
-.MDDLLREFLTETFESLDTVDNQLVR.F +231.8015
-.MDDLLREFLTETFESLDTVDNQLVR.F +356.86545.446
K.ALANGLVTEAELEK.M +135.7053
K.FIFAPGFSTAAAVTSVSGR.G +246.4611
K.GQATEVIDVAHFLPMAFSDWLAR.K +248.088545.1119
K.KSGGEGEGAAEGGAAGGVANQSIR.V +242.084362.599957.9863
K.SGGEGEGAAEGGAAGGVANQSIR.V +247.1353
R.DLAAELGK.Q +139.496427.466
R.DQLMPLVLMEGVEVATSGVQPILVFADEDR.S +261.638438.9162
R.DQLMPLVLMEGVEVATSGVQPILVFADEDR.S +381.24547.0657
R.EFLTETFESLDTVDNQLVR.F +256.518753.989
R.MQPIGNAWQK.L +125.7052
R.NASAEQLTSLLVFR.A +236.638144.7282
R.NMLGPVLK.A +126.7135
R.QVLDLIKDPLTHMVR.N +353.2811
R.SMGLVVDEIVDIVEEHLHIQVGSSR.E +230.9243
R.SVLLVDDSAFFR.N +126.121330.172
R.SVLLVDDSAFFR.N +255.419442.396239.7017
R.TNIDQIGGTIEVK.S +127.466132.385337.0163
R.TNIDQIGGTIEVK.S +231.278230.6634
R.VATSAVEGLSVLR.S +125.7106
R.VATSAVEGLSVLR.S +232.114446.2131
R.VNVDTLEHLMTMVSELVLTR.N +234.954959.137356.2768
R.VNVDTLEHLMTMVSELVLTR.N +346.369150.1249.413256.9217
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA1628
RPA1677
12.010.835.528.336.7
36.7
cheW2 chemotaxis signal transduction/oligomerization protein CheW2 1810060:1810560 forward MW:17971
cheW3 chemotaxis signal transduction/oligomerization protein CheW3 1867257:1867757 forward MW:17971
R.GESYGLLIDSIGEVLTLPDEGRETNPVNLDPR.M +358.451662.6086
R.LTRVPLAPDDVAGVLNLR.G +231.300748.7859
R.LTRVPLAPDDVAGVLNLR.G +365.8276
R.LTRVPLAPDDVAGVLNLRGR.I +346.6659
R.VPLAPDDVAGVLNLR.G +239.088952.209853.9392
R.VQDVFMPER.L +230.9907
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA162975.260.351.242.175.2cheY2 chemotaxis response regulator, CheY2 1810628:1810993 forward MW:13503
K.ALEACKHGLPDAVLLDWNMPVMDGYEFLR.N +239.694432.338
K.FQEVGLI.- +131.175130.7644
K.HGLPDAVLLDWNMPVMDGYEFLR.N +258.477165.90973.974364.1686
K.HGLPDAVLLDWNMPVMDGYEFLR.N +364.3096
K.VVFCTTENDVAHIAR.A +236.634644.0648
K.VVFCTTENDVAHIAR.A +351.0544
R.ALHAGANEYIMKPFDKDIVTAK.F +258.064944.584751.784462.2618
R.ALHAGANEYIMKPFDKDIVTAK.F +349.702357.569376.439165.5504
R.ILEGLDFEIVEAEDGEK.A +233.7306
R.ILEGLDFEIVEAEDGEKALEACK.H +233.0065
R.RILEGLDFEIVEAEDGEKALEACK.H +356.5171
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA165118.818.86.49.921.5RPA1651 possible leucine/isoleucine/valine-binding protein precursor 1834778:1835995 reverse MW:44250
K.INFISYDDAYSPPK.A +137.142426.3944
K.INFISYDDAYSPPK.A +242.719445.616455.9645
K.MLNEKGGINGR.K +255.6849
K.VGNFVPYSGPASAYGIVGQVQSAYVK.M +240.46836.1034
K.WIMATYPNAK.I +130.479926.7664
R.KINFISYDDAYSPPK.A +140.077846.480155.641957.7843
R.KINFISYDDAYSPPK.A +270.365775.462473.238182.7764
R.KINFISYDDAYSPPK.A +347.128848.321573.090681.4068
R.KLVEGDEVLFLYHTLGTPSNTAVMK.Y +250.84257.418641.6296
R.KLVEGDEVLFLYHTLGTPSNTAVMK.Y +355.390857.5232
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA165322.738.626.543.943.9RPA1653 conserved unknown protein 1837519:1837917 reverse MW:14676
K.HALEK.Y +127.781527.6592
K.IAAVETVDHPSDGQIVAHAR.K +267.062965.577482.784571.1037
K.IAAVETVDHPSDGQIVAHAR.K +377.202185.033482.426182.7452
K.YIADHNPALK.A +141.540140.486743.7707
K.YIADHNPALK.A +242.799946.483952.143143.8001
K.YIADHNPALKAK.I +147.0195
K.YIADHNPALKAK.I +234.0392
R.VFHFNPAEADK.L +128.6365
R.VFHFNPAEADKLVVHADNPNR.H +236.9498
R.VFHFNPAEADKLVVHADNPNR.H +365.4272
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA165968.981.181.677.689.8RPA1659 conserved unknown protein 1843683:1844273 reverse MW:23016
K.EEQLLFPAALETLTPEDWAK.I +234.870146.7695
K.ERNPAVAGTVGDIEKEHELEVDR.L +231.214149.423
K.ERNPAVAGTVGDIEKEHELEVDR.L +370.618177.554156.352379.0461
K.ERNPAVAGTVGDIEKEHELEVDRLANFAK.V +350.6938
K.FQNLYATILR.W +126.764831.107536.571936.4055
K.FQNLYATILR.W +259.830963.655158.25460.2963
K.VVDDVLADQELPR.Q +140.257643.322135.409539.2473
K.VVDDVLADQELPR.Q +276.330479.403273.052777.4262
K.VVDDVLADQELPR.Q +367.573569.9299
K.VVDDVLADQELPRQTFHAAAR.D +354.976648.2587
M.SRIIELLNDEHR.N +257.966165.254770.377463.8139
M.SRIIELLNDEHR.N +358.875263.405367.113170.0452
M.SRIIELLNDEHRNIAR.L +347.824651.619146.032763.3396
R.ERPDYEIFQAIIQYFK.E +265.368167.486
R.ERPDYEIFQAIIQYFK.E +350.9605
R.ERPDYEIFQAIIQYFKEYPEACHHPKEDVVYR.I +357.5769
R.HMLKEEQLLFPAALETLTPEDWAK.I +265.814675.182572.298867.2553
R.HMLKEEQLLFPAALETLTPEDWAK.I +374.712971.325273.871979.1984
R.IDDRKDPMFDGETASK.F +126.220335.003131.445
R.IDDRKDPMFDGETASK.F +241.481343.725835.520851.6298
R.IDDRKDPMFDGETASK.F +356.24745.159147.31
R.IDDRKDPMFDGETASKFQNLYATILR.W +355.819963.991368.724871.4606
R.IIELLNDEHR.N +128.8304
R.IIELLNDEHR.N +241.272433.8329
R.ILKERNPAVAGTVGDIEKEHELEVDR.L +233.328238.75
R.ILKERNPAVAGTVGDIEKEHELEVDR.L +347.056552.407383.675285.5715
R.KDPMFDGETASK.F +137.0864
R.KDPMFDGETASKFQNLYATILR.W +246.5714
R.LANFAK.V +125.125425.0277
R.LLDVLEQELSVFDR.R +134.299331.9646
R.LLDVLEQELSVFDR.R +273.65476.048171.303767.7911
R.LLDVLEQELSVFDRR.E +234.15931.374830.329835.2707
R.LLDVLEQELSVFDRR.E +346.164751.070848.7442
R.NPAVAGTVGDIEKEHELEVDR.L +273.781375.59279.091583.7332
R.NPAVAGTVGDIEKEHELEVDR.L +371.503152.996562.41768.45
R.NPAVAGTVGDIEKEHELEVDRLANFAK.V +231.907638.710130.3651
R.NPAVAGTVGDIEKEHELEVDRLANFAK.V +364.179361.954967.124854.6892
R.RHMLKEEQLLFPAALETLTPEDWAK.I +253.045251.6449.509840.5204
R.RHMLKEEQLLFPAALETLTPEDWAK.I +370.921261.600372.3414
R.WEQETAADR.S +128.392826.4311
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA166448.957.236.726.161.7RPA1664 Glyoxalase/Bleomycin resistance protein/dioxygenase domain 1849361:1849903 reverse MW:20106
-.MQIQQIHHVAYR.C +126.102630.0278
-.MQIQQIHHVAYR.C +273.55764.0658.540756.0166
-.MQIQQIHHVAYR.C +346.9661
K.ETVAFYGR.V +125.0788
K.SIYFRDPSGHRLEVAAWTATPEQLAQMK.S +346.7116
K.SVAHAMVDEWAVTK.K +140.6079
K.SVAHAMVDEWAVTK.K +246.6526
K.SVAHAMVDEWAVTKKPPR.H +244.3751
R.AEAEGLDVVGPTDHTIFK.S +141.596630.887532.243
R.AEAEGLDVVGPTDHTIFK.S +245.189341.258549.930947.1859
R.HTAWLHQK.E +132.6261
R.LEVAAWTATPEQLAQMK.S +130.136727.890941.078235.4935
R.LEVAAWTATPEQLAQMK.S +241.856637.8549
R.VMGMELIGAIAEDKVPSTK.A +247.818336.7613
R.VMGMELIGAIAEDKVPSTK.A +350.445963.862147.6129
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA166668.675.541.036.581.3hemN1 putative coproporphyrinogen oxidase III 1850616:1851965 reverse MW:49338
K.AFGCGEDWYAPEQDSLAELQR.D +258.252654.333143.038132.999
K.IGELGFTR.A +132.605628.0083
K.IGELGFTR.A +251.372646.2633
K.LTLTPEGVR.L +230.344530.1288
K.VQEAINRVQPPEMVAR.A +233.9106
K.YDPVADYVEHLIDEIDLVADALPGTMPVR.H +251.793754.5337
K.YDPVADYVEHLIDEIDLVADALPGTMPVR.H +351.2246
M.SSALDKYAK.S +134.655638.5444
M.SSALDKYAK.S +235.8439
R.AMQLFK.S +128.028326.7799
R.ASFGVQEFDPK.V +248.7799
R.ATQAETAAEALVK.G +138.715930.77436.226231.8446
R.ATQAETAAEALVK.G +275.710271.453742.5891
R.AVEAGKIPVAR.G +152.776640.5156
R.AVEAGKIPVAR.G +242.24141.670140.0808
R.DGAVVCNGSKLTLTPEGVR.L +235.8963
R.FEFLPDAEIAIESDPR.T +250.459643.7431
R.GHALTQQDNLR.A +131.851326.1126
R.GWLAQLDTDEPVSLYLHVPFCK.Q +240.980631.3587
R.GWLAQLDTDEPVSLYLHVPFCK.Q +345.429949.3634
R.HLHFGGGTPTVIDPQDLGALMTLLR.E +242.374142.063636.4008
R.HLHFGGGTPTVIDPQDLGALMTLLR.E +373.87389.0234
R.IGIDHFALPGDSLAIAAK.T +153.382455.739849.142.1111
R.IGIDHFALPGDSLAIAAK.T +256.393363.527765.28357.9858
R.IGIDHFALPGDSLAIAAK.T +369.808278.990966.1001
R.INFDLIYGLPYQTAEDLRR.T +349.680554.78445.1614
R.MIPDESLPKPELR.A +242.4914
R.NFQGYTSDAAQTLIGLGATSIGR.T +256.382884.833546.153156.0537
R.NFQGYTSDAAQTLIGLGATSIGR.T +358.362
R.NFQGYTSDAAQTLIGLGATSIGRTPSGYVQNISETGAWSR.A +349.0149
R.TLTEDMAAK.I +126.849126.022
R.TLTEDMAAK.I +231.1525
R.TPSGYVQNISETGAWSR.A +269.661171.327371.290230.7729
R.TVEQCVEMKPDR.V +246.292737.6005
R.VALFGYAHVPWVAK.N +138.603541.888725.062
R.VALFGYAHVPWVAK.N +249.396654.097737.467242.8763
R.VALFGYAHVPWVAK.N +347.646861.4471
R.VVASVFDTYLR.N +260.81163.670142.388148.1416
R.YTSYPTAPHFAK.D +126.9953
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA166813.819.324.118.436.8bchE Mg-protoporphyrin IX monomethyl ester oxidative cyclase 66kD subunit 1852676:1854373 reverse MW:63685
K.ANGFADIKFVDAMTEEISNEGLAK.I +234.514738.6063
K.DLDAIKPDWGVLNWNLYR.Y +242.7586
K.DLDAIKPDWGVLNWNLYR.Y +358.9981
K.FVDAMTEEISNEGLAK.I +128.173434.507543.654736.5471
K.FVDAMTEEISNEGLAK.I +284.933663.259134.198478.1529
K.IISDYQPDLVGATSITPSIYAAEEALK.V +241.97539.761743.317238.1281
K.IISDYQPDLVGATSITPSIYAAEEALKVAK.Q +231.3116
K.IISDYQPDLVGATSITPSIYAAEEALKVAK.Q +345.801351.717948.2606
K.ISHAQMADWEANADR.S +236.9031
K.KKVDFQFDTTR.K +128.7474
K.KKVDFQFDTTR.K +243.8339
K.KVVDEIQELVEK.Y +125.4489
K.KVVDEIQELVEK.Y +256.3982
R.AVASGNWPANR.S +231.7962
R.GEGEEIVVELAR.A +134.8736
R.KAAASQMAIVSACGGGTDQMEESEADAK.A +232.4712
R.KISHAQMADWEANADR.S +241.655
R.KISHAQMADWEANADR.S +346.667
R.MAMDWKPDLANWSMYTPWPFTPLFK.E +244.971839.3739
R.VGYWGPQSK.K +126.6599
R.VTDILRDEQLLK.F +240.306138.30331.0402
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA167312.610.36.48.912.6RPA1673 D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase 1858439:1860790 forward MW:88477
K.IANPTVLAR.I +241.1246
K.LQLDHIKPR.L +237.4286
M.SDVLSNDLLQK.M +134.921432.4267
M.SDVLSNDLLQK.M +233.0467
R.AHQVPIADFKNPEHLTLLEDWMR.S +244.301657.571952.5261
R.AHQVPIADFKNPEHLTLLEDWMR.S +354.711545.0421
R.GYGYEPHFVEGDDPAVVHQTLAATLER.V +249.15159.830551.382942.8027
R.GYGYEPHFVEGDDPAVVHQTLAATLER.V +371.2477
R.LLGHWGTTPGLNLLYVHLNR.L +242.250631.6981
R.LLGHWGTTPGLNLLYVHLNR.L +368.274856.236545.2889
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA16835.415.05.415.015.0RPA1683 3-oxoacyl-acyl carrier protein reductase 1874213:1874995 reverse MW:26966
K.ALNANMLTPIELIK.A +130.101432.070536.243327.721
K.ALNANMLTPIELIK.A +245.874850.478246.779440.3126
K.APIDVLGLSNGAR.S +239.99734.8048
R.SGLTGFVAGLSR.K +254.683444.5673
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA168440.714.233.614.244.7RPA1684 putative 3-ketoacyl-acyl carrier protein reductase 1875104:1875865 forward MW:26455
K.AMALELASSR.I +252.2813
K.FVSPYAISK.A +125.4243
K.LAIDTSEADWDKVIGANLK.G +241.980731.6361
R.MDVTDLGGMAAALDQAEAALGPITVLINNAGVATEK.L +245.234632.614340.223848.5983
R.MDVTDLGGMAAALDQAEAALGPITVLINNAGVATEK.L +371.423964.949778.996564.7118
R.QQGGNIVNIASVLGQSVLK.F +248.4469
R.VGHESDLDGAILLLASNASR.Y +253.039465.729
R.VGHESDLDGAILLLASNASR.Y +346.9096
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA168726.225.816.88.636.5RPA1687 putative aldehyde dehydrogenase 1882277:1883710 reverse MW:52265
K.NLTPVTLELGGKSPTIVDR.S +253.444959.710654.0154
R.FADLYPPYGAK.I +129.485735.8627
R.FADLYPPYGAK.I +237.9525
R.FEQAISADFGHR.S +230.52736.2622
R.IVAAEAGKNLTPVTLELGGKSPTIVDR.S +236.8291
R.IVAAEAGKNLTPVTLELGGKSPTIVDR.S +372.982384.932747.195
R.KVSTQLQFLPGKNR.L +232.9583
R.LKSLVDDAVAR.G +128.443433.4656
R.LKSLVDDAVAR.G +239.123850.3117
R.LLPQPLGVVGVIAPWNYPLQLTVAPAIGAIAAGNR.V +236.6117
R.LLQPASADDAAWAGKR.K +240.5626
R.LPFDHLMFTGSTR.V +231.145538.2729
R.LPFDHLMFTGSTR.V +362.8237
R.SADLDEVAPR.I +129.170128.1507
R.SADLDEVAPR.I +261.0476
R.SSTETLIAETLSLLGDIK.H +125.796827.200727.5041
R.SSTETLIAETLSLLGDIK.H +270.269466.203569.872562.3971
R.SSTETLIAETLSLLGDIK.H +364.145457.871675.6212
R.SSTETLIAETLSLLGDIKHTSR.H +249.475242.394831.881
R.SSTETLIAETLSLLGDIKHTSR.H +347.6662
R.VGRIVAAEAGKNLTPVTLELGGKSPTIVDR.S +345.714569.6756
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA169361.183.850.064.695.5sodB superoxide dismutase 1889961:1890557 forward MW:22515
K.AFVDSLINWEYVEELYSKA.- +263.394574.433175.88773.833
K.ETLEYHHDKHHQAYVTNGNNLLK.G +246.610230.985438.8901
K.ETLEYHHDKHHQAYVTNGNNLLK.G +346.4366
K.ETLEYHHDKHHQAYVTNGNNLLKGTEFEGK.S +230.398
K.ETLEYHHDKHHQAYVTNGNNLLKGTEFEGK.S +348.6336
K.FKTDFAAAGAGQFGSGWAWLSVK.N +240.3019
K.GSFNKNAPLFNNAAQHFNHIHFWK.W +236.177
K.INEDLGGFEK.F +143.080641.129646.3537
K.INEDLGGFEK.F +258.163455.114343.5051
K.KINEDLGGFEK.F +151.623349.287145.89145.0948
K.KINEDLGGFEK.F +263.92755.709656.0568
K.KINEDLGGFEK.F +353.924353.291
K.LPGALEK.K +128.1053
K.NAPLFNNAAQHFNHIHFWK.W +254.017250.993752.08751.8209
K.NGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYR.N +359.7043
K.SLEEVVK.G +129.720529.503725.168328.9519
K.SLEEVVK.G +236.290636.964634.3979
K.SLEEVVKGSFNK.N +147.971247.5621
K.SLEEVVKGSFNK.N +251.985453.43739.9615
K.SLEEVVKGSFNKNAPLFNNAAQHFNHIHFWK.W +352.2048
K.WMKPNGGGSKLPGALEK.K +132.086536.1245
K.WMKPNGGGSKLPGALEK.K +255.679942.171943.0515
K.WMKPNGGGSKLPGALEK.K +351.267
K.WMKPNGGGSKLPGALEKK.I +238.5123
M.TFTLPELPYAYDALQPYMSK.E +264.418961.70162.687767.7995
M.TFTLPELPYAYDALQPYMSK.E +365.690973.3887
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA170310.722.85.113.837.1RPA1703 putative acetyl-CoA acyltransferase 1901366:1902541 reverse MW:40978
K.IDDIDLFEVNEAFASIPAAWLK.A +232.6396
K.LMTTLIHALKQQNKR.Y +230.2619
R.GGDPVIMLEAPLPATEYALKK.A +241.6024
R.GGDPVIMLEAPLPATEYALKK.A +345.3094
R.LAGWHPVDLAASVINALVDR.S +246.470953.840549.80245.7719
R.LAGWHPVDLAASVINALVDR.S +353.480762.645646.8105
R.LNVNGGAIALGHPLGGSGTK.L +127.6765
R.LNVNGGAIALGHPLGGSGTK.L +231.4159
R.NAVLASKLPESVPGTSVDR.Q +237.1722
R.SGAAPDQIEDVIMGCVGQGGEQAVNVGR.N +238.3077
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA170558.959.250.046.462.8RPA1705 possible 3-hydroxyacyl-CoA dehydrogenase type II 1903489:1904565 forward MW:37664
K.AEAAHGIVR.V +131.656933.340931.8235
K.AEAAHGIVR.V +247.875949.731636.4767
K.EAIAK.A +125.5744
K.GGIVGMTLPVAR.D +133.072827.812
K.GGIVGMTLPVAR.D +260.45658.416558.115353.6663
K.NGAYPLDHFSR.I +126.9866
K.NGAYPLDHFSR.I +237.243533.2351
K.SLGSQVPHPAR.L +125.218735.01
K.SLGSQVPHPAR.L +244.441241.739735.032831.8011
K.TVSKNGAYPLDHFSR.I +125.2065
K.TVSKNGAYPLDHFSR.I +240.2052
K.VAAEIGGVACVGDVSQEAPVKEAIAK.A +272.430452.064769.479961.7328
K.VAAEIGGVACVGDVSQEAPVKEAIAK.A +365.531361.987749.874645.7312
K.VAVLDMNK.D +127.1377
K.VAVLDMNKDNAEK.V +148.534451.676845.953746.0731
K.VAVLDMNKDNAEK.V +257.089852.0649
K.VAVLDMNKDNAEK.V +346.5345
K.VAVLDMNKDNAEKVAAEIGGVACVGDVSQEAPVKEAIAK.A +376.517173.565881.911775.6278
R.AMAAKGAKVAVLDMNKDNAEK.V +347.9998
R.DLASMNIR.V +128.072925.503534.818832.3618
R.DLASMNIR.V +242.497145.100841.568941.0277
R.GVCINTASVAAFDGQIGQAAYSASK.G +236.425846.7095
R.IINVNLIGSFNCIR.L +125.45728.5026
R.IINVNLIGSFNCIR.L +262.636263.606659.9422
R.IINVNLIGSFNCIR.L +347.0309
R.KSLGSQVPHPAR.L +129.12633.0314
R.KSLGSQVPHPAR.L +240.5911
R.LGDPSEYASLAVQIVENPMLNGETIR.L +278.790379.514675.289473.105
R.LGDPSEYASLAVQIVENPMLNGETIR.L +386.756689.406996.508977.6961
R.LGDPSEYASLAVQIVENPMLNGETIRLDGAIR.M +346.5421
R.LVAER.M +130.649327.9838
R.MQSAPTIGEER.G +127.8804
R.MQSAPTIGEER.G +259.019754.831244.335941.4646
R.VLVNCAGIGGAVK.T +142.600940.425737.392736.0477
R.VLVNCAGIGGAVK.T +261.505257.720757.626954.4948
R.VMTIAPGLFLTPLLMGLSEDAR.K +268.890160.265564.93962.2729
R.VMTIAPGLFLTPLLMGLSEDAR.K +371.395577.217680.893977.9496
R.VMTIAPGLFLTPLLMGLSEDARK.S +254.087550.671955.234242.6263
R.VMTIAPGLFLTPLLMGLSEDARK.S +349.522253.132346.765853.1871
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA173447.251.839.436.955.6RPA1734 putative amidotransferase, subunit A 1938948:1940381 reverse MW:50316
K.IDRNLGVQGPMAR.N +231.596330.3951
K.SGEVTPIEVLDVLEER.I +129.106827.0736
K.SGEVTPIEVLDVLEER.I +268.929274.845952.389451.9887
M.AADQALVKETACAVVDKLK.S +232.9422
M.AADQALVKETACAVVDKLK.S +359.970850.2977
R.FAEAGVIVEQAQPDLSEAHECFQALR.A +236.465533.7015
R.FAEAGVIVEQAQPDLSEAHECFQALR.A +346.006645.843854.6344
R.GLLAGLPVPIKDLTAVAGVLTTQGSPIYKDNVPAR.S +355.439256.868168.310375.628
R.IAEVDGAINALPTLCFDR.A +242.865848.566444.46230.7143
R.NEAGLLAGAALLEDILGLK.S +150.261739.932642.16133.3196
R.NEAGLLAGAALLEDILGLK.S +287.71684.216476.233167.4914
R.NEAGLLAGAALLEDILGLK.S +398.623471.2939
R.NEAGLLAGAALLEDILGLKSTTPIDPRPAPASL.- +364.108154.7945
R.NLGVQGPMAR.N +234.614931.1459
R.NVEDVALLLDAMSGEYAADPLSIPSPATSFLAAAR.S +239.991546.211942.029643.6572
R.NVEDVALLLDAMSGEYAADPLSIPSPATSFLAAAR.S +358.91766.473549.9665
R.SAAGSSGGAAAALASGTAWLAHGSDMGGSLR.N +243.108637.8383
R.SDLMVEHLEGNGGVVYAK.S +244.8037
R.VAYSPDLGITPVDPEVAAVTR.K +258.668165.21458.808154.8575
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA174122.136.572.477.481.7RPA1741 possible branched-chain amino acid transport system substrate-binding protein 1947510:1948760 reverse MW:44690
K.AINKDYEK.N +128.3165
K.DLLVDAR.Q +128.0308
K.GLLTGLMLQWQDGK.Q +148.838156.6968
K.GLLTGLMLQWQDGK.Q +230.198633.074956.722531.9968
K.GLLTGLMLQWQDGKQVAVWPPEVAK.A +237.665844.4697
K.IEGSKPDVIITGISHVGVQPTVQWK.N +259.266457.2694
K.IEGSKPDVIITGISHVGVQPTVQWK.N +370.393867.7732
K.IGVIAEAQAIAGASIPQAAQLAAEEINAK.G +252.7549
K.KYGNYPSYAGYTAYDEVYYIAEAVKR.A +234.913941.5822
K.KYGNYPSYAGYTAYDEVYYIAEAVKR.A +375.161775.2616
K.LVEALEK.T +128.5037
K.NKYTFHGYLTSGELAQSVCDAAK.D +257.888971.856
K.NKYTFHGYLTSGELAQSVCDAAK.D +353.3705
K.NKYTFHGYLTSGELAQSVCDAAKDLLVDAR.Q +364.517465.6056
K.NQQVPIPMFGIASQATNETFGKDTNNASDGVLYQGVSGPGVAVTSK.S +353.291867.8502
K.SAVIMSEDAAWTKPLDVGYQECLPK.V +235.402340.31857.816653.1502
K.SAVIMSEDAAWTKPLDVGYQECLPK.V +385.404270.9343
K.SVPFAENFKKK.Y +230.4974
K.TPFVTPGAASNEITK.A +130.777632.7282
K.TPFVTPGAASNEITK.A +237.712641.6658
K.YGNYPSYAGYTAYDEVYYIAEAVK.R +242.487337.2104
K.YGNYPSYAGYTAYDEVYYIAEAVKR.A +240.041943.972741.136
K.YGNYPSYAGYTAYDEVYYIAEAVKR.A +349.119856.652
K.YTFHGYLTSGELAQSVCDAAK.D +230.5163
R.AGSTDGEKLVEALEK.T +142.090438.8275
R.AGSTDGEKLVEALEK.T +242.193758.381663.8987
R.AGSTDGEKLVEALEKTDYEGTIGR.V +239.208742.9244
R.AGSTDGEKLVEALEKTDYEGTIGR.V +381.878884.0826
R.AVNEDKVNAVIASYISEVVLALMPWASR.L +235.034380.6548
R.AVNEDKVNAVIASYISEVVLALMPWASR.L +346.5147
R.FSPDTTDFTPIFNK.I +137.768836.6587
R.FSPDTTDFTPIFNK.I +241.731664.62157.7785
R.FSPDTTDFTPIFNKIEGSKPDVIITGISHVGVQPTVQWK.N +354.22158.7538
R.KIEIVSYDNHSSSADSVR.A +230.890857.808870.662766.6617
R.KIEIVSYDNHSSSADSVR.A +371.239152.6755
R.LKTPFVTPGAASNEITK.A +130.62840.91733.74
R.LKTPFVTPGAASNEITK.A +235.596850.303350.729
R.LKTPFVTPGAASNEITK.A +347.948668.643273.459
R.VQFYGKDEPFTHGLK.Y +136.273534.2965
R.VQFYGKDEPFTHGLK.Y +240.749456.221954.044
R.VQFYGKDEPFTHGLK.Y +361.076450.6582
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA174846.744.361.965.571.3RPA1748 putative branched-chain amino acid transport system substrate-binding protein 1955272:1956519 forward MW:45278
K.AADADVLMPSSYTTDGILLIR.T +274.400748.083781.551178.3138
K.AFQTAAELINNKYDFDLPLAR.G +264.334665.673681.762577.4129
K.AFQTAAELINNKYDFDLPLAR.G +374.003886.143392.118886.9339
K.ALYDAVGDKIPGVISR.G +137.824438.8403
K.ALYDAVGDKIPGVISR.G +258.869360.592167.652262.3127
K.ALYDAVGDKIPGVISR.G +351.473446.547165.479663.1449
K.FVTIFPTQAAVADAIWPMP.- +255.167557.794755.835259.802
K.FVTIFPTQAAVADAIWPMP.- +355.2905
K.IAADIK.Y +129.860230.4464
K.INDMYKEK.S +126.7453
K.IRDALAATDMPGEQTIMPWSR.V +236.923336.997463.857457.786
K.KGQKIETLALFHEDTIFGTDSSNAQLK.L +230.5011
K.NIVAQDAGFSEK.A +130.30340.813641.487637.8144
K.NIVAQDAGFSEK.A +252.334543.678939.6812
K.STDGEKIRDALAATDMPGEQTIMPWSR.V +232.315638.412444.086441.7172
K.STDGEKIRDALAATDMPGEQTIMPWSR.V +379.214677.5094
K.YRANSPSLTAEVQQLK.A +132.1275
K.YRANSPSLTAEVQQLK.A +244.498565.115454.3543
K.YYFRPAPHDEMFSQAMFDFFDALKK.K +230.6303
K.YYFRPAPHDEMFSQAMFDFFDALKK.K +356.037846.579291.3478
R.AKSTDGEKIRDALAATDMPGEQTIMPWSR.V +230.546
R.AKSTDGEKIRDALAATDMPGEQTIMPWSR.V +380.033577.642
R.ANSPSLTAEVQQLK.A +146.487143.528438.942243.0075
R.ANSPSLTAEVQQLK.A +252.654335.035259.143360.4081
R.DALAATDMPGEQTIMPWSR.V +245.1878
R.GEGLPGLGGAK.V +133.380534.783134.9387
R.GSFSIDLAQK.R +125.406432.354
R.GSFSIDLAQKRPMVGK.I +127.9081
R.GSFSIDLAQKRPMVGK.I +242.7293
R.GSFSIDLAQKRPMVGKINDMYKEK.S +351.6832
R.LITQEK.V +129.6824
R.LVFADHQADPQKGR.A +131.124425.2953
R.LVFADHQADPQKGR.A +235.424641.910641.8148
R.LVFADHQADPQKGR.A +347.3566
R.TMGELGYK.A +129.401231.149429.939
R.VKFDETGQNTFADPVLLQYVGGK.F +261.938572.362775.641167.0387
R.VKFDETGQNTFADPVLLQYVGGK.F +366.539494.164593.6432
R.YQVPFLSADNSSPSLHRR.G +231.2125
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA175848.954.549.635.054.5RPA1758 putative enoyl-CoA hydratase paaG 1968171:1968971 forward MW:28971
K.ALEWGLVNR.V +245.3244
K.GAGAALETAFHPFLR.R +243.263534.8627
K.GAGAALETAFHPFLR.R +345.4859
K.HVTLDFDGPVAILK.L +129.180839.9629
K.HVTLDFDGPVAILK.L +257.397148.073863.656440.0953
K.HVTLDFDGPVAILK.L +362.7919
K.LAHDLANGPTIALSLIR.K +127.4533
K.LAHDLANGPTIALSLIR.K +262.207947.259851.254748.0269
K.LAHDLANGPTIALSLIR.K +347.2455
K.LDHQEVMNAVSIDMLGGLGEALDAIEDK.R +254.755157.829
K.LDHQEVMNAVSIDMLGGLGEALDAIEDK.R +358.5281
K.LDHQEVMNAVSIDMLGGLGEALDAIEDKR.A +235.858634.612249.4034
K.LDHQEVMNAVSIDMLGGLGEALDAIEDKR.A +358.574861.74975.585468.9102
R.IGLVPDCGSTWLLPR.L +241.540341.539547.9825
R.SVELSLLGEKLPADK.A +127.9526
R.SVELSLLGEKLPADK.A +233.4591
R.SVELSLLGEKLPADKALEWGLVNR.V +252.728443.91160.4016
R.VAGSTDDFKEGVGAFLEK.R +130.0038
R.VAGSTDDFKEGVGAFLEK.R +247.487251.434456.2853
R.VAGSTDDFKEGVGAFLEK.R +359.3564
R.VYEDAELWAETMK.L +125.4893
R.VYEDAELWAETMK.L +238.3407
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA177815.517.527.49.534.1RPA1778 putative Glu-tRNA amidotransferase 1993022:1994380 forward MW:47209
R.AFIHVDRDAALQAADAMDKLR.A +353.2153
R.ALDDNPPADSDAPAVAR.L +237.6499
R.DGAVPLSFSLDSIGPLAR.S +232.560432.805851.1304
R.IAVPTTVALDDLDAAVTAAFER.A +269.958166.371283.529376.2821
R.IAVPTTVALDDLDAAVTAAFER.A +368.413554.493
R.KLVEDCLAR.I +126.9406
R.LAPYDAVAMPTTAIAAPTIAELADDKAFTK.A +233.600331.0033
R.LAPYDAVAMPTTAIAAPTIAELADDKAFTK.A +345.443649.8153
R.NCTLINMIDGCAISLPCHQDGEPPIGLMLAGVNGTDR.E +345.3987
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA178210.115.511.626.529.8RPA1782 TrapT family, dctP subunit, C4-dicarboxylate periplasmic binding protein 1997376:1998386 forward MW:37078
K.AFDHYDMAR.D +126.5715
K.ALQDHEVYPLTDAQLAEWK.K +230.648437.157755.3605
K.LFGGTNVQASAPESR.D +243.531543.851749.6523
K.SGGDPAAVESDLQNALK.K +237.922248.054
K.VRPAQSTIGEMVK.L +254.358747.6872
K.VSLWVPPAHPLVPATK.A +346.610650.9269
R.MTVFPSEQLGK.A +244.8824
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA178972.275.177.776.177.7RPA1789 putative branched-chain amino acid transport system substrate-binding protein 2004817:2005974 forward MW:40884
K.ADVIMGSSVTPPTVAVSNVANEAQVPHIALAPLPITPER.A +355.378759.422160.926960.9196
K.ALVSEKDIAASQGVYSFTETDR.Y +254.100653.205976.259279.8671
K.ALVSEKDIAASQGVYSFTETDR.Y +353.6141
K.ALVSEKDIAASQGVYSFTETDRYGLDDR.S +346.892973.934260.2915
K.DGKYVMVK.- +136.620327.865731.993
K.EIGGHPLK.V +126.78
K.EIGGHPLKVIVLDDGGDPTAATTNAR.R +259.579159.441161.866857.7642
K.EIGGHPLKVIVLDDGGDPTAATTNAR.R +375.205167.401594.110787.6964
K.EIGGHPLKVIVLDDGGDPTAATTNARR.F +349.898261.3806
K.GLIYQTHGAASMDFIR.I +133.9769
K.GLIYQTHGAASMDFIR.I +234.559767.332256.8064
K.GLIYQTHGAASMDFIR.I +357.2827
K.KPGLELNTAYEAK.Y +125.766936.7136
K.LVAANPDAILVGASGTAAALPQTSLR.E +281.071583.263566.989473.7228
K.LVAANPDAILVGASGTAAALPQTSLR.E +364.194666.173562.684456.1259
K.LVAANPDAILVGASGTAAALPQTSLRER.G +353.915945.701756.1109
K.SAEGVLMASGPVMDPEGQDDSALTK.K +232.466151.389671.854871.2284
K.SAEGVLMASGPVMDPEGQDDSALTK.K +374.1484
K.SAEGVLMASGPVMDPEGQDDSALTKKPGLELNTAYEAK.Y +349.123752.636358.054763.0918
K.TVGYIGYSDSYGDLWFNDLKK.Q +238.405945.237750.966355.531
K.TVGYIGYSDSYGDLWFNDLKK.Q +348.0056
K.VIVLDDGGDPTAATTNAR.R +125.141
K.VIVLDDGGDPTAATTNAR.R +286.228884.654590.765596.0574
K.VLYEHMK.K +127.301128.261128.2649
K.VLYEHMK.K +231.491830.1481
K.WSVAMPQPIPIMGK.V +139.010237.720636.665537.2942
K.WSVAMPQPIPIMGK.V +243.053849.999548.869245.0477
K.YVMVK.- +125.956427.8005
R.AKWSVAMPQPIPIMGK.V +142.603448.838345.304140.5971
R.AKWSVAMPQPIPIMGK.V +262.849158.746562.246163.1654
R.AKWSVAMPQPIPIMGK.V +349.384458.952459.167861.2483
R.FARPDTSVAGQVLK.L +137.810634.31842.695538.0657
R.FARPDTSVAGQVLK.L +263.618662.700965.011461.1556
R.FARPDTSVAGQVLK.L +346.032257.488948.350653.2666
R.FVTESK.A +126.8249
R.GYKGLIYQTHGAASMDFIR.I +255.65166.31891.244683.9049
R.GYKGLIYQTHGAASMDFIR.I +352.5482
R.ILLTVK.D +131.279831.1896
R.ILLTVKDGK.Y +126.642626.618234.20733.9657
R.ILLTVKDGK.Y +237.552336.453930.788
R.ILLTVKDGKYVMVK.- +125.935539.64734.5974
R.ILLTVKDGKYVMVK.- +249.449646.3861
R.KALVSEKDIAASQGVYSFTETDR.Y +249.756955.909
R.KALVSEKDIAASQGVYSFTETDRYGLDDR.S +356.710361.8081
R.NALEFVAK.E +138.500734.760237.782636.942
R.NALEFVAK.E +237.801343.635347.882347.4863
R.SQFAAHSFDAFK.V +146.538243.943146.228746.486
R.SQFAAHSFDAFK.V +258.490958.181373.268970.3266
R.SQFAAHSFDAFK.V +347.8028
R.SQFAAHSFDAFKVLER.V +247.610154.757260.184550.2763
R.SQFAAHSFDAFKVLER.V +346.9032
R.VVPVALK.T +125.189826.4109
R.VVPVALKTAKPGTQEFR.E +246.739850.3958
R.VVPVALKTAKPGTQEFR.E +345.446246.401355.66354.1023
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA179846.569.151.347.474.7RPA1798 putative periplasmic binding protein for ABC transporter for branched chain amino acids 2017212:2018447 reverse MW:44344
K.AANPDVLVIFATPK.F +141.007733.885235.034434.0999
K.AANPDVLVIFATPK.F +260.709955.309445.292649.1883
K.AYYEFMAK.Y +128.50429.8215
K.DATDKQWENDPGMK.A +126.7948
K.DATDKQWENDPGMK.A +235.32
K.GVQLGGLLPGVTLNTSPTDFAPIEQLQMMR.F +237.530555.317146.875758.5854
K.GVQLGGLLPGVTLNTSPTDFAPIEQLQMMR.F +360.3739
K.IAVLYQGDDFGKDYLK.G +125.8994
K.IAVLYQGDDFGKDYLKGLKDGLGAK.V +261.352263.0775
K.IAVLYQGDDFGKDYLKGLKDGLGAK.V +353.936664.5118
K.IGNIVPYSGPASAYGSVGR.A +257.453759.324650.203963.9738
K.IKAANPDVLVIFATPK.F +130.1387
K.IKAANPDVLVIFATPK.F +238.3486
K.KVAELAWKPMMIVPNVSASTGSVMKPAGFENAQGIVSAAYAK.D +366.214168.3622
K.KVPHLFLASGATK.W +144.538747.162535.008545.9717
K.KVPHLFLASGATK.W +233.092340.7762
K.KVPHLFLASGATK.W +347.372348.0204
K.LVESDEVLFMFSPLGTPSNTAIQK.Y +240.029
K.MINDK.G +131.338434.3156
K.MINDKGGINGR.K +132.489633.0158
K.MINDKGGINGR.K +236.547255.559949.2277
K.QAANLKGVQLGGLLPGVTLNTSPTDFAPIEQLQMMR.F +356.1314
K.VAELAWKPMMIVPNVSASTGSVMKPAGFENAQGIVSAAYAK.D +352.448361.814952.6964
K.VSQVVIEDSYELTEPTVDSHIVK.I +241.973945.186453.759
K.VSQVVIEDSYELTEPTVDSHIVK.I +346.711858.401155.7765
K.VSQVVIEDSYELTEPTVDSHIVKIK.A +232.5731
K.YGPGASDTEVK.I +127.5658
K.YILKEKPEAK.I +132.973133.6795
K.YLNAK.K +127.367725.635625.4292
R.ENVMK.Q +125.600325.0455
R.FEGENWKLFGDVIEGEVAAPSGG.- +237.6015
R.KIVYVSYDDAYSPPK.A +237.8697
R.KIVYVSYDDAYSPPKAVEQTR.K +250.511535.7196
R.KLVESDEVLFMFSPLGTPSNTAIQK.Y +233.980937.552652.96140.8857
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA181160.665.660.647.965.6RPA1811 enoyl CoA hydratase 2038105:2038884 reverse MW:27791
K.AFAAGADIK.E +238.2941
K.AFAAGADIKEMQPK.G +131.276437.183433.3528
K.AFAAGADIKEMQPK.G +257.488663.418161.214557.5014
K.AMDLCLTGR.M +126.18132.526625.369626.1181
K.AMDLCLTGR.M +257.432850.591
K.FGQPEITLGTIPGIGGTQR.L +128.4136
K.FGQPEITLGTIPGIGGTQR.L +253.732259.868156.5458.1243
K.GFIDMFNEDFTSIGGDR.L +125.5942
K.GFIDMFNEDFTSIGGDR.L +265.471873.794372.128953.7091
K.IATMSRPTAAMAK.S +128.113725.895926.56
K.IATMSRPTAAMAK.S +248.151646.48747.280546.1089
K.LMEEALGAAEK.I +135.805835.047235.4586
K.LMEEALGAAEK.I +262.282644.151244.4069
K.MLNALSFGVFR.E +128.3272
K.MLNALSFGVFR.E +263.530959.147859.662960.2148
R.AEGMAAFIEK.R +133.343629.90635.120533.6388
R.AEGMAAFIEK.R +234.853847.1772
R.ALETTLAEGLAVER.D +127.697132.241327.240331.6474
R.ALETTLAEGLAVER.D +274.747168.882269.634241.8959
R.EIGAAVEDLEADDAIGCILITGSEK.A +234.862331.815946.0038
R.IVPADKLMEEALGAAEK.I +144.7659
R.IVPADKLMEEALGAAEK.I +259.992564.007870.695564.3884
R.IVPADKLMEEALGAAEK.I +350.682948.9193
R.QNAVGIIK.L +126.8874
R.QNAVGIIKLNRPK.M +234.1649
R.STFALEDR.A +129.1049
R.STFALEDR.A +241.14841.885335.103
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA182436.836.836.836.836.8RPA1824 unknown protein 2054711:2055226 forward MW:17579
K.LASLGSPNLPAMAK.V +137.120340.928240.534541.924
K.LASLGSPNLPAMAK.V +238.346140.294945.82142.6613
K.LIETASDCVK.T +136.990833.102832.241332.5433
K.LIETASDCVK.T +234.34531.6501
K.LIETASDCVKTGQACIAHCLQSFAAGDTSLAACAK.S +235.1063
K.LIETASDCVKTGQACIAHCLQSFAAGDTSLAACAK.S +365.302560.006268.944462.4342
K.SVDQMLSVCATLQK.L +126.720326.6372
K.SVDQMLSVCATLQK.L +230.1048
K.SVDQMLSVCATLQKLASLGSPNLPAMAK.V +257.552761.2073
K.SVDQMLSVCATLQKLASLGSPNLPAMAK.V +347.5334
K.TGQACIAHCLQSFAAGDTSLAACAK.S +243.172957.234847.89845.6004
K.TGQACIAHCLQSFAAGDTSLAACAK.S +357.776751.393
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA183721.214.19.56.430.2RPA1837 possible methylmalonyl-CoA small subunit 2064252:2066123 reverse MW:65276
-.MSSANQELR.L +125.0289
K.GLGDVAAGLASTGFKGPFLVADGR.V +233.3491
K.ISFTALTPIR.V +234.506335.0984
K.SYDGIQIDPIYVR.A +231.475935.5064
K.VFLANLGTPADFTAR.A +245.63567.813636.2742
K.VLDVKPAAVPPAGEAK.I +129.6994
R.AGGALAALQAGLIQPK.V +151.349529.995335.964644.7013
R.AGGALAALQAGLIQPK.V +236.5278
R.AGGALAALQAGLIQPK.V +350.3447
R.ALEAAGVSPEAAR.G +127.5792
R.AVQGSSATDWSEIAK.G +246.3
R.DVLTGASEFPNLHEAQAK.V +252.5108
R.FGIDPLGAR.A +230.6378
R.NTQLILLEESNLDKVADPAAGAGGIEALTK.E +233.7102
R.NTQLILLEESNLDKVADPAAGAGGIEALTK.E +351.2783
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA184312.519.013.27.125.4RPA1843 conserved unknown protein 2069189:2070799 forward MW:57304
K.AITELGKGEALVSFLEGNGTPAMVER.V +253.603661.5279
K.AVAAAADTFRPNPK.L +238.7884
K.SASEGPAPGEGGILGQLGGLFSTVFGTNTPR.G +265.521361.839156.904456.8153
K.SASEGPAPGEGGILGQLGGLFSTVFGTNTPR.G +346.502545.2015
R.AMLDAIAPIAQK.V +148.793643.4396
R.AMLDAIAPIAQK.V +250.4631
R.AQEIGLK.F +127.7551
R.ATVSEMGPLLLSR.M +230.458
R.GKLTTGQLVAR.N +126.945327.4956
R.IGPITPEER.K +232.6242
R.VADDMGLPLMDMK.D +239.372
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA184421.611.320.59.227.4RPA1844 putative peptidase 2071008:2072414 forward MW:50332
K.AAAEHLAADIASIGFDAEVRPTAGHPAIVAK.A +258.030552.2102
K.AAAEHLAADIASIGFDAEVRPTAGHPAIVAK.A +362.696858.720853.573475.2837
M.SASSHVQTVLAR.A +131.629732.837833.1416
M.SASSHVQTVLAR.A +247.038545.084232.225730.1009
R.AEFLDHSNGAAIALPWDMKPLTAASR.A +230.02253.766
R.ALTEEWGKEAVLIGSGASIPIVADFKR.T +347.3218
R.ILGALADAPR.- +259.788547.1649
R.ITIPGFYDGVKDLPPEILAQWK.G +238.8464
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA184623.032.426.648.452.5RPA1846 unknown protein 2075163:2075897 forward MW:26087
K.LVFKDQPKPK.T +129.1558
K.LVLDLVPAGQPGQFK.L +138.965134.9059
K.LVLDLVPAGQPGQFK.L +231.89242.739953.667944.6493
K.TASGFKLPFTAAAGDSIVAEDASYPLYTWK.Q +233.777733.883154.754146.0733
K.TKVTLTTQSGWAK.E +125.451628.9097
K.VTGTLLSAK.G +127.9394
K.VTGTLLSAKGEQKAEASK.T +242.2531
R.FGEFGENLR.E +235.959339.7735
R.LITGFAAQQPK.L +131.334129.13636.641933.7164
R.LITGFAAQQPK.L +254.449561.472262.867962.224
R.SGPKGAEPYDAVSYATTVTYEK.A +232.4805
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA19409.915.820.511.526.4RPA1940 putative quinone oxidoreductase 2182941:2183909 reverse MW:33691
-.MKAYVYGAGGAAITEVDKPAPKGPQVLIR.V +233.1331
K.LPIDK.V +125.647226.7374
R.LLPIPDGLSFEEAATLPVALTTMHNAVVAIGK.L +232.398433.094836.108733.1013
R.LLPIPDGLSFEEAATLPVALTTMHNAVVAIGK.L +354.263348.20554.338169.7076
R.VMGSTAGAFGEYTLADHGR.L +251.6975
R.VMGSTAGAFGEYTLADHGR.L +350.7177
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA195526.834.744.240.754.7RPA1955 glutathione dependent formaldehyde dehydrogenase 2198871:2199980 reverse MW:39631
K.AGEVLVEIK.A +129.3065
K.ATGICHTDAYTLDGFDSEGIFPSILGHEGAGIVR.E +236.133545.127158.385853.1456
K.ATGICHTDAYTLDGFDSEGIFPSILGHEGAGIVR.E +362.820782.553288.5562113.49
K.IEIDPMITHVLK.L +139.392731.911628.213
K.IEIDPMITHVLK.L +247.134841.028136.8115
K.IEIDPMITHVLK.L +349.5049
K.KIDGDIVQHLVGLTDGGADYTFDCTGNTNVMR.Q +238.835330.4008
K.KIDGDIVQHLVGLTDGGADYTFDCTGNTNVMR.Q +358.096
K.KPLEIVELDLEGPK.A +163.889658.39452.9528
K.KPLEIVELDLEGPK.A +240.362932.14751.986935.3218
K.KPLEIVELDLEGPK.A +345.8465
K.LEEINKGFDLMHQGK.S +138.818736.871
K.LEEINKGFDLMHQGK.S +254.673256.608748.2254
K.LEEINKGFDLMHQGK.S +347.535649.09847.7516
K.MVGADKIVGVDINDDKEEWGR.R +370.2938
K.MVGADKIVGVDINDDKEEWGRR.F +350.31
K.TNLCTAIR.A +238.7239
K.VTPGSNVVVFGLGGIGLNVIQGAK.M +232.0786
R.AAVAFEAK.K +131.7603
R.EIGPGVTSVKPGDHVIPLYTPECR.Q +239.217441.716847.030444.0437
R.EIGPGVTSVKPGDHVIPLYTPECR.Q +345.445154.12955.994755.044
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA197338.856.157.841.561.2RPA1973 3-hydroxyisobutyrate dehydrogenase 2221944:2222813 reverse MW:30320
K.AEPVIGAYAR.M +126.7904
K.AEPVIGAYAR.M +236.574632.2718
K.AGFHFIDAPVSGGQAGAENGVLTVMCGGRPEDFAK.A +345.203558.711454.5966
K.KAGLDVNAVIDTISK.G +244.8125
K.LLGPAGSGQLTK.M +128.847130.299832.173427.9743
K.LLGPAGSGQLTK.M +248.70748.712442.347833.6575
K.MVNQICIAGLVEGLSEGIHFAK.K +247.4769
K.MVNQICIAGLVEGLSEGIHFAK.K +357.382456.376169.1376
K.VAFIGLGVMGFPMAGHLVTK.G +346.8839
M.AKVAFIGLGVMGFPMAGHLVTK.G +270.6721
M.AKVAFIGLGVMGFPMAGHLVTK.G +366.861460.058
R.AAPTPAEAAAGQDFVMACVGNDDDLR.A +249.991940.155667.260340.0514
R.AVTTGADGAFGAMSR.G +252.595839.561835.7057
R.NGASLPVTALVDTFYAEVEK.M +234.695835.038230.5672
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA198120.745.346.131.950.0cbbI, rpiA, ppi ribose 5-phosphate isomerase 2230997:2231695 forward MW:24676
K.HFVELLGER.V +129.213332.111231.104431.9323
K.HFVELLGER.V +240.0471
K.LGLGTGSTAK.H +125.567425.6326
K.LVDTLGRFPLPIEVIPFGLGATR.R +231.668330.133934.8191
K.LVDTLGRFPLPIEVIPFGLGATR.R +356.266847.8324
K.LVDTLGRFPLPIEVIPFGLGATRR.A +347.944552.557856.4719
R.ALQNAFTAAGCDGELK.L +129.4516
R.ALQNAFTAAGCDGELK.L +240.182838.1072
R.LAQLLSVIPGVVEHGLFVGMASTVVLAGADGIR.T +231.9664
R.LAQLLSVIPGVVEHGLFVGMASTVVLAGADGIR.T +348.27951.3788
R.LGLEIIGVPTSEVTR.A +128.682626.5212
R.LGLEIIGVPTSEVTR.A +237.025340.132936.0443
R.MIVIADESK.L +127.7143
R.RALQNAFTAAGCDGELK.L +234.5539
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA198263.759.864.265.970.4RPA1982 conserved unknown protein 2231692:2232231 forward MW:19915
K.DLVTFYKSPLGQK.L +154.037946.036642.408637.2822
K.DLVTFYKSPLGQK.L +241.041144.638950.1137
K.EILELK.R +132.300234.7199
K.EILELKR.A +128.588327.865728.923126.1366
K.EVAVVIAK.K +130.129226.456132.9468
K.FAEEVNGEFR.A +127.242227.062233.6082
K.FAEEVNGEFR.A +237.187138.236760.906546.958
K.IYATDFTEQELK.D +134.983739.568538.575934.9718
K.IYATDFTEQELK.D +257.670966.098452.777450.808
K.IYATDFTEQELKDLVTFYK.S +261.432156.710470.978674.33
K.IYATDFTEQELKDLVTFYK.S +346.057957.341751.264960.4019
K.IYATDFTEQELKDLVTFYKSPLGQK.L +258.719860.519268.513368.033
K.IYATDFTEQELKDLVTFYKSPLGQK.L +389.411685.7119104.7898.5745
K.LLTQEPK.S +130.758725.9859
K.QPSPAAIASAK.E +126.2084
K.RAGGIYAQAVPNIIQR.T +253.85654.713145.186152.5924
K.RAGGIYAQAVPNIIQR.T +350.457660.5779
K.SIAESMQFMNQWAQK.F +128.640335.869640.47249.4413
K.SIAESMQFMNQWAQK.F +267.936165.626466.647358.4006
R.AGGIYAQAVPNIIQR.T +147.935740.40646.57252.3086
R.AGGIYAQAVPNIIQR.T +271.121165.705869.667865.726
R.AGGIYAQAVPNIIQR.T +354.547
R.EKEIGDGMAK.I +132.090833.194935.906735.2718
R.TMDTLMQSNLNYQQDLK.E +241.551962.124162.218865.6938
R.TMDTLMQSNLNYQQDLKEVAVVIAK.K +239.406442.312950.298539.3857
R.TMDTLMQSNLNYQQDLKEVAVVIAK.K +354.1978
R.TMDTLMQSNLNYQQDLKEVAVVIAKK.L +365.9419
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA200025.236.714.55.537.4leuA putative isopropyl malate synthase 2249471:2251069 forward MW:58014
K.HIPGAHVGIHAHNDTEQAVANSFAAVR.A +255.205741.0031
K.LKER.E +128.7918
K.VLVSDQAGKSNVLAELAR.T +241.140840.4495
K.VLVSDQAGKSNVLAELAR.T +361.6205
K.YIEGLK.L +129.446726.0226
R.ALDNILDRAPNPHAPYVGGSAFVTK.T +248.918745.707338.1866
R.ALDNILDRAPNPHAPYVGGSAFVTK.T +355.970956.54460.8555
R.ILNGGTEAVTR.V +125.4026
R.ILNGGTEAVTR.V +250.709936.7626
R.LYLYDTTLR.D +231.137442.1874
R.QIQGTLNGLGER.C +234.6547
R.SASNDPGIAMLIDAK.A +131.3074
R.SASNDPGIAMLIDAK.A +267.98255.6778
R.VALETTNEENIASIRDSVSLAK.D +242.8912
R.WTTIGVSPNIIDASFQALMDSVVYK.L +255.443847.051831.4397
R.WTTIGVSPNIIDASFQALMDSVVYK.L +366.280565.5936
R.WVVLCDTNGGTMPDEVEAIVGEVVK.H +242.023738.9563
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA200126.529.618.311.133.9RPA2001 putative acetolactate synthase large subunit 2251263:2252807 forward MW:53370
K.IAEGLGVEASR.A +233.0226
K.LNSLGVAQAIAHLTPDHAIYAEEANTSGLPFQMILPK.A +355.928552.147250.6948
K.SAGAVASDTAR.A +232.1578
K.VAAETVEAIAK.L +251.3925
R.AAQKLPEIGPAK.V +134.6515
R.AVQAASAAPGGIATLIMPADVAWNPAAR.A +258.848363.948158.0665.7675
R.AVQAASAAPGGIATLIMPADVAWNPAAR.A +371.1542
R.DLAAALDAPAEPAAR.T +130.605329.78231.3643
R.DLAAALDAPAEPAAR.T +250.1142
R.GSALLGDVLEAAGR.V +130.658133.0855
R.GSALLGDVLEAAGR.V +265.183461.138658.095441.1527
R.TQLVLPELPK.G +235.174934.7808
R.VGASGAGANALSMLDLHNPEMNWMK.I +232.505746.494
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA201280.680.680.680.680.6RPA2012 conserved unknown protein 2265975:2266301 forward MW:11249
K.AIPDPAGKEVVFACR.S +238.298933.815834.383332.1739
K.AIPDPAGKEVVFACR.S +359.958
M.AGQVEDLTPQEVAK.G +137.243835.502239.787938.7059
M.AGQVEDLTPQEVAK.G +257.008260.151658.36865.4632
R.EPNEVAVEAYPDAVVVPLSTFDPK.A +242.982147.0736
R.HLAGGILGWK.A +139.187142.766242.061640.771
R.HLAGGILGWK.A +243.456343.657342.9881
R.SVTASMAAQAAGLPYNR.H +134.809439.867935.0087
R.SVTASMAAQAAGLPYNR.H +241.255440.723142.882748.7483
R.YLLVDVREPNEVAVEAYPDAVVVPLSTFDPK.A +233.7876
R.YLLVDVREPNEVAVEAYPDAVVVPLSTFDPK.A +349.618256.693680.391849.2606
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA201946.533.139.235.056.6RPA2019 3-oxoacyl-acyl carrier protein synthase II 2274168:2275448 reverse MW:44398
K.GDFPGPLFLAVAPVELEWLPR.Q +230.003734.1999
K.LADLATEEAIAQSGIGR.K +126.3896
K.LADLATEEAIAQSGIGR.K +266.19763.5983
K.LADLATEEAIAQSGIGR.K +348.2769
K.SMVGHTLSAAGAVEAIFSLLTLEHQR.I +258.914830.682930.509635.1941
K.SMVGHTLSAAGAVEAIFSLLTLEHQR.I +381.537676.154272.596363.1715
K.STMAGTVDFVPVEPFSSVVLGEK.L +230.795134.082930.7265
R.ATGANTAIDYDALLR.V +240.454533.6146
R.DKFGRPIVVVTGMGVVTSLGAGKNDNWAK.L +351.167748.231
R.FLFGSVADHLADTFGTK.G +251.523950.9621
R.FSLLSALSTQNDPPQASSKPFAK.N +237.615830.3431
R.GASILGVIAGCGELADNFHR.T +234.587147.2157
R.GASILGVIAGCGELADNFHR.T +349.2201
R.IPPTINYDVPDPAIPLDVVPNQAR.D +263.06464.313747.680253.2748
R.IPPTINYDVPDPAIPLDVVPNQAR.D +352.6722
R.KGDFPGPLFLAVAPVELEWLPR.Q +267.427152.598760.971349.8028
R.KGDFPGPLFLAVAPVELEWLPR.Q +365.151251.5465
R.SSPDGKPIIGCINK.T +133.6305
R.SSPDGKPIIGCINK.T +230.7905
R.TITRFPIDGLK.S +233.690235.6402
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA202045.349.829.436.654.5RPA2020 3-oxoacyl-acyl carrier protein synthase 2275459:2276667 reverse MW:42291
R.AEPIEAWITGIGLATSLAEGLDAHWDALTER.R +243.591140.279648.661546.1047
R.AEPIEAWITGIGLATSLAEGLDAHWDALTER.R +358.864157.228764.331267.1051
R.DGATAIITGATGAEPVTAEETAFLR.N +232.935942.745452.9352
R.GEGMALVEAVR.- +125.788825.8775
R.GEGMALVEAVR.- +248.717146.5552
R.GTATPFGHVMEAQFPLGIALAALSLSR.G +238.7945
R.IAAGQSDIALIGAAQNGER.K +266.915345.578234.4853
R.IGTYAAGLALESAGIKGNTEILSR.M +238.232836.0786
R.IGTYAAGLALESAGIKGNTEILSR.M +347.6721
R.LKNVVADQSR.R +130.0239
R.LMNDLRPTLFLAQLSNLLAGNIAIVHGVTGSSR.T +364.557660.283969.083871.9269
R.NAGDVTASLEK.L +128.679429.941226.7606
R.NAGDVTASLEK.L +234.2885
R.RVNVDTAAFAPYVVHPLAPLSFDK.Q +247.08346.563134.4262
R.RVNVDTAAFAPYVVHPLAPLSFDK.Q +379.159966.819356.757956.1014
R.RVNVDTAAFAPYVVHPLAPLSFDKQIPK.K +361.573259.438961.6347
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA203122.824.516.019.627.7ilvI acetolactate synthase (large subunit) 2286918:2288696 forward MW:64487
K.AHNEMLLPAEATDEATAAAFAGGK.A +263.679855.97972.334353.4955
K.AHNEMLLPAEATDEATAAAFAGGK.A +355.665154.2325
K.RPVIYSGGGVINSGPEASR.L +237.8151
K.VLHEAFYVATSGRPGPVVVDVPKDVQFATGTYHPPR.K +348.292860.457755.4307
M.SDSNSHDPNQMTGAAMIVR.A +247.222557.459658.711464.0975
R.AMKDHGVEHIFGYPGGAVLPIYDEIFQQSDVQHILVR.H +358.837864.197384.082761.73
R.HEQGAGHAAEGYAR.S +132.9601
R.VAALENCFPMIPSGK.A +233.937931.3827
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA203255.061.745.645.661.7ilvH acetolactate synthase (small subunit) 2288912:2289454 forward MW:19942
K.INQFIELMRPLGLVEVVR.T +243.125944.119645.243637.9261
K.INQFIELMRPLGLVEVVR.T +361.727574.147850.786757.6973
M.TQPASAYFMEER.H +230.6144
R.ELAMVK.L +135.307926.530132.827937.164
R.GYNIESLTVSETEAQK.H +133.6348
R.GYNIESLTVSETEAQKHLSR.I +244.577448.510446.816432.6688
R.HDPNETHTLSVIVQNEPGVLAR.V +264.638856.219767.596663.2081
R.HDPNETHTLSVIVQNEPGVLAR.V +369.132869.630969.603750.0068
R.ITIVTTGTPMVIQQIK.N +138.834731.428335.772331.6197
R.ITIVTTGTPMVIQQIK.N +263.836750.094961.0417
R.ITIVTTGTPMVIQQIK.N +359.4161
R.VIGLFSGR.G +233.369239.7944
R.VVDMTLSGR.S +243.266352.8125
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA203562.569.369.363.169.3ilvC ketol-acid reductoisomerase 2291138:2292157 forward MW:37107
-.MRVYYDR.D +236.02431.7907
-.MRVYYDRDADLNLIK.G +127.7883
-.MRVYYDRDADLNLIK.G +235.373841.985735.4609
-.MRVYYDRDADLNLIK.G +347.578545.4765
-.MRVYYDRDADLNLIKGKK.V +230.2385
K.DASGNAHDLGLSYASAIGGGR.A +130.691544.035242.106839.5375
K.DASGNAHDLGLSYASAIGGGR.A +267.989773.483275.311174.3572
K.DASGNAHDLGLSYASAIGGGR.A +349.9051
K.DSGVKDVAIALR.K +125.971837.315629.987735.3264
K.DSGVKDVAIALR.K +239.110139.6827
K.DSGVKDVAIALR.K +346.2837
K.DSGVKDVAIALRK.G +349.0962.6551
K.DVAIALR.K +129.4596
K.DVAIALRK.G +231.162632.5236
K.GALVDK.S +130.098426.8509
K.GALVDKSKN.- +131.341334.667631.805930.671
K.KAENAGFK.V +128.626
K.KAENAGFKVMEVAEAAK.W +153.255145.32939.922436.2789
K.KAENAGFKVMEVAEAAK.W +271.569265.49354.94963.9371
K.KAENAGFKVMEVAEAAK.W +360.324565.660646.174466.7984
K.KGALVDK.S +126.777
K.KGALVDKSKN.- +137.415329.915240.378836.6198
K.KVAVIGYGSQGHAHALNLK.D +144.134439.8545
K.KVAVIGYGSQGHAHALNLK.D +265.636536.325760.640454.9357
K.KVAVIGYGSQGHAHALNLK.D +351.8115
K.KVAVIGYGSQGHAHALNLKDSGVK.D +242.736945.1077
K.KVAVIGYGSQGHAHALNLKDSGVKDVAIALR.K +230.673730.765741.200244.2797
K.KVAVIGYGSQGHAHALNLKDSGVKDVAIALR.K +348.061864.519152.9947
K.KVAVIGYGSQGHAHALNLKDSGVKDVAIALRK.G +377.294158.469776.998380.6407
K.LAQHPIEEVGAK.L +148.126150.195246.044344.9941
K.LAQHPIEEVGAK.L +255.215154.111757.80350.1519
K.LAQHPIEEVGAK.L +354.201647.281361.230854.9043
K.LRDMMPWIK.K +131.717131.845727.882825.9328
K.LRDMMPWIK.K +239.562639.361247.645742.0686
K.LRDMMPWIKK.G +126.1236
K.LRDMMPWIKK.G +237.7677
K.LRDMMPWIKK.G +354.5073
K.QGAALLFAHGLNVHFNLIEPR.A +248.361
K.QGAALLFAHGLNVHFNLIEPR.A +346.148747.1362
K.RVLADIQNGIFTR.N +259.101756.093160.766660.033
K.RVLADIQNGIFTR.N +354.2733
K.VAVIGYGSQGHAHALNLK.D +146.282641.625837.0863
K.VAVIGYGSQGHAHALNLK.D +248.832469.906152.20954.1658
K.VAVIGYGSQGHAHALNLKDSGVK.D +266.829440.342560.209852.8081
K.VAVIGYGSQGHAHALNLKDSGVKDVAIALR.K +262.730961.624860.370254.7889
K.VAVIGYGSQGHAHALNLKDSGVKDVAIALR.K +381.164987.615105.16395.1445
K.VAVIGYGSQGHAHALNLKDSGVKDVAIALRK.G +234.1473
K.VAVIGYGSQGHAHALNLKDSGVKDVAIALRK.G +356.4950.18549.6442
K.VMEVAEAAK.W +145.322637.17235.492936.0477
K.VMEVAEAAK.W +245.43348.203639.4192
K.WADVMMMLTPDELQADIYR.E +241.3237
K.WADVMMMLTPDELQADIYREHLHDNMK.Q +346.136453.971350.386957.8817
R.ADLDVLMVAPK.G +144.894238.921236.151737.3569
R.ADLDVLMVAPK.G +267.024564.786361.771162.8141
R.ADLDVLMVAPKGPGHTVR.S +129.5513
R.ADLDVLMVAPKGPGHTVR.S +259.450862.40761.61662.7182
R.ADLDVLMVAPKGPGHTVR.S +363.103760.86272.5127
R.AKLAQHPIEEVGAK.L +153.578654.159346.124848.9322
R.AKLAQHPIEEVGAK.L +263.783965.388861.640661.7284
R.AKLAQHPIEEVGAK.L +355.667659.963554.34968.0856
R.DADLNLIK.G +129.784234.912534.605829.8541
R.DADLNLIK.G +234.899344.3418
R.DADLNLIKGK.K +133.283129.7293
R.DADLNLIKGK.K +240.569454.100730.671334.2358
R.DADLNLIKGKK.V +131.786335.3346
R.DADLNLIKGKK.V +242.3143
R.DMMPWIK.K +130.390428.342331.97426.2428
R.DMMPWIKK.G +126.4384
R.GGGVPCLIAIHK.D +134.521232.006926.057233.0473
R.GGGVPCLIAIHK.D +235.3539
R.GGGVPCLIAIHKDASGNAHDLGLSYASAIGGGR.A +258.085755.61765.533462.5377
R.GGGVPCLIAIHKDASGNAHDLGLSYASAIGGGR.A +372.36670.482680.961397.3922
R.IVTPETK.A +140.430527.192626.295525.2638
R.IVTPETK.A +232.1794
R.NWMLENK.V +140.270338.900638.039335.5685
R.NWMLENKVNQTSFK.A +136.004847.575146.59742.9055
R.NWMLENKVNQTSFK.A +268.660261.625969.327265.8455
R.NWMLENKVNQTSFK.A +359.586
R.NWMLENKVNQTSFKATR.A +231.692154.949739.999243.007
R.NWMLENKVNQTSFKATR.A +348.390447.1971
R.VLADIQNGIFTR.N +130.695633.161425.4533
R.VLADIQNGIFTR.N +272.842472.526261.015370.9324
R.VLADIQNGIFTRNWMLENKVNQTSFKATR.A +346.2348
R.VYYDRDADLNLIK.G +137.445535.579137.5377
R.VYYDRDADLNLIK.G +246.066351.640253.390548.1008
R.VYYDRDADLNLIKGK.K +234.639
R.VYYDRDADLNLIKGKK.V +345.4669
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA204325.038.559.745.669.7RPA2043 putative ABC transporter, periplasmic substrate-binding protein 2299917:2300939 forward MW:35299
K.AHPNEAQGLTK.A +132.984635.7238
K.AILGTLNWIHAHSAEEIADKMPANIVGKDK.A +362.51177.587764.9174
K.AQYVAALK.N +128.6236
K.AVLGGSADVVSGYFDHTVNLAAK.K +252.5436
K.AVLGGSADVVSGYFDHTVNLAAK.K +355.2599
K.GGSDALKAVLGGSADVVSGYFDHTVNLAAK.K +355.712949.468360.0666
K.KQEMQSFVVYDRYPGLVLAVSPGHTAEIK.S +237.5686
K.KQEMQSFVVYDRYPGLVLAVSPGHTAEIK.S +357.152460.391271.3238
K.KVGVSAPGSSTDFFLK.Y +128.5312
K.KVGVSAPGSSTDFFLK.Y +241.644857.409955.3711
K.NGVDPNNVAVVGVGLGATAVAAMQQGQIDAAVMLDPAVTILQAAHADLR.I +345.9041
K.QLGEYDKAGLAVELVDLKGGSDALK.A +230.1838
K.SIKELAGK.K +126.398
K.SIKELAGKKVGVSAPGSSTDFFLK.Y +242.5257
K.TYTNAFVEQAK.V +128.479934.712136.821735.7555
K.TYTNAFVEQAK.V +231.123936.5654
K.VGVSAPGSSTDFFLK.Y +129.908741.499538.4735
K.VGVSAPGSSTDFFLK.Y +232.727437.505232.1664
R.ANIDVTK.T +129.2594
R.EVFGGDYPGGALYATTAWIK.A +239.056957.265382.007970.6628
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA204651.357.839.932.364.1leuI 2-isopropylmalate synthase 2303251:2304825 forward MW:57551
K.AGATTINLPDTVGYAVPEEYR.E +233.8697
K.AGATTINLPDTVGYAVPEEYRELFR.K +232.397335.599430.5472
K.AYLGALNK.I +134.360130.228431.1435
K.AYLGALNK.I +234.824238.142
K.DVYDEDIEALVDEQLLHGQDQIK.L +239.062630.5475
K.IVAK.R +125.3495
K.LDVDGQIR.I +238.89
K.LMSLTVIAGTHGPQR.A +125.7091
K.MEELGYK.L +128.656733.195529.5725
K.NAQTYEIMTPETVGVK.G +134.091732.9724
K.NAQTYEIMTPETVGVK.G +237.4994
K.NAQTYEIMTPETVGVKGTSLVMGK.H +241.37141.200132.3001
K.NAQTYEIMTPETVGVKGTSLVMGK.H +349.7957
K.TVSAATSFPVQYNK.A +132.547135.211630.628128.6477
K.TVSAATSFPVQYNK.A +255.415353.420546.663349.1211
R.AADPDTLVASAK.A +137.294133.3152
R.AADPDTLVASAK.A +243.629748.58742.3908
R.AAHKDIDR.C +131.5059
R.AGNAALEEVVMAMR.V +146.288936.91439.926536.5339
R.AGNAALEEVVMAMR.V +274.173875.257256.051738.4421
R.AGNAALEEVVMAMR.V +373.5139
R.ARNHTDDVEWSAEDATR.T +126.5819
R.ARNHTDDVEWSAEDATR.T +249.3268
R.FSVHCHNDLGMAVANSMAGVAGGAR.Q +243.7168
R.IEEAEGNGPVDAVFNCIK.A +245.004845.993142.677832.1153
R.IETTMLTHASK.T +132.158229.763127.385830.006
R.IETTMLTHASK.T +247.842843.9311
R.IHTFLSTSPVHMK.Y +151.304751.159732.1236
R.IHTFLSTSPVHMK.Y +259.092656.3592
R.IHTFLSTSPVHMK.Y +356.366247.0676
R.KKDVYDEDIEALVDEQLLHGQDQIK.L +256.577560.521952.39545.3285
R.KKDVYDEDIEALVDEQLLHGQDQIK.L +382.1502102.18479.495779.3902
R.MLDDMGVDVIEAGYPFASDGDFEAVHEIAK.R +348.06356.2935
R.MLDDMGVDVIEAGYPFASDGDFEAVHEIAKR.S +355.410966.303769.274553.1638
R.NAFAHESGIHQDGMIK.N +140.694831.0162
R.NAFAHESGIHQDGMIK.N +233.790660.3814
R.NAFAHESGIHQDGMIK.N +346.398761.3159
R.NHTDDVEWSAEDATR.T +243.9266
R.NQIEDVFVR.F +125.704927.422642.3888
R.NQIEDVFVR.F +241.742145.9298
R.SKNSVICGLSR.A +232.6228
R.SVREDAPAVAVAG.- +135.186834.167329.7567
R.SVREDAPAVAVAG.- +233.034
R.TEFDFLCR.C +232.6765
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA204784.183.586.587.789.5dctP1 TrapT family, dctP subunit, C4-dicarboxylate periplasmic binding protein 2305049:2306053 forward MW:36473
K.ALIEEFIK.E +127.932430.702928.707331.1166
K.ALIEEFIK.E +249.344351.976749.445348.7086
K.ALIEEFIKESGGGPTK.- +154.315471.701858.548659.1355
K.ALIEEFIKESGGGPTK.- +267.194963.590469.370861.2688
K.ALIEEFIKESGGGPTK.- +373.165572.565273.220379.6052
K.AMAPVYDDVGGR.V +137.950436.825835.406536.9062
K.AMAPVYDDVGGR.V +265.2972.145259.320164.1301
K.AMAPVYDDVGGRVGK.A +248.353140.7677
K.AMKEATEFGNSQSQKENAEALEEMK.K +247.418565.369245.2638
K.AMKEATEFGNSQSQKENAEALEEMK.K +357.8815
K.AMKEATEFGNSQSQKENAEALEEMKK.S +247.702345.706148.334652.3948
K.AMKEATEFGNSQSQKENAEALEEMKK.S +361.210271.098773.827887.9548
K.DKEELDALK.L +128.26537.6078
K.DKEELDALKLGAVQMLAPSISK.F +274.340679.563779.057876.3574
K.DKEELDALKLGAVQMLAPSISK.F +345.193763.586556.022480.6716
K.EATEFGNSQSQKENAEALEEMK.K +251.076560.5388
K.EATEFGNSQSQKENAEALEEMKK.S +242.690846.958947.391345.3134
K.EATEFGNSQSQKENAEALEEMKK.S +349.571949.971757.271362.3965
K.EFEVFDLPYILPDIAALR.K +260.744760.328455.713158.5685
K.EFEVFDLPYILPDIAALR.K +370.026978.989353.143271.5149
K.EFEVFDLPYILPDIAALRK.V +241.530357.513155.477362.9796
K.EFEVFDLPYILPDIAALRK.V +357.559752.182258.391259.3522
K.FGPAGVK.E +125.379
K.FGPAGVKEFEVFDLPYILPDIAALR.K +283.44786.839488.423780.1919
K.FGPAGVKEFEVFDLPYILPDIAALR.K +366.479366.674671.311862.8431
K.FGPAGVKEFEVFDLPYILPDIAALRK.V +269.254776.269969.010765.4986
K.FGPAGVKEFEVFDLPYILPDIAALRK.V +376.522990.855495.263888.7807
K.FKELAEK.Y +125.0289
K.FRIQSSK.V +125.132428.6638
K.FRIQSSK.V +239.4061
K.FSHVVAPNTPK.G +151.831345.180143.391851.6563
K.FSHVVAPNTPK.G +247.227945.317448.212839.5766
K.FSHVVAPNTPK.G +362.747357.722158.114259.308
K.FSHVVAPNTPKGMAADKFKELAEK.Y +236.170337.0337
K.GMAADKFK.E +128.2396
K.GMAADKFKELAEK.Y +145.521650.2746.199947.3147
K.GMAADKFKELAEK.Y +262.199459.291256.989156.9718
K.GMAADKFKELAEK.Y +345.97952.060750.013
K.GMAADKFKELAEKYTDGK.V +264.879163.191965.609355.9682
K.GMAADKFKELAEKYTDGK.V +347.672159.075582.209362.0959
K.GMAADKFKELAEKYTDGKVK.V +230.877140.359448.358644.3435
K.GMAADKFKELAEKYTDGKVK.V +345.558257.2104
K.GMTGLAYWDNGFK.I +152.283546.761347.760648.1166
K.GMTGLAYWDNGFK.I +248.18363.278360.219559.6092
K.GMTGLAYWDNGFKIMSANKK.L +232.349446.147141.9934
K.KLIAPEDYK.G +148.973941.000635.204240.7836
K.KLIAPEDYK.G +239.362340.117945.0258
K.KSGKTEIITLTPEQNLAMR.K +240.772447.328944.874
K.LGAVQMLAPSISK.F +147.961941.115143.191639.5786
K.LGAVQMLAPSISK.F +257.714668.396467.64858.0388
K.LIAPEDYK.G +131.662731.855729.037431.6322
K.LIAPEDYK.G +231.529435.158333.5795
K.LLDSK.G +129.099727.957729.699229.3112
K.MHEVQK.Y +137.26134.398135.745433.7139
K.QFWDGIPADVR.A +125.3703
K.QFWDGIPADVR.A +252.674451.574846.502553.1928
K.SGKTEIITLTPEQNLAMR.K +262.496961.963960.776756.879
K.SGKTEIITLTPEQNLAMR.K +370.173773.66962.642962.4806
K.SGKTEIITLTPEQNLAMRK.A +261.399759.774264.039363.2405
K.SGKTEIITLTPEQNLAMRK.A +370.1974.037690.863578.9824
K.TEIITLTPEQNLAMR.K +126.215527.608931.793925.1869
K.TEIITLTPEQNLAMR.K +247.03748.145748.445956.1599
K.TEIITLTPEQNLAMRK.A +240.002144.265448.7468
K.TEIITLTPEQNLAMRK.A +348.466245.121951.4772
K.VEVYPNSQLFK.D +237.0289
K.VEVYPNSQLFKDKEELDALK.L +242.066443.924345.31946.383
K.VEVYPNSQLFKDKEELDALK.L +351.775148.019649.4622
K.VEVYPNSQLFKDKEELDALKLGAVQMLAPSISK.F +360.626659.971581.761879.1361
K.VKVEVYPNSQLFK.D +134.56426.781542.0796
K.VKVEVYPNSQLFK.D +232.61238.9734
K.VKVEVYPNSQLFKDKEELDALK.L +240.225243.648358.800762.3189
K.VKVEVYPNSQLFKDKEELDALK.L +348.312449.534456.431545.1758
K.VKVEVYPNSQLFKDKEELDALKLGAVQMLAPSISK.F +367.109774.932575.109678.9612
K.VLDAQFR.A +134.792338.492632.1078
K.VLDAQFR.A +245.492244.011946.605344.3038
K.VTNGPVGAK.L +125.9039
K.YTDGKVKVEVYPNSQLFKDKEELDALKLGAVQMLAPSISK.F +368.571259.0432
K.YTTVTNHGYIGYAVIVNK.Q +255.359246.9825
K.YTTVTNHGYIGYAVIVNK.Q +353.461
K.YTTVTNHGYIGYAVIVNKQFWDGIPADVR.A +357.2788
R.ALGAIPQVLAFSEVYQALQTGVVDGQENTPSNMYTQK.M +371.367269.288665.748875.4016
R.AQLDK.A +125.861726.615226.799
R.AQLDKAMKEATEFGNSQSQKENAEALEEMKK.S +356.055548.230782.253459.9212
R.IQSSKVLDAQFR.A +242.3501
R.KAMAPVYDDVGGR.V +147.083541.910150.272448.9434
R.KAMAPVYDDVGGR.V +254.948359.519259.847554.1739
R.KAMAPVYDDVGGR.V +373.455667.003475.762874.1378
R.KAMAPVYDDVGGRVGK.A +244.23830.1819
R.KAMAPVYDDVGGRVGK.A +345.980764.493
R.KVTNGPVGAK.L +132.444832.376935.164134.0385
R.KVTNGPVGAK.L +235.373942.1942
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA209049.342.153.142.660.8cobH precorrin isomerase CobH 2347836:2348465 reverse MW:21791
K.EALLADSPSPCVIVR.G +247.032546.5692
K.RLPADNEVICTLNHPDVPALAAK.L +347.868753.568850.6394
R.AALQAGAPILCDAQMVANGVTR.K +241.462749.5567
R.AALQAGAPILCDAQMVANGVTR.K +347.7568
R.KRLPADNEVICTLNHPDVPALAAK.L +346.8638
R.LLEILVEPGAPRPAAIIGIPVGFVGAAESK.E +241.514550.758747.7155
R.LLEILVEPGAPRPAAIIGIPVGFVGAAESK.E +364.060663.17673.51
R.MQGAVVAIGNAPTALFR.L +129.312433.1897
R.MQGAVVAIGNAPTALFR.L +238.296639.5928
R.RGGSAMTAAAINALASERE.- +243.365743.596657.539961.7488
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA213631.741.352.941.352.9RPA2136 possible cytochrome C precursor 2401317:2401631 forward MW:11231
K.DLAAYIAQQK.H +143.492643.99241.5658
K.GTDMAPSFAAIASQANFNEEK.L +256.026938.5258
K.LAFFLLEPHPK.M +140.1117
K.LAFFLLEPHPK.M +237.422446.786654.3307
K.LAFFLLEPHPK.M +356.496260.802556.2859
K.MSNMALSR.G +238.2346
R.GETKDLAAYIAQQK.H +126.9283
R.KGTDMAPSFAAIASQANFNEEK.L +243.661639.138873.283375.4931
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA214810.910.910.910.910.9RPA2148 Beta-lactamase 2416916:2418184 reverse MW:45662
M.PSQAAPAQSSTPTIGSAASAGMSEAALR.R +264.174449.284963.366868.379
R.ILDPLGMTDTDFYVPAAK.A +125.3272
R.ILDPLGMTDTDFYVPAAK.A +257.435265.971862.690663.506
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA215368.587.878.883.087.8RPA2153 aldehyde dehydrogenase 2423788:2425218 forward MW:50503
K.ADVDKAVAAAK.R +141.373439.279533.233937.5714
K.ADVDKAVAAAK.R +239.18933.8553
K.ADVDKAVAAAKR.A +130.3446
K.AVTGGVMHMFNNSGQSCNAPSR.M +250.485768.575366.307563.9347
K.AVTGGVMHMFNNSGQSCNAPSR.M +376.728373.49261.5578
K.DENEAVELANDTPYGLAGYVSAGSVDR.A +246.69
K.GFYVRPTVFADVTK.D +256.517455.172759.733351.8859
K.GFYVRPTVFADVTKDMTIAR.E +357.766950.7658.847766.496
K.GIEEGATLVAGGPGLPEGVNK.G +133.661445.665345.329948.8421
K.GIEEGATLVAGGPGLPEGVNK.G +256.349567.050462.362173.2503
K.GVFNLVNGLGPEVGAAMSEHPDIDMISFTGSTR.A +230.00342.597533.6042
K.GVFNLVNGLGPEVGAAMSEHPDIDMISFTGSTR.A +357.509646.071347.0858
K.IQTLINK.G +130.946736.2431
K.IQTLINKGIEEGATLVAGGPGLPEGVNK.G +255.593960.404158.201667.5582
K.IQTLINKGIEEGATLVAGGPGLPEGVNK.G +350.0962
K.KSTPVVNPATEEAMYEVALGSK.A +242.0038
K.MKEVAAIAK.G +133.231730.514531.62737.8616
K.MQAGAGLGHIMSTLDVLK.N +139.231647.026239.884742.6874
K.MQAGAGLGHIMSTLDVLK.N +268.22378.562664.888866.4953
K.MQAGAGLGHIMSTLDVLK.N +359.538457.960662.136962.2906
K.NYQFEEPLGSAMIVREPIGVVGMITPWNWPLNQIACK.V +348.741162.754466.783689.9001
K.RVSQELGGKSPNVILEDADLTK.A +242.224656.8024
K.RVSQELGGKSPNVILEDADLTK.A +358.847554.217151.739153.5815
K.SPNVILEDADLTK.A +149.896956.977144.818952.0993
K.SPNVILEDADLTK.A +243.336970.803954.99455.3672
K.STPVVNPATEEAMYEVALGSK.A +273.05175.867886.640885.8061
K.VAPAIAAGCTMVLKPSEFTPTSALLFAEILHEAGVPK.G +358.566970.065578.826978.041
K.VVAIYK.S +128.661632.170234.52437.2176
R.AFETFSVTSR.E +232.602340.4613
R.AGIDVAQR.A +133.3496
R.AGIDVAQR.A +243.931939.8295
R.AGNVNLQGVPNER.T +131.543236.218826.488336.8522
R.AGNVNLQGVPNER.T +243.457448.301752.544744.2469
R.EEIFGPVLVIMGAK.D +133.8714
R.EEIFGPVLVIMGAKDENEAVELANDTPYGLAGYVSAGSVDR.A +348.164845.913351.0567
R.EPIGVVGMITPWNWPLNQIACK.V +247.080349.783844.777451.7637
R.EPIGVVGMITPWNWPLNQIACK.V +355.2341
R.EWGKFGLEEYLEVK.A +125.9045
R.GEGTTIGPVVNR.I +126.0527
R.GEGTTIGPVVNR.I +249.792644.755441.6294
R.IALLEK.V +131.963128.365831.9541
R.IQWDKIQTLINK.G +142.205439.377639.283
R.IQWDKIQTLINK.G +245.979360.120858.529850.3637
R.IQWDKIQTLINKGIEEGATLVAGGPGLPEGVNK.G +241.5433
R.IQWDKIQTLINKGIEEGATLVAGGPGLPEGVNK.G +354.155958.712369.901967.5338
R.MIVPLSK.M +135.872329.756730.5026
R.MKEIGAAISDEMGAPLPMAEK.M +289.066383.22686.404493.1901
R.MKEIGAAISDEMGAPLPMAEK.M +358.25866.192575.8266
R.MQFYIDGAWVDPVVKK.S +125.5632
R.MQFYIDGAWVDPVVKK.S +252.731462.826566.857650.5256
R.MQFYIDGAWVDPVVKK.S +364.587855.9029
R.VSQELGGKSPNVILEDADLTK.A +268.017982.378792.82975.7416
R.VSQELGGKSPNVILEDADLTK.A +374.383683.694477.552383.7922
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA216481.088.786.585.090.1groEL2 chaperonin GroEL2, cpn60 2437219:2438862 reverse MW:57796
K.AMLQDIAILTGGQAISEDLGIK.M +275.123485.581477.892464.3914
K.AMLQDIAILTGGQAISEDLGIK.M +381.805645.6011
K.AMLQDIAILTGGQAISEDLGIKMENVTLQMLGR.A +241.070533.9315
K.AMLQDIAILTGGQAISEDLGIKMENVTLQMLGR.A +371.988850.969578.0937
K.AQIEETTSDYDR.E +131.0003
K.AQIEETTSDYDR.E +266.32743.047439.1109
K.AQIEETTSDYDREK.L +131.529626.775926.417625.515
K.AQIEETTSDYDREK.L +259.798462.778950.395454.0818
K.AQIEETTSDYDREK.L +347.95762.7622
K.AQIEETTSDYDREKLQER.L +235.851940.319234.384940.57
K.AQIEETTSDYDREKLQER.L +354.57
K.AVAAGMNPMDLK.R +146.256839.925842.578639.4229
K.AVAAGMNPMDLK.R +265.490966.683460.265260.3578
K.AVAAGMNPMDLKR.G +135.358836.791830.851830.024
K.AVAAGMNPMDLKR.G +269.785762.411357.912459.8272
K.AVAAGMNPMDLKR.G +345.073447.997946.8954
K.DGVTVAK.D +125.709926.0826
K.DGVTVAKDIELDDKFENMGAQMVR.E +265.667968.166374.674366.8108
K.DGVTVAKDIELDDKFENMGAQMVR.E +386.264777.816787.05274.224
K.DIELDDKFENMGAQMVR.E +269.198173.43476.001481.261
K.DIELDDKFENMGAQMVR.E +371.960184.88764.4354
K.DRVDDAMHATR.A +126.1136
K.DRVDDAMHATR.A +245.6464
K.FLADAMK.K +136.482433.8979
K.FLADAMKK.V +136.468934.672931.59932.5378
K.FLADAMKK.V +241.41645.505938.8854
K.GIIDPTK.V +130.043429.199730.069531.6827
K.GIIDPTKVVR.T +237.077334.781940.2278
K.KADIEAR.V +132.9538
K.KADIEAR.V +231.8633
K.KGGAGAGGMPPGGGMGGMDF.- +126.089755.319129.4251
K.KGGAGAGGMPPGGGMGGMDF.- +243.898354.588334.7931
K.KGIIDPTK.V +138.056939.6276
K.KGIIDPTK.V +238.454541.2582
K.KGIIDPTKVVR.T +236.275740.0424
K.KGIIDPTKVVR.T +350.642145.701
K.KLSNLNELLPLLEAVVQTGKPLVIVAEDVEGEALATLVVNR.L +375.645159.175170.0048
K.KVGNEGVITVEEAK.S +148.183347.754240.855447.0476
K.KVGNEGVITVEEAK.S +271.537468.413660.174558.3473
K.KVGNEGVITVEEAK.S +354.934258.1935
K.KVMIDKENTTIVNGAGK.K +143.505736.87539.885
K.KVMIDKENTTIVNGAGK.K +250.569159.577350.338561.0461
K.KVMIDKENTTIVNGAGK.K +347.648756.929
K.KVMIDKENTTIVNGAGKK.A +259.5950.5483
K.KVTSNDEIAQVGTISANGDAEIGK.F +252.950670.359361.974677.5431
K.KVTSNDEIAQVGTISANGDAEIGK.F +353.7159
K.KVTSNDEIAQVGTISANGDAEIGKFLADAMK.K +235.4735
K.KVTSNDEIAQVGTISANGDAEIGKFLADAMK.K +370.438367.044477.148269.8032
K.KVTSNDEIAQVGTISANGDAEIGKFLADAMKK.V +360.933480.251351.943162.295
K.LAGGVAVIR.V +127.1779
K.LAGGVAVIR.V +257.727858.474245.92753.43
K.LQER.L +128.7918
K.LSNLNELLPLLEAVVQTGKPLVIVAEDVEGEALATLVVNR.L +357.843462.471
K.MENVTLQMLGR.A +131.448641.035337.303641.145
K.MENVTLQMLGR.A +275.038271.943270.453871.2182
K.MRVEFDDAYILINEK.K +236.6231
K.NDDQKTGVEIVR.R +130.0622
K.NSKKVTSNDEIAQVGTISANGDAEIGK.F +234.436
K.RGIDLAVEAVVADLVK.N +248.753162.700855.281351.5045
K.RGIDLAVEAVVADLVK.N +383.226581.7313
K.SADAAGDGTTTATVLAQAIVR.E +125.939626.391634.4365
K.SADAAGDGTTTATVLAQAIVR.E +275.653386.8272.535473.4819
K.SADAAGDGTTTATVLAQAIVR.E +359.267457.494346.07
K.SFGAPR.I +136.09526.816327.5316
K.SLETELDVVEGMQFDR.G +136.998734.051432.3787
K.SLETELDVVEGMQFDR.G +261.013162.468748.133553.9705
K.SLETELDVVEGMQFDR.G +363.0635
K.SLETELDVVEGMQFDRGYISPYFVTNADKMR.V +354.3638
K.TGVEIVRR.A +232.754230.651430.8456
K.TKNDDQKTGVEIVR.R +129.127626.6833
K.TKNDDQKTGVEIVR.R +235.0062
K.VAAVKAPGFGDR.R +250.024241.946336.1104
K.VGNEGVITVEEAK.S +143.748943.286834.603637.1579
K.VGNEGVITVEEAK.S +255.388757.730253.671549.5809
K.VLEKEQYAFGFDSQSGEYGDLVK.K +256.949472.940965.25965.0877
K.VLEKEQYAFGFDSQSGEYGDLVK.K +360.878272.682269.4229
K.VLEKEQYAFGFDSQSGEYGDLVKK.G +262.539461.684453.18650.7331
K.VLEKEQYAFGFDSQSGEYGDLVKK.G +367.979781.504178.31391.5644
K.VMIDKENTTIVNGAGK.K +127.175239.275534.845525.8859
K.VMIDKENTTIVNGAGK.K +261.842973.266468.425851.4483
K.VMIDKENTTIVNGAGK.K +358.143847.9328
K.VMIDKENTTIVNGAGKK.A +139.0371
K.VMIDKENTTIVNGAGKK.A +255.477959.446749.6991
K.VMIDKENTTIVNGAGKK.A +356.855269.07953.656
K.VMIDKENTTIVNGAGKKADIEAR.V +240.018154.9485
K.VMIDKENTTIVNGAGKKADIEAR.V +353.567151.8339
K.VTLGPK.G +128.712225.843229.137829.3739
R.AAVEEGIVPGGGVALLR.A +139.531243.168440.502543.7066
R.AAVEEGIVPGGGVALLR.A +274.289869.98569.469163.5059
R.AAVEEGIVPGGGVALLR.A +371.813371.236561.0925
R.AKKVMIDKENTTIVNGAGK.K +276.9474.533851.8444
R.ASEQLKGLK.T +140.195240.842733.691936.527
R.ASEQLKGLK.T +245.806947.251635.292434.0256
R.GGLKVAAVK.A +129.117728.8246
R.GGLKVAAVKAPGFGDR.R +244.155848.398440.3444
R.GGLKVAAVKAPGFGDR.R +357.4003
R.GIDLAVEAVVADLVK.N +152.235648.640650.767353.1002
R.GIDLAVEAVVADLVK.N +284.869281.565177.274269.9778
R.GIDLAVEAVVADLVK.N +3110.032105.54380.2918
R.GVDILANAVK.V +135.223434.278236.594338.3122
R.GVDILANAVK.V +249.53654.034448.735345.8185
R.GVDILANAVKVTLGPK.G +244.751933.969249.208
R.GVDILANAVKVTLGPK.G +355.4173
R.GYISPYFVTNADK.M +150.433447.571543.044944.1671
R.GYISPYFVTNADK.M +272.441180.704263.354469.5366
R.GYISPYFVTNADKMR.V +262.649360.595553.581651.0731
R.ITKDGVTVAK.D +132.028635.552732.283835.6284
R.ITKDGVTVAK.D +243.761744.503531.8899
R.ITKDGVTVAKDIELDDKFENMGAQMVR.E +263.75156.944461.426859.2498
R.ITKDGVTVAKDIELDDKFENMGAQMVR.E +393.290887.386892.147696.4348
R.KAMLQDIAILTGGQAISEDLGIK.M +279.227380.747980.86676.9476
R.KAMLQDIAILTGGQAISEDLGIK.M +354.965251.1228
R.KAMLQDIAILTGGQAISEDLGIKMENVTLQMLGR.A +348.969654.655859.016
R.KDRVDDAMHATR.A +125.218129.366325.521
R.KDRVDDAMHATR.A +245.585540.4153
R.KDRVDDAMHATR.A +371.1874
R.MLRGVDILANAVK.V +128.7504
R.MLRGVDILANAVK.V +246.910155.856747.103251.9683
R.MLRGVDILANAVK.V +356.645
R.NVVLDK.S +134.105436.085137.22141.0918
R.NVVLDKSFGAPR.I +253.335131.735851.4903
R.NVVLDKSFGAPR.I +346.8444
R.RKAMLQDIAILTGGQAISEDLGIK.M +251.742449.993630.5549
R.RKAMLQDIAILTGGQAISEDLGIK.M +359.9764
R.TAIQNAASVAALLITTEAMIAELPK.K +286.210881.86678.766779.0235
R.TAIQNAASVAALLITTEAMIAELPK.K +379.453982.389881.300683.4171
R.TAIQNAASVAALLITTEAMIAELPKK.G +356.682566.8628
R.TAIQNAASVAALLITTEAMIAELPKKGGAGAGGMPPGGGMGGMDF.- +359.848967.929277.336771.5288
R.VAQIK.A +127.504626.2558
R.VDDAMHATR.A +127.274728.0107
R.VDDAMHATR.A +257.3083
R.VEFDDAYILINEK.K +145.495250.907245.425744.3023
R.VEFDDAYILINEK.K +266.539777.043757.953956.8793
R.VEFDDAYILINEKK.L +130.66544.151729.169432.6539
R.VEFDDAYILINEKK.L +247.241848.842140.1169
R.VEFDDAYILINEKK.L +346.593854.833
R.VGGATEVEVK.E +129.781232.31533.279132.0812
R.VGGATEVEVK.E +256.8344.605530.9543
R.VGGATEVEVKER.K +137.377641.286436.7961
R.VGGATEVEVKER.K +244.965435.980531.0095
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA216590.486.575.041.391.3groES2 chaperonin GroES2, cpn10 2439028:2439342 reverse MW:11164
-.MNFRPLHDR.V +241.878637.486830.4926
K.EKPSQGEIVAVGPGGR.D +135.6706
K.EKPSQGEIVAVGPGGR.D +241.66551.7782
K.EKPSQGEIVAVGPGGRDEAGK.L +238.566343.7038
K.EKPSQGEIVAVGPGGRDEAGK.L +347.164945.8384
K.EKPSQGEIVAVGPGGRDEAGKLIPIDLK.V +234.517736.795133.5071
K.EKPSQGEIVAVGPGGRDEAGKLIPIDLK.V +355.100652.656747.9358
K.ELLIMK.E +138.165236.6619
K.ESDIMGVITDVGAK.K +154.54960.596951.440647.8205
K.ESDIMGVITDVGAK.K +272.064364.729934.1842
K.ESDIMGVITDVGAKK.K +238.7451
K.IDGKELLIMK.E +133.635739.816430.9406
K.IDGKELLIMK.E +242.247146.9865
K.IDGKELLIMKESDIMGVITDVGAK.K +258.871761.6782
K.IDGKELLIMKESDIMGVITDVGAK.K +366.6824
K.TAGGIIIPDTAK.E +144.222444.374540.819838.187
K.TAGGIIIPDTAK.E +245.248947.346239.123340.6986
K.TAGGIIIPDTAKEKPSQGEIVAVGPGGRDEAGKLIPIDLK.V +355.11
K.VGDRVLFGK.W +244.043541.3879
K.VGDRVLFGKWSGTEVK.I +244.8348
K.WSGTEVKIDGK.E +132.9212
R.DEAGKLIPIDLK.V +233.174433.4613
R.VLFGK.W +128.5427.861431.358132.6098
R.VLFGKWSGTEVK.I +130.693132.2789
R.VVVKR.I +128.9858
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA217221.830.221.425.039.3RPA2172 putative oxidoreductase 2446500:2447258 reverse MW:26420
K.IALVTGAGTGVGR.A +243.934532.0636
K.LGAEFGDGLPVVADMADPASIAALFDTIVQR.Y +235.349234.071240.87253.0295
K.LGAEFGDGLPVVADMADPASIAALFDTIVQR.Y +346.741452.470551.1466
R.AYDIAVGQIDIGNAATPMTDR.M +240.618134.8214
R.IINNGSISAHAPRPFSAAYTATK.H +238.675
R.MVQGVLQPDGR.T +242.973144.643133.5581
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA217816.716.714.720.830.6RPA2178 possible competence damage protein 2452385:2453122 forward MW:26593
K.IGNVIVMAGVPSIMQAMMDIVAPR.L +231.1135
K.IGNVIVMAGVPSIMQAMMDIVAPR.L +345.574251.7868
R.IPEGAELIQSATIIAPGFK.I +258.851254.4487
R.SRDPEKLQQAMIAVK.Q +236.4513
R.VVADDEAAIVEALDALR.S +125.4675
R.VVADDEAAIVEALDALR.S +263.246257.419164.861645.7871
R.VVADDEAAIVEALDALR.S +378.567477.449262.315955.9055
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA218117.614.128.236.236.2RPA2181 possible metE (5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase) 2454971:2455993 reverse MW:37454
-.MLFPTTIAGSLPKPEWLAEPNKLWAPWK.S +361.300357.1341
K.AMVPQVVAPLR.L +242.4499
K.FTLPGPMTIIDTIADR.H +234.5548
K.GKIVQAGVIDVASDEVETAEDVCATIEAVMQHVPK.S +373.475456.849289.827890.3668
K.IVQAGVIDVASDEVETAEDVCATIEAVMQHVPK.S +239.222144.826152.1513
K.IVQAGVIDVASDEVETAEDVCATIEAVMQHVPK.S +369.015271.207675.476475.7258
K.LAALGAGAELAR.E +131.496430.6486
K.LAALGAGAELAR.E +239.985457.197254.1567
K.VPLELLSLLK.G +236.203847.676744.0494
R.DATILALK.L +133.016928.289
R.NSKVPLELLSLLK.G +234.607136.1696
R.NSKVPLELLSLLK.G +357.459547.476584.8543
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA218655.455.426.215.155.4RPA2186 possible 3-oxo-(acyl) acyl carrier protein reductase 2459456:2460373 forward MW:31988
K.AGIVGLMNVLAQEGR.K +268.336968.865630.2163
K.AQALEGAFQQTQK.Y +153.246443.0277
K.AQALEGAFQQTQK.Y +277.811758.2076
K.IIETEGINLPENEWTPDGIAAHFAEISDDSK.A +240.0755
K.IIETEGINLPENEWTPDGIAAHFAEISDDSK.A +349.489850.8799
K.MELSDFQK.V +131.643726.955
K.VVVNDFGGAR.D +246.06240.5217
R.AHALGLAALGAK.V +144.624244.537632.755547.6664
R.AHALGLAALGAK.V +245.061853.4453
R.DGTGGSMTAAETVVEEIKK.A +233.874433.048932.6007
R.MTEELLPPQALQLMKPEAITPAVLFLLSENAPTR.T +352.872562.451362.047360.529
R.TTLGAGAGSFAQIK.I +126.168228.8604
R.TTLGAGAGSFAQIK.I +250.4207
R.VAIVTGAGNGLGR.A +134.9599
R.VAIVTGAGNGLGR.A +264.408166.0921
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA220062.275.981.777.789.6guaB inosine monophosphate dehydrogenase 2475578:2477074 forward MW:52395
K.ADVPVIADGGIK.Y +125.0233
K.ALAAGADIAMVGSLLAGTDETPGEVFLWQGR.S +237.416534.109
K.AVAHPLASK.D +135.651729.063336.858238.8034
K.AVAHPLASK.D +234.564
K.AVAHPLASKDAQGR.L +133.874341.7588
K.DLGEFHTK.A +127.947528.902926.86
K.DLGEFHTK.A +233.723737.7968
K.FESGMVVNPLTISPDAK.L +125.104341.469828.3558
K.FESGMVVNPLTISPDAK.L +246.396841.761545.2731.5715
K.KADVPVIADGGIK.Y +135.898944.424939.2383
K.KADVPVIADGGIK.Y +238.75550.710550.1433
K.KADVPVIADGGIKYSGDLAK.A +238.948650.005858.6198
K.KADVPVIADGGIKYSGDLAK.A +357.322768.0676
K.KFESGMVVNPLTISPDAK.L +147.114946.554751.4885
K.KFESGMVVNPLTISPDAK.L +278.982681.490176.295983.303
K.KFESGMVVNPLTISPDAK.L +357.2284
K.KLLHQHR.I +234.95
K.LADALALMNQYGFSGIPVVTGAQGHGPGK.L +237.069635.200256.858241.17
K.LADALALMNQYGFSGIPVVTGAQGHGPGK.L +361.607980.982882.229178.3968
K.LADALALMNQYGFSGIPVVTGAQGHGPGKLVGILTNR.D +351.84151.833875.167156.3649
K.LLVVDDQYR.C +130.63430.465633.9351
K.LLVVDDQYR.C +242.90245.753848.776946.0373
K.LVGILTNR.D +230.4603
K.LVPEGIEGQVPYKGPVGNVVHQLAGGLR.A +240.047245.989741.5303
K.LVPEGIEGQVPYKGPVGNVVHQLAGGLR.A +351.036361.673659.9701
K.RISNQVQVIAGNIATR.D +246.0143
K.VGIGPGSICTTR.I +230.826937.550341.886432.4906
K.VSELMTHENLVTVR.E +136.0097
K.VSELMTHENLVTVR.E +244.290849.099760.70151.5711
K.VSELMTHENLVTVR.E +354.704848.01
M.ASVSASPQFIEALTFDDVLLKPGLSDVLPSEVDIR.S +231.973338.86446.7427
M.ASVSASPQFIEALTFDDVLLKPGLSDVLPSEVDIR.S +348.756159.158970.169265.7274
R.AAMGYVGAK.D +132.394732.178336.155634.6935
R.AAMGYVGAK.D +243.6729
R.AIPLNIPIIASAMDTVTEAR.M +272.261568.336681.563985.3183
R.AIPLNIPIIASAMDTVTEAR.M +385.426588.1877
R.DGAQALIDSGADAVK.V +156.11753.834853.297951.6852
R.DGAQALIDSGADAVK.V +265.510260.81281.614968.0308
R.DGAQALIDSGADAVKVGIGPGSICTTR.I +255.118967.301964.455762.5015
R.DGAQALIDSGADAVKVGIGPGSICTTR.I +361.138756.540854.625967.1228
R.ESHVHDVTITR.E +136.021534.771143.5685
R.ESPNYPGGV.- +126.287828.412625.3954
R.FATDPAQKVSELMTHENLVTVR.E +257.961642.49854.990161.3659
R.FATDPAQKVSELMTHENLVTVR.E +351.164457.46679.5266
R.GMGSVGAMAR.G +125.2594
R.GMGSVGAMAR.G +250.583844.3232
R.GSADRYFQQDIKDTLK.L +126.101525.077228.183
R.GSADRYFQQDIKDTLK.L +243.126930.7597
R.GSADRYFQQDIKDTLK.L +357.5941
R.ISNQVQVIAGNIATR.D +132.960434.9442
R.ISNQVQVIAGNIATR.D +268.040569.363272.171168.6586
R.ITGAGLRESHVHDVTITR.E +235.626441.4333
R.ITGAGLRESHVHDVTITR.E +348.0736
R.IVAGVGVPQLTAIMDAVQACK.K +250.846659.021769.759268.3831
R.IVAGVGVPQLTAIMDAVQACK.K +378.941697.019484.950274.1433
R.LIEAGVDVVVVDTAHGHSAR.V +231.3752
R.LRVAAATTVGEGGYER.T +255.3069
R.MAIAMAQAGGLGVIHR.N +232.640365.499374.7407
R.MAIAMAQAGGLGVIHR.N +356.375656.872855.2778
R.NFDPEGQAAQVR.Q +125.8842
R.NFDPEGQAAQVR.Q +259.982662.769565.176356.6996
R.VAAATTVGEGGYER.T +129.490433.4058
R.VAAATTVGEGGYER.T +268.523153.297170.296757.3159
R.VLDAVTR.I +128.0239
R.YFQQDIKDTLK.L +138.443828.451430.3573
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA220148.441.648.744.061.6RPA2201 quinone oxidoreductase 2477373:2478398 forward MW:36423
K.EGETVVVAAASGAVGSAVGQIAK.V +235.0722
K.GDIVLAHSGWATHAIADAKPLR.K +236.584563.954655.263343.5017
K.GDIVLAHSGWATHAIADAKPLR.K +356.1548
K.GDIVLAHSGWATHAIADAKPLRK.I +240.445250.871844.5106
K.GDIVLAHSGWATHAIADAKPLRK.I +356.487248.621859.6523
K.IDPALGPISTAVGVLGMPGMTAYTGLLDIGQPK.E +251.711851.188747.275741.2949
K.IDPALGPISTAVGVLGMPGMTAYTGLLDIGQPK.E +354.807160.386758.5541
K.YREHVTDGLENAPEAFMGLLK.G +231.911
K.YREHVTDGLENAPEAFMGLLK.G +349.474556.762
R.EHVTDGLENAPEAFMGLLK.G +230.335139.1642
R.GFIVSDFAGR.R +237.3415
R.IPVCGLIAQYNAFETPPTPK.W +253.892759.30677.492532.4628
R.IPVCGLIAQYNAFETPPTPK.W +349.8406
R.IVLASRPVGEPTPQNFR.L +232.24732.464133.0763
R.IVLASRPVGEPTPQNFR.L +357.615262.088259.4265
R.IVLASRPVGEPTPQNFRLEEFDVPAPGEGQVLLR.T +346.03460.341162.842754.1331
R.KIDPALGPISTAVGVLGMPGMTAYTGLLDIGQPK.E +230.963933.080937.462833.1097
R.KIDPALGPISTAVGVLGMPGMTAYTGLLDIGQPK.E +348.176455.513565.439463.0945
R.LEEFDVPAPGEGQVLLR.T +125.5332.768729.643830.5882
R.LEEFDVPAPGEGQVLLR.T +237.470161.673841.006557.5622
R.MSDGPSYAQPVPVGGVMEGGTVCEVIDSK.S +247.286231.9778
R.MSDGPSYAQPVPVGGVMEGGTVCEVIDSKSPGFAK.G +361.2958
R.TIWLSLDPYMR.G +125.1307
R.TIWLSLDPYMR.G +249.328750.626942.782540.3899
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA226617.017.017.017.017.0gst1, parB putative glutathione S-transferase 2568791:2569447 forward MW:23788
R.RVDLADAEMAAEHAAAVGG.- +241.606846.572255.996541.8928
R.VLLEELGAPYDLHVLNMK.A +240.530334.0844
R.VLLEELGAPYDLHVLNMK.A +360.080657.447765.556547.9295
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA227632.328.224.219.037.5RPA2276 putative branched-chain amino acid transport system ATP-binding protein 2577663:2578409 forward MW:27169
K.IIDGFANSEIEANMDKLHTYLGV.- +234.1797
M.VEATTLDRPVSSAAGAPLLSVR.D +243.242834.887253.038745.927
M.VEATTLDRPVSSAAGAPLLSVR.D +360.065362.749353.5689
R.EGEVVTLLGR.N +244.069238.2819
R.FLMLDEPTEGLAPVIIQQIGHTIAR.L +239.621134.385257.75642.5036
R.FLMLDEPTEGLAPVIIQQIGHTIAR.L +346.025845.558357.706357.9958
R.SGSVTFDGTDISR.A +125.4726
R.SGSVTFDGTDISR.A +238.2591
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA229751.057.213.913.959.5RPA2297 conserved unknown protein 2602665:2605472 forward MW:93059
K.ADSEGNYTIGLDQDLTALTK.T +267.394556.2856
K.ADSEGNYTIGLDQDLTALTK.T +372.112661.5963
K.ATLGNAGAVISTSNGAANSSITSGMLK.L +241.893159.6097
K.AVDLATGVR.K +127.7513
K.AVDLATGVR.K +255.781152.2701
K.GTLDDVLK.A +125.828631.894631.045929.3818
K.GTLDDVLK.A +237.277240.2741
K.GTLDDVLKAVDLATGVR.K +140.098731.1088
K.GTLDDVLKAVDLATGVR.K +256.867456.0596
K.GTLDDVLKAVDLATGVR.K +381.680985.2765
K.GTLDDVLKAVDLATGVRK.A +346.6794
K.ISDLTNGVTATATGPASGDAITVNGK.T +265.478669.3553
K.ISDLTNGVTATATGPASGDAITVNGK.T +356.5433
K.KVNTALDNPTNFFTAASLDSR.A +247.243759.0784
K.LELHSGTTSPLTISDNAGGAVLAK.L +268.416252.0918
K.LELHSGTTSPLTISDNAGGAVLAK.L +351.817653.8407
K.LGLGGSTQFK.V +130.767329.2227
K.LGLGGSTQFK.V +245.669741.9039
K.LSTASTTLR.S +232.4057
K.LSTASTTLRSQASAFGSNLSVVQAR.Q +234.493742.3363
K.LSTASTTLRSQASAFGSNLSVVQAR.Q +348.694567.0371
K.LSTGLQSDLSITGTGNAMSALGLTGPSGTDSSFSATR.G +232.8236
K.LVDSAK.S +132.557833.1285
K.LVFNETGK.S +132.655328.986832.909928.7921
K.LVFNETGK.S +233.122330.1682
K.NAAVPSASASHTGISGNVETDGNGNSTVYLQK.G +237.87845.1737
K.NAAVPSASASHTGISGNVETDGNGNSTVYLQK.G +353.4587
K.NLGLTTSTGSGPLTLTK.Q +140.392441.569
K.NLGLTTSTGSGPLTLTK.Q +280.310881.1666
K.NLGLTTSTGSGPLTLTK.Q +351.3536
K.QFNDILNQIK.T +125.1134
K.QRTTDGTTLGTLIQDGSTLNVNGHTITFK.N +365.846347.0209
K.SIANQALQTVAGYASK.S +134.715626.1602
K.SIANQALQTVAGYASK.S +271.446164.1198
K.SIANQALQTVAGYASK.S +370.093465.1723
K.SLINVLQTGSANLTLADTNEEAANSQALSTR.Q +238.740743.8718
K.SLINVLQTGSANLTLADTNEEAANSQALSTR.Q +361.595461.78
K.TIDAMNNNTTNASAVTAGK.L +125.8412
K.TIDAMNNNTTNASAVTAGK.L +262.46834.0455
K.TITFK.T +125.637925.891626.1562
K.TITFKTSDAPQGNNIASGTGVLGR.I +252.131356.8882
K.TITFKTSDAPQGNNIASGTGVLGR.I +354.137457.4642
K.TITFTTAGTAK.A +236.1024
K.TSDAPQGNNIASGTGVLGR.I +127.279226.2544
K.TSDAPQGNNIASGTGVLGR.I +258.994560.5078
K.TTAQDASFNGVNLLNGDNLK.L +259.259256.9176
K.TTAQDASFNGVNLLNGDNLKLVFNETGK.S +235.3014
R.AGLVKQFNDILNQIK.T +125.27238.1039
R.AGLVKQFNDILNQIK.T +261.727958.5715
R.AGLVKQFNDILNQIK.T +366.600673.2979
R.ASDINNLLDGIGNGVQILQAANTGITSLNK.L +243.750546.304460.968461.0301
R.ASDINNLLDGIGNGVQILQAANTGITSLNK.L +346.0451
R.ASDINNLLDGIGNGVQILQAANTGITSLNKLVDSAK.S +349.394157.762475.346568.6914
R.GASAGSLNGK.T +131.708733.937531.8295
R.IGTDGNGNSTIYLGNQSNFTNATVGDVLTAIDLANGVK.S +366.399157.4535
R.KATLGNAGAVISTSNGAANSSITSGMLK.L +285.851280.4579
R.KATLGNAGAVISTSNGAANSSITSGMLK.L +371.636982.3646
R.QNLSSLQATADLLATTQSR.L +258.435746.886254.411668.0583
R.QSIAVSALSLANQSQQGVLQLLR.- +260.143664.85762.3586
R.QSIAVSALSLANQSQQGVLQLLR.- +352.541564.3883
R.SQASAFGSNLSVVQAR.Q +128.852137.8881
R.SQASAFGSNLSVVQAR.Q +282.663174.2651
R.SQASAFGSNLSVVQAR.Q +368.9669
R.TTDGTTLGTLIQDGSTLNVNGHTITFK.N +247.768236.6505
R.TTDGTTLGTLIQDGSTLNVNGHTITFK.N +354.8518
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA230410.914.723.520.836.5RPA2304 putative acyl-CoA thiolase 2611555:2612742 forward MW:40814
K.AGKSEVTVTTDEQPLKAK.L +232.6766
K.AKLEK.I +128.343527.9843
R.AGLKPDAIDEVVFGCVLPAGQGQAPAR.Q +242.291250.027654.469452.5239
R.EITPVTIK.A +127.384429.7765
R.GLKPLAAIVGHSTHAHEPALFATAPIGAIR.K +250.6758
R.GLKPLAAIVGHSTHAHEPALFATAPIGAIR.K +352.0739
R.TPMGGFQGELKDATASQLGAAAISAAVVR.A +245.7479
R.VIDHMFLDGLEDAYDKGR.L +231.3699
R.VIDHMFLDGLEDAYDKGR.L +348.84851.3955
R.VLVTLLAALEK.H +250.3684
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA231461.669.260.354.872.6RPA2314 cytochrome c556 2622816:2623256 forward MW:15200
K.AKFDDLFAK.L +135.817137.3411
K.AKFDDLFAK.L +237.866838.4693
K.ANIGGVLGNCK.S +127.8329
K.FDDLFAK.L +133.659434.677337.752331.474
K.FDDLFAK.L +241.820344.3988
K.FDQAVVQK.S +139.76538.364341.822727.2395
K.FDQAVVQK.S +251.463149.229839.9716
K.IWEDKAK.F +137.7207
K.KLPALFPADSK.T +134.971741.877833.846928.7462
K.KLPALFPADSK.T +247.966950.162130.673440.9848
K.KLPALFPADSKTGGDTAALPK.I +241.7393
K.LAAAATAAQGTIK.D +233.0029
K.LAAAATAAQGTIKDEASLK.A +140.662228.147132.8445
K.LAAAATAAQGTIKDEASLK.A +266.673360.045963.875478.4481
K.LAAAATAAQGTIKDEASLK.A +353.464960.826951.718549.699
K.QMGEATKPIAAMLK.G +230.0095
K.QMGEATKPIAAMLKGEAK.F +238.479137.956540.290830.0926
K.SLAAIADDSK.K +153.753153.824355.635946.6755
K.SLAAIADDSK.K +257.937256.11145.100536.9972
K.SLAAIADDSKK.L +141.572
K.SLAAIADDSKK.L +230.7933
K.SLAAIADDSKKLPALFPADSK.T +258.829159.421841.329948.5912
K.SLAAIADDSKKLPALFPADSK.T +360.848553.0895
K.SLAAIADDSKKLPALFPADSKTGGDTAALPK.I +365.592345.2975
K.TGGDTAALPK.I +129.394928.674
K.TGGDTAALPK.I +250.882361.466754.4163
R.KAILK.Q +126.53126.537430.9897
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA233317.513.03.63.424.6ctpC putative cation transport ATPase, possible copper transporter 2645744:2647840 reverse MW:73612
K.IAFVGDGINDAPALAGAHVGIAMHK.G +244.196942.9568
K.TLLFIGFGGR.L +230.1797
K.TSDPALLAGIVR.L +238.476433.2383
K.VLSGTMLEDGR.L +230.4225
R.AAEMAQELR.L +244.7148
R.ADFVAANTTTFILALGEAIEDSIAR.R +239.576
R.IADYVEQSLTAK.S +125.7393
R.IADYVEQSLTAK.S +233.3667
R.LDGFHAELLPTDK.A +129.5005
R.LPVSLAAALPLLR.H +252.551642.557440.926644.6049
R.LTADIALLEDGVDR.V +241.099443.351
R.SDDGGSDVAATLAVLLGTSALPMQAR.L +230.1864
R.SKTSDPALLAGIVR.L +237.9343
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA233684.173.878.579.489.7RPA2336 unknown protein 2648496:2648819 reverse MW:10907
-.MLPLLR.F +128.1603
K.AGEDLREATVSGLSAVEK.S +270.035171.238746.581454.1328
K.AGEDLREATVSGLSAVEK.S +348.996662.8411
K.APEAVKSFAQK.A +135.7083
K.LSNTTDSSEAATDDAPNVATTETAPAPSADQTATNEKA.- +238.677243.925943.337647.844
K.LSNTTDSSEAATDDAPNVATTETAPAPSADQTATNEKA.- +356.618264.581452.961451.6996
K.SFAQK.A +126.2233
R.EATVSGLSAVEK.S +127.563932.69829.429827.786
R.EATVSGLSAVEK.S +254.259843.0414
R.FASGILVGVVGVHLLK.Q +237.141558.185850.991738.9995
R.FASGILVGVVGVHLLK.Q +358.937964.2288
R.SGLDKAGEDLR.E +125.9808
R.SGLDKAGEDLR.E +242.4007
R.SGLDKAGEDLREATVSGLSAVEK.S +258.966272.1940.839255.3116
R.SGLDKAGEDLREATVSGLSAVEK.S +378.867379.062866.435576.0382
R.SKLSNTTDSSEAATDDAPNVATTETAPAPSADQTATNEKA.- +367.929767.328680.238583.5139
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA243522.416.228.010.039.6accC biotin carboxylase 2764725:2766077 reverse MW:48662
K.AAFGDASVYLEK.Y +133.0217
K.RLGIPVVPGSDGGVGPDDDAMAIAK.E +247.628243.668344.971839.8001
K.RLGIPVVPGSDGGVGPDDDAMAIAK.E +352.8288
K.VAHTAEDLALAISTAGNEAK.A +150.81353.744750.7224
K.VAHTAEDLALAISTAGNEAK.A +272.181763.84976.593662.905
K.VAHTAEDLALAISTAGNEAK.A +346.906
R.ALDEMVVDGIETTLPLFR.A +244.0064
R.FAEILSDHNLHFIGPK.A +247.361134.543855.1056
R.HQKVWEESPSPVISPEAR.A +238.0801
R.IQVEHPVTEMITGIDLVLEQIR.I +238.1192
R.LADESVCIGPPPSKDSYLNVPALLAACEITGADAVHPGYGFLSENAR.F +348.7188
R.LGIPVVPGSDGGVGPDDDAMAIAK.E +236.928671.527839.3612
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA244214.133.745.945.949.0RPA2442 putative outer membrane protein 2770683:2771450 reverse MW:27686
K.EYLVSHPEVLEEASEELGKR.Q +247.5716
K.EYLVSHPEVLEEASEELGKR.Q +349.600845.977
K.HQQAIKDNADIIYNSPR.G +255.3072
K.LAESMGMNGTPSYVIGK.Q +125.654527.1591
K.LAESMGMNGTPSYVIGK.Q +259.17956.888650.017
K.VVLKEFPVLGPPSVEAAQVAIAVR.M +239.340135.6048
K.YLDFHQK.L +126.72331.1662
R.AMTDMMELMKDDPNLK.V +239.964438.805733.8939
R.ATIEESFK.L +125.028
R.QAAAQAEKHQQAIKDNADIIYNSPR.G +238.2236.876244.6975
R.QAAAQAEKHQQAIKDNADIIYNSPR.G +368.7153
R.SQIETIIKEYLVSHPEVLEEASEELGKR.Q +236.689937.820762.356249.206
R.SQIETIIKEYLVSHPEVLEEASEELGKR.Q +384.529492.142696.148698.8226
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA244347.258.518.818.859.4RPA2443 probable antioxidant protein 2771641:2772330 reverse MW:25740
K.HTVAAPADWRPGDKVIIPLSVK.G +234.2781
K.IRLTMTYPMNVGR.N +230.5267
K.LAQPFASR.N +237.145934.9387
K.LYDMIHPNQSDTAAVR.S +130.7317
K.LYDMIHPNQSDTAAVR.S +254.32164.055145.072455.141
K.LYDMIHPNQSDTAAVR.S +348.830959.940148.4539
K.VAKLYDMIHPNQSDTAAVR.S +243.06
K.VAKLYDMIHPNQSDTAAVR.S +348.8681
K.WIADVNDTQQTDLQFPIIADPELK.V +231.548244.5367
R.LTMTYPMNVGR.N +125.419526.0428
R.LTMTYPMNVGR.N +240.524842.7653
R.NFDEILR.V +136.982733.328
R.NFDEILR.V +234.557240.5244
R.NVKPIGLSTDTVDEHLK.W +139.133937.823129.6345
R.NVKPIGLSTDTVDEHLK.W +265.659867.356651.617550.4517
R.NVKPIGLSTDTVDEHLK.W +370.43773.170153.63856.5194
R.SVFIIDPNKK.I +135.5434.549632.6104
R.SVFIIDPNKK.I +238.52445.225832.2746
R.VIDALQFADK.H +128.849939.741
R.VIDALQFADK.H +261.864263.6318
R.VIDALQFADKHTVAAPADWRPGDKVIIPLSVK.G +348.1051
R.VIDALQFADKHTVAAPADWRPGDKVIIPLSVKGEAATK.A +345.065
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA244410.99.317.117.117.1RPA2444 unknown protein 2772482:2772871 reverse MW:13348
K.GGREVPCP.- +126.6474
R.FRSYNPATGTYIAK.G +236.647662.424454.4069
R.FRSYNPATGTYIAKGGREVPCP.- +345.041
R.SYNPATGTYIAK.G +133.575227.978938.651127.8148
R.SYNPATGTYIAK.G +236.574139.80248.325935.5559
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA244657.355.866.952.868.4RPA2446 putative aminotransferase 2774592:2775782 forward MW:43057
-.MLDATK.T +134.593332.649333.822533.9654
K.APLKGVLVGSPANPTGTMMTR.E +250.568456.243760.5586
K.APLKGVLVGSPANPTGTMMTR.E +349.4934
R.AALAAAHAALDSSR.I +147.961553.785252.777142.8594
R.AALAAAHAALDSSR.I +274.221569.949174.662770.0495
R.AALAAAHAALDSSR.I +373.428356.134470.2657
R.AALAAAHAALDSSRIDYTSALGIPSLR.A +236.136435.874642.149136.9525
R.AALAAAHAALDSSRIDYTSALGIPSLR.A +371.509963.84269.3089
R.AILIEGLPK.A +129.581530.420232.4278
R.AILIEGLPK.A +254.348251.091643.902447.7249
R.ARGLLTASAR.S +232.659
R.EALTELIAVAESEGIR.F +131.4706
R.EALTELIAVAESEGIR.F +268.531450.275264.897461.9997
R.EALTELIAVAESEGIR.F +375.929775.8086
R.FISDEIYHGLDYAFPAVTAAELSPNAVVINSFSK.Y +240.7271
R.FISDEIYHGLDYAFPAVTAAELSPNAVVINSFSK.Y +354.8224
R.GLLTASAR.S +126.1873
R.GLLTASAR.S +239.903536.1226
R.GYEENRAILIEGLPK.A +235.9879
R.HALTGEALLAAHR.K +143.353636.870940.764838.3126
R.HALTGEALLAAHR.K +272.907456.438170.483274.8258
R.HALTGEALLAAHR.K +371.319867.285477.639872.7708
R.HALTGEALLAAHRK.A +128.5205
R.HALTGEALLAAHRK.A +255.067137.1876
R.HILNALGCVPVPIETHSETR.H +246.185336.295750.9069
R.HILNALGCVPVPIETHSETR.H +362.1271
R.IDYTSALGIPSLR.A +133.858339.326339.222932.0524
R.IDYTSALGIPSLR.A +254.690151.985747.456945.2606
R.IEAAGGHVIHMEVGQPWAPAPR.A +263.47865.155675.871776.6721
R.IEAAGGHVIHMEVGQPWAPAPR.A +361.551483.113570.6568
R.ITAWLGR.- +128.4421
R.ITAWLGR.- +237.972433.271133.4178
R.KAPLKGVLVGSPANPTGTMMTR.E +282.013573.987565.578865.5554
R.KAPLKGVLVGSPANPTGTMMTR.E +380.529675.291180.031187.3398
R.LQQNLAISVPTLSQIAAEAAFDGR.A +267.763331.823645.018643.5618
R.MLEEAR.V +132.255929.779638.517731.9461
R.RITAWLGR.- +243.891837.776448.549844.4651
R.SDVPPFMVMDVMAAADR.I +129.402828.259843.896240.1635
R.SDVPPFMVMDVMAAADR.I +269.949363.748778.181877.2947
R.SDVPPFMVMDVMAAADR.I +351.379760.3222
R.SDVPPFMVMDVMAAADRIEAAGGHVIHMEVGQPWAPAPR.A +359.191553.501268.768472.3979
R.VAATPGIDFDPVR.G +251.357739.694135.789750.019
R.VAATPGIDFDPVRGK.S +127.770126.157927.1704
R.VAATPGIDFDPVRGK.S +245.065839.910940.578644.9548
R.VAATPGIDFDPVRGK.S +351.455851.881
R.VGWMVLPESLVRPVER.L +237.108835.006437.686538.2027
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA245014.722.922.022.930.3rne putative ribonuclease E 2779169:2782324 reverse MW:115619
K.MLIDATHPEETR.V +126.785935.801329.492427.8754
K.MLIDATHPEETR.V +248.569642.731952.466947.8566
K.RDFEYLIR.M +235.789533.4417
K.TNMEAAEEVAR.Q +260.9109
R.DFEYLIR.M +231.4817
R.DFMHMLMPSQVR.A +136.8086
R.DFMHMLMPSQVR.A +232.430330.786534.2079
R.EHHIEDTALK.T +129.5619
R.GNIYLAK.V +125.4446
R.GNKGAALTTYLSLAGR.Y +125.1649
R.GNKGAALTTYLSLAGR.Y +244.4027
R.GNRVEEFDFETAQR.K +243.89649.8343
R.HGFLAFSEIHPDYYQIPVADR.Q +247.673458.359842.7911
R.HGFLAFSEIHPDYYQIPVADR.Q +354.845764.25681.25169.0424
R.ISHFGLLEMSR.Q +127.762536.073940.704630.867
R.ISHFGLLEMSR.Q +244.139137.744935.5035
R.ISHFGLLEMSR.Q +347.9308
R.LKEVVQDLDVPEGMGVILR.T +252.7154.548668.26466.7437
R.LKEVVQDLDVPEGMGVILR.T +350.747464.5252
R.LRDLAGLIVIDFIDMDEK.R +250.6334
R.LRDLAGLIVIDFIDMDEKR.N +372.391152.6262
R.MGVESQLDAMFSPTVQLR.S +234.730940.134233.3949
R.MWETVRDVTLNSQAPK.L +238.969854.061934.6469
R.QALIEADER.A +232.5689
R.SLRDLYNKEIDEVLVAGEAGYR.E +246.356468.2448
R.SLRDLYNKEIDEVLVAGEAGYR.E +350.27745.34157.171757.0421
R.SLRDLYNKEIDEVLVAGEAGYREAR.D +345.456247.0727
R.SVSSVALQLLR.G +252.069648.067344.009234.9219
R.VEPSLQAAFIEYGGNR.H +247.025936.412750.5281
R.VQSEIVEAATDVAAEQPHEAADHHEAHEAGAHAEAER.L +366.716885.582271.1962
R.YAVLMPNTAR.G +231.353230.5902
R.YAVLMPNTARGGGISRKITSAQDRSR.L +231.5985
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA246019.911.722.714.822.7tyrS tyrosyl-tRNA synthetase 2797634:2798890 reverse MW:46039
K.AGGLKVNDAPVTDEK.M +142.5468
K.AGGLKVNDAPVTDEK.M +246.215135.607636.7886
K.ILATEATALMHGR.E +231.41132.9649
K.ILATEATALMHGR.E +348.7479
K.LFTLLPMDEIER.L +130.1018
K.MTLTATDLSSDGVIK.L +128.037439.420838.4461
K.MTLTATDLSSDGVIK.L +235.785340.923142.079132.4071
R.MGTHQLHALTCPLLTTASGAK.M +239.206860.7282
R.MGTHQLHALTCPLLTTASGAK.M +354.779749.8899
R.TTFEQGGTAQDLPSVEISR.G +232.112136.186848.223236.6258
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA24797.67.63.13.19.0RPA2479 methyl-accepting chemotaxis receptor/sensory transducer 2818822:2820561 forward MW:62024
K.ALAEQTAK.A +126.694527.6858
R.AGEAGRGFAVVAAEVK.A +239.04839.3865
R.AGEAGRGFAVVAAEVK.A +348.985358.0227
R.GFAVVAAEVK.A +129.46933.7884
R.IGDVVELINTIAGQTNLLALNATIEAAR.A +235.399442.2476
R.IGDVVELINTIAGQTNLLALNATIEAAR.A +375.92966.3805
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA250323.416.714.314.323.4RPA2503 possible aminotransferase 2844868:2846088 forward MW:44402
K.LNPDTQVVATLGSK.E +142.256830.2682
K.LNPDTQVVATLGSK.E +248.593633.1242
R.AGWEIPPPSASMFAWAPLPPAFR.E +240.8304
R.DILVESFGR.A +127.25228.7586
R.FGVKLNPDTQVVATLGSK.E +233.0785
R.FLESGVETLHNVVPLAAQR.- +245.253147.727155.170446.9839
R.FLESGVETLHNVVPLAAQR.- +351.170147.5013
R.NAGADIIDLGMGNPDLPAPPHVLEK.L +251.5257.168351.80945.8135
R.NAGADIIDLGMGNPDLPAPPHVLEK.L +375.382257.9197
R.RFLESGVETLHNVVPLAAQR.- +354.743345.0697
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA250552.457.235.944.064.7glpX Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase related protein 2847555:2848559 forward MW:35497
K.GADQAAVDAMR.R +235.7334
K.GDCLFAATGVTDGSLLSGVK.F +239.224931.0074
K.GVIQTETVVMR.S +234.7345
K.GVPTSGVTVLVLDRPR.H +255.143251.3801
K.IAIGPGYEK.N +130.059832.77326.769828.2584
K.IAIGPGYEK.N +231.902435.866930.2983
K.MPIEGTIVIGEGERDEAPMLFIGEK.V +233.921
K.NLIDIDAPPEDNILR.L +131.415334.337128.96736.0191
K.NLIDIDAPPEDNILR.L +255.080351.677251.233954.5969
K.NMPGSIATMAMAEGGTLLHAPDVYMQK.I +250.750356.41542.8575
K.VDIAVDPLEGTTLCAK.N +125.681744.172235.312527.2381
K.VDIAVDPLEGTTLCAK.N +254.214563.630630.9326
K.VGAGINAGPKVDIAVDPLEGTTLCAK.N +259.024658.7606
K.VGAGINAGPKVDIAVDPLEGTTLCAK.N +375.661672.4542
R.AESMGIEDPNFVYQIEDMVK.G +264.909564.681167.87969.1124
R.ELNKMPIEGTIVIGEGERDEAPMLFIGEK.V +233.169234.7538
R.ELNKMPIEGTIVIGEGERDEAPMLFIGEK.V +357.950450.647167.4
R.HAELIAK.I +134.362330.6671
R.ILTLEIVR.V +125.893127.622427.7221
R.ILTLEIVR.V +248.891146.824839.350332.9658
R.KGVIQTETVVMR.S +134.2314
R.KGVIQTETVVMR.S +262.285160.0846
R.LAQAK.G +125.9221
R.LLLDTHSK.R +126.8816
R.LLLDTHSKR.N +125.154325.1811
R.LLLDTHSKR.N +237.3137.3512
R.NRAESMGIEDPNFVYQIEDMVK.G +232.944834.611642.836653.3852
R.NRAESMGIEDPNFVYQIEDMVK.G +346.7205
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA251371.371.361.758.079.8efp elongation factor P 2856053:2856619 reverse MW:20717
-.MRVIASSIR.K +246.976144.590840.987540.6331
K.DVVGSAAPYLQEGMVVK.L +149.747649.887240.526945.2727
K.DVVGSAAPYLQEGMVVK.L +256.934950.339154.078649.833
K.GQTASSSYKPAVLSNGVR.T +244.195748.738449.947647.9331
K.LSMHDTTAVAITLPQR.A +235.422
R.ATLEVVDTEPVTK.G +144.007939.738648.018546.2786
R.ATLEVVDTEPVTK.G +261.184858.985160.903354.0202
R.ATLEVVDTEPVTKGQTASSSYKPAVLSNGVR.T +231.062732.531435.449736.435
R.ATLEVVDTEPVTKGQTASSSYKPAVLSNGVR.T +361.75772.415976.103667.9087
R.IVVLTEDGSYVER.A +266.194677.329574.1138
R.KGNVLEQDGK.L +126.109428.835631.3964
R.NYSFLYEDGEGFHFMEPESYDQVQVTK.D +235.583939.084640.4485
R.NYSFLYEDGEGFHFMEPESYDQVQVTK.D +348.060156.46766.4691
R.NYSFLYEDGEGFHFMEPESYDQVQVTKDVVGSAAPYLQEGMVVK.L +350.314347.3558
R.TQVPPHIGTGTR.I +126.534327.7478
R.YKTTDQVEK.V +135.249225.092431.7561
R.YKTTDQVEKVTIEER.N +127.5854
R.YKTTDQVEKVTIEER.N +273.920670.682
R.YKTTDQVEKVTIEER.N +345.2789
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA251616.316.316.316.316.3RPA2516 unknown protein 2859061:2859321 forward MW:8827
R.IDQIDPADAALDR.K +128.183930.0359
R.IDQIDPADAALDR.K +241.613258.747357.837330.2162
R.IDQIDPADAALDRK.I +128.2256
R.IDQIDPADAALDRK.I +254.478840.990346.077147.8324
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA252322.120.822.122.122.1RPA2523 putative lactoylglutathione lyase 2863487:2863936 reverse MW:17161
R.NLDTALEFFVGALGLK.E +149.015438.884948.310341.7107
R.NLDTALEFFVGALGLK.E +278.180154.105577.948885.1902
R.NLDTALEFFVGALGLK.E +389.655985.014680.733496.2414
R.NLDTALEFFVGALGLKEVR.R +240.568444.89436.5186
R.NLDTALEFFVGALGLKEVR.R +351.839849.813255.8933
R.SPDLQSVELLQK.G +134.896531.753834.906
R.SPDLQSVELLQK.G +230.866936.934736.800764.9063
R.VRNLDTALEFFVGALGLK.E +253.307346.3748
R.VRNLDTALEFFVGALGLK.E +372.336
R.VRNLDTALEFFVGALGLKEVR.R +366.630979.083667.3084
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA254315.629.836.640.446.9RPA2543 TrapT family, dctP subunit, C4-dicarboxylate periplasmic binding protein 2883903:2884922 reverse MW:36194
K.AGAKVDKLDAATVEK.W +144.378142.492638.016143.3772
K.AGAKVDKLDAATVEK.W +267.478652.230759.71856.2554
K.AGAKVDKLDAATVEK.W +379.255645.954
K.AIFDKLPK.N +126.786
K.AIFDKLPK.N +231.9705
K.ALLSPDDAK.G +126.451227.3776
K.ALTDFLADK.G +131.238
K.HLTSGADASYWFMLEPLMMSK.A +242.145734.06875.785373.8626
K.ISHQFPGGTIDKGDFR.D +244.7363
K.QGAQADDIEVAK.V +230.0322
K.RSGGELVGEVYPGSSLIK.T +236.3282
K.TNAQFSAMR.K +125.8514
K.TNAQFSAMR.K +230.5709
K.VDKLDAATVEK.W +129.285228.913730.042140.4976
R.KGALDLSLYPMPYAGGEVPETNIGLMPGLVSTYEQGLSWK.T +359.373270.309951.4507
R.SGGELVGEVYPGSSLIK.T +138.657243.704644.988243.7614
R.SGGELVGEVYPGSSLIK.T +253.604958.113262.84859.8825
R.SKALLSPDDAK.G +136.0186
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA254659.973.071.771.773.0RPA2546 FKBP-type peptidyl-prolyl cis-trans isomerase 2889133:2889591 forward MW:15826
K.FDSSVDRNEPFEFPIGMGR.V +234.5454
K.FDSSVDRNEPFEFPIGMGR.V +364.161661.3741
K.GWDEGVASMK.V +126.445830.5052
K.SVTTPSGLQIVDTQVGTGASPAR.G +266.309371.737378.748776.6536
K.SVTTPSGLQIVDTQVGTGASPAR.G +346.149757.644546.2359
K.TRKFDSSVDRNEPFEFPIGMGR.V +232.3791
R.GAGGVIPPNATLVFDVELLGLK.- +241.359154.109161.841155.476
R.GQICVMHYTGWLYENGAK.T +241.05263.571445.1966
R.GQICVMHYTGWLYENGAK.T +346.6991
R.KFDSSVDRNEPFEFPIGMGR.V +241.750435.690643.883440.4445
R.KFDSSVDRNEPFEFPIGMGR.V +349.853755.839355.5079
R.NEPFEFPIGMGR.V +127.367926.276227.8906
R.NEPFEFPIGMGR.V +237.612944.831641.7752
R.TLIIPPDLGYGAR.G +125.033732.0258
R.TLIIPPDLGYGAR.G +245.962751.429440.094244.1343
R.VIKGWDEGVASMK.V +151.492349.070838.632141.8293
R.VIKGWDEGVASMK.V +250.007249.592831.384950.3481
R.VIKGWDEGVASMK.V +371.873266.702261.593658.0583
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA255249.153.853.849.153.8RPA2552 unknown protein 2893377:2893697 reverse MW:11666
R.AWAYGDLNSLK.A +134.969635.445833.7928
R.AWAYGDLNSLKATLER.T +247.83532.2494
R.IEELIKETETNLDLAAR.A +130.036628.1404
R.IEELIKETETNLDLAAR.A +261.6967.110275.630178.071
R.IEELIKETETNLDLAAR.A +361.200161.2431
R.VILNDLSEHIVEELSGPNHYAGEK.I +248.476747.61954.966357.6789
R.VILNDLSEHIVEELSGPNHYAGEK.I +357.370955.611263.938575.1462
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA256028.136.443.532.247.0aapJ-1 ABC transporter, periplasmic amino acid binding protein aapJ-1 2907057:2908073 forward MW:36524
K.GGIMYAPPIR.- +126.156425.6257
K.GGIMYAPPIR.- +240.243733.5712
K.LATPADHAVLPEVISKEPLGPLVR.H +260.429353.010351.978948.1028
K.LATPADHAVLPEVISKEPLGPLVR.H +363.124569.356172.360475.012
K.RVFGTDGNLGEQLGLTKDWVAR.I +230.2869
K.RVFGTDGNLGEQLGLTKDWVAR.I +350.523265.40674.791667.3374
K.WTLFALVNAEELGVTQKNVDEMAK.S +231.9746
R.AIAAAVFDDPSKVK.F +230.295348.474944.0242
R.GLNKLWNK.G +127.969
R.GLNKLWNKGGIMYAPPIR.- +237.888632.5457
R.GMLSCGVSQGLPGFSAPDDKGNWAGLDVDVCR.A +238.658140.812235.6083
R.GMLSCGVSQGLPGFSAPDDKGNWAGLDVDVCR.A +361.793
R.HGDDQWFDIVK.W +141.99440.058239.1227
R.HGDDQWFDIVK.W +241.788245.098750.3727
R.LKLATPADHAVLPEVISKEPLGPLVR.H +249.334560.621357.099246.5876
R.LKLATPADHAVLPEVISKEPLGPLVR.H +362.757876.514179.90380.938
R.NVGSGSKLEIAR.G +234.4682
R.VFGTDGNLGEQLGLTK.D +127.1765
R.VFGTDGNLGEQLGLTK.D +235.336344.749544.3925
R.VFGTDGNLGEQLGLTKDWVAR.I +235.275150.197247.5485
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA258314.28.84.64.219.4valS valyl-tRNA synthetase 2937609:2940482 forward MW:107230
K.IEPNVHMVPHGDR.S +235.4014
K.ISVADNSAYLEGLPEGAR.E +233.335533.7963
K.TFDPADPSSFIVVATTRPETMLGDSAVAVNPEDER.Y +346.378
R.AEMNIVPSTLTPLVLAGASADTNAR.A +237.6138
R.AWEDAEAFK.A +128.6837
R.DGLLALAPWSR.K +237.9846
R.EAAVAR.K +126.109
R.GEVAALPLKGVVDFAAEQAR.L +258.340450.038445.975342.9622
R.GEVAALPLKGVVDFAAEQAR.L +367.8207
R.LDDFGFLEK.I +125.7432
R.LDDFGFLEK.I +236.5531
R.RIPIVADEYSDPEKGSGAVK.I +347.8434
R.VGEISFADAAPQGAVQLLVR.G +252.966449.281547.7873
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA25908.010.88.08.013.6ispD 4-diphosphocytidyl-2C-methyl-D-erythritol synthase:YgbB 2944754:2945950 reverse MW:41660
R.AGLEALAELKPDIVLIHDAAR.C +244.173130.256152.1724
R.AGLEALAELKPDIVLIHDAAR.C +348.286567.071264.029477.9906
R.AITAAGATGAALPVVPVTDTIK.Q +234.711
R.IAEITGVPVSR.V +241.316436.343438.7337
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA25994.312.95.23.813.3gyrA DNA gyrase subunit A 2956669:2959332 forward MW:98000
K.ALINILPLEQGER.I +236.9093
K.GIVAMSVNSR.N +240.9067
R.AATGEENEPVETPEAEAEEGDTSAALSQER.Y +232.785851.781365.0547
R.AGIR.A +125.6253
R.LFVASTHTPVLFFSSR.G +241.393133.7994
R.LFVASTHTPVLFFSSR.G +376.859548.6141
R.TVGDVIGKYHPHGDQSVYDALVR.M +239.8459
R.TVGDVIGKYHPHGDQSVYDALVR.M +347.1003
R.VPLIDGQGNFGSVDGDMPAAMR.Y +236.134162.977
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA260246.540.135.334.246.5RPA2602 peptidyl prolyl cis-trans isomerase 2960636:2961199 forward MW:20009
K.ASPTSPGGAVTDPDK.M +131.8561
K.ASPTSPGGAVTDPDKMVK.V +130.256639.513341.756736.5065
K.ASPTSPGGAVTDPDKMVK.V +263.924747.229960.593950.5657
K.KASPTSPGGAVTDPDKMVK.V +136.443727.6105
K.KASPTSPGGAVTDPDKMVK.V +242.762641.894830.7283
K.KASPTSPGGAVTDPDKMVK.V +376.18364.0582
K.VQVASDVK.- +131.706829.484126.1419
K.VQVASDVK.- +231.0711
R.ADIAPK.H +128.0687
R.EGFYNNVPFHR.V +127.5899
R.EGFYNNVPFHR.V +232.095634.870730.0244
R.LKQLAR.E +131.577
R.VMGGFMAQTGDGQNFNGTGGSKYPNLK.Q +240.3302
R.VMGGFMAQTGDGQNFNGTGGSKYPNLKQEFSNVPFTR.G +350.445645.017771.331655.607
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA260493.585.289.787.793.5RPA2604 peptidyl prolyl cis-trans isomerase 2961628:2962095 forward MW:16926
K.AEFNAEPHVR.G +126.8549
K.AEFNAEPHVR.G +245.454338.568341.130546.8449
K.AEFNAEPHVR.G +349.2975
K.IEMRPDLAPNHVAR.I +125.485829.299926.665534.5609
K.IEMRPDLAPNHVAR.I +239.660842.591535.771935.1635
K.IEMRPDLAPNHVAR.I +370.505165.829970.451756.4612
K.LKAEFNAEPHVR.G +130.009
K.LKAEFNAEPHVR.G +235.018637.5197
K.LKAEFNAEPHVR.G +360.683646.911465.0357
K.RGEPVKDPDKIVK.A +131.475236.537540.292330.3217
K.RGEPVKDPDKIVK.A +243.7407
K.VIEGMENVDK.I +130.069331.864831.64734.9851
K.VIEGMENVDK.I +230.502736.8606
K.VIEGMENVDKIK.R +131.906841.980236.040139.4534
K.VIEGMENVDKIK.R +259.592357.637658.424948.4767
K.VIEGMENVDKIK.R +350.6005
K.VIEGMENVDKIKR.G +254.6994
K.VIEGMENVDKIKRGEPVKDPDKIVK.A +345.9788
M.ADNDNILILETTQGTVK.I +140.86237.68143.2895
M.ADNDNILILETTQGTVK.I +260.431758.265773.956266.3629
R.AANPDSGDSQFFICFDDAR.F +257.296552.341467.214458.2668
R.EGFYDGIVFHR.V +131.04728.167529.1711
R.EGFYDGIVFHR.V +239.821141.675639.347241.6886
R.FLDKQYTVWGK.V +145.879544.214540.653236.1773
R.FLDKQYTVWGK.V +261.563561.978959.811962.404
R.FLDKQYTVWGK.V +357.694565.937755.2207
R.FLDKQYTVWGKVIEGMENVDKIK.R +351.0547
R.GEPVKDPDKIVK.A +136.199739.92438.286437.7773
R.GEPVKDPDKIVK.A +242.563342.922635.9241
R.GVASMAR.A +125.221325.5606
R.IKELVR.E +136.964131.2168
R.VIEGFMAQTGCPQGTGMGGSGK.K +263.871474.634580.328887.3575
R.VIEGFMAQTGCPQGTGMGGSGKK.L +249.340452.279256.126152.1371
R.VIEGFMAQTGCPQGTGMGGSGKK.L +352.280458.416866.709247.6316
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA264617.318.424.315.231.4RPA2646 putative ABC transporter oligopeptide-binding protein 3010761:3012377 reverse MW:59989
K.ILNYGSTLQLFLTTVDTPDPQTAIFR.Y +233.761734.1546
K.IQEPLVDLDTAGNPVGVLAESWESTPDGK.T +255.818248.448354.67948.371
K.LGTGPIPSTSTDFYPGPNTPQYPYDKQK.A +231.4574
K.LGTGPIPSTSTDFYPGPNTPQYPYDKQK.A +360.1124
K.TITFK.L +125.637925.891626.1562
R.AAAAAQLEAGGLQLSPFSGLTISDMAR.L +246.832433.5366
R.AIAHAINVPFFIENFLGDFAK.L +245.497937.5628
R.AIAHAINVPFFIENFLGDFAK.L +358.016553.634163.397
R.ALPDLGYVSAK.H +137.1544
R.ANTELPIWMPIEQLFVTVITAK.A +238.254246.202135.173
R.ANTELPIWMPIEQLFVTVITAK.A +387.8032
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA264829.621.934.611.947.3RPA2648 unknown protein 3013743:3014525 reverse MW:27818
K.LSHGAPLEFIG.- +128.6817
M.GFQIDHVVVAVANLDQAIVDYRR.L +349.3677
R.ALRVPEGAVR.Q +230.114135.7816
R.NIDADVAAAQSR.G +132.4183
R.SAITLITPTAEGPAGQR.V +248.379345.0741
R.SGPGLVDYALLPR.N +131.3133
R.SGPGLVDYALLPR.N +252.098657.178941.4577
R.SKQSDTPFFCGDVTPR.A +230.27933.4562
R.YAALFGEPAAHVHALPGLGVR.I +262.489258.499857.172749.387
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA266741.957.759.759.764.1RPA2667 conserved unknown protein 3041681:3042427 forward MW:26287
K.AAPAPAQQQAPAPEQQQVQLIYAPWTK.F +257.603259.888653.012357.1618
K.AAPAPAQQQAPAPEQQQVQLIYAPWTK.F +346.833
K.DGRIESGQPVIAAVIIEPEGEPK.K +250.3364
K.FCLKGQDANAK.Q +125.673232.083544.931239.255
K.GQNLIVQAINSNGAPLTLPLPLGEFAK.A +254.268557.017261.305564.6221
K.GQNLIVQAINSNGAPLTLPLPLGEFAK.A +365.538855.672360.0082
K.KGQNLIVQAINSNGAPLTLPLPLGEFAK.A +272.531774.126378.605168.4551
K.KGQNLIVQAINSNGAPLTLPLPLGEFAK.A +358.085969.876462.2822
K.KILRVTLPLGMQLVHGTR.I +353.8498
K.LQEELQK.R +132.1718
K.LQEELQKR.A +127.4403
K.QFEETQKK.L +231.1413
R.IESGQPVIAAVIIEPEGEPK.K +268.703266.425960.75869.6727
R.IESGQPVIAAVIIEPEGEPKK.I +249.484361.986351.4578
R.IESGQPVIAAVIIEPEGEPKK.I +347.6907
R.IESGQPVIAAVIIEPEGEPKKILR.V +238.705937.516935.733935.6418
R.IIVDSNAPQQSPYVICFANGCMSDYEATPDLISQLKK.G +349.803272.560451.688
R.VTLPLGMQLVHGTR.I +125.536839.384428.055325.2042
R.VTLPLGMQLVHGTR.I +254.604150.997253.612548.1344
R.VTLPLGMQLVHGTR.I +361.576957.2755
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA267122.621.421.424.635.7RPA2671 putative FAD-dependent monoxygenase 3044646:3045842 reverse MW:42818
K.FASDEIGMDAFGYNIENR.A +242.2657
R.AAELSNLQRFDDEAESVVPGDDEVIVR.M +257.04451.426833.0461
R.ALHQSALTFNVK.T +140.218128.26726.9081
R.ALLVGLEER.A +254.19646.6165
R.DAGDLAEIVR.D +126.9253
R.DAMANGTDIGSDAVMTR.Y +235.6218
R.FDDEAESVVPGDDEVIVR.M +131.650931.963727.0014
R.FDDEAESVVPGDDEVIVR.M +261.615749.158440.960130.2676
R.IALVGEAAHVVPPIGAQGLNMGLR.D +236.052452.240136.1569
R.IALVGEAAHVVPPIGAQGLNMGLR.D +369.059367.6581
R.SHDNISTEFHTK.E +243.8323
R.TLLSDLLPAQMLR.A +130.295829.512426.7973
R.TLLSDLLPAQMLR.A +251.203859.099947.4681
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA268454.059.945.154.465.4RPA2684 conserved unknown protein 3057686:3058399 forward MW:25114
K.DAGIFGDILCAR.M +235.398937.3222
K.RGITALITDGVVR.D +231.0133
M.SLTPEAIDILSR.V +125.211725.047430.856827.8611
M.SLTPEAIDILSR.V +241.143553.504854.050153.5674
R.AAIEAMPEGCIAVVDAMGIK.D +233.586243.991343.1668
R.AAIEAMPEGCIAVVDAMGIKDAGIFGDILCAR.M +236.332336.227544.649243.075
R.AAIEAMPEGCIAVVDAMGIKDAGIFGDILCAR.M +354.111145.123
R.DIIVADQDGAVLIPQALLDHVLAEGPEQER.M +243.213937.980844.701441.0418
R.DIIVADQDGAVLIPQALLDHVLAEGPEQER.M +358.766378.6244
R.FVPAREDLATPESWASPISTR.A +241.250959.475353.6092
R.FVPAREDLATPESWASPISTR.A +360.945864.401962.294558.2662
R.GITALITDGVVR.D +255.49337.595953.00648.3052
R.LVGEAFTLR.F +130.0074
R.LVGEAFTLR.F +233.850732.702531.6911
R.MEGWIVEEVNNGAVLPGLYPMNAETK.A +231.129
R.VSTATITTVLLK.K +231.895632.9929
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA268651.951.950.553.253.2dapA2 dihydrodipicolinate synthase 3058948:3059841 forward MW:31760
K.AGADAVLVVTPYYNKPTQEGMYQHFK.A +232.278136.963137.8956
K.AGADAVLVVTPYYNKPTQEGMYQHFK.A +349.241948.2855
K.GRVPVIAGAGSNSTR.E +261.019970.313668.301972.8006
K.GRVPVIAGAGSNSTR.E +360.643455.7706
K.HGLTLLGR.I +128.1255
K.HGLTLLGR.I +249.302451.977845.4336
K.LCSDLMGAVFAGDYPGALK.I +130.07838.512950.321635.4315
K.LCSDLMGAVFAGDYPGALK.I +268.539367.702173.02957.271
K.LCSDLMGAVFAGDYPGALK.I +350.6832
R.AAMVHAGVIN.- +128.200133.357632.13532.4606
R.AAMVHAGVIN.- +250.2359
R.GSFTALVTPFK.N +126.4002
R.GSFTALVTPFK.N +230.1073
R.GSFTALVTPFKNGALDEQAFR.S +246.933750.706850.120749.4515
R.GSFTALVTPFKNGALDEQAFR.S +364.382
R.HAEKAGADAVLVVTPYYNKPTQEGMYQHFK.A +234.5068
R.HAEKAGADAVLVVTPYYNKPTQEGMYQHFK.A +364.567571.0424
R.IQEDVRLPLMTVTEPTGK.A +251.597858.257261.521561.5441
R.IQEDVRLPLMTVTEPTGK.A +362.3773
R.LPLMTVTEPTGK.A +126.9301
R.LPLMTVTEPTGK.A +231.613635.769338.3276
R.LVPLHDAVFKEPGVAGAK.H +143.999228.4705
R.LVPLHDAVFKEPGVAGAK.H +246.145454.462255.960360.133
R.LYELDNIVGVK.D +140.944937.681732.860726.8042
R.LYELDNIVGVK.D +250.627250.242542.525
R.LYELDNIVGVKDATANLGR.V +255.476354.242455.84152.932
R.LYELDNIVGVKDATANLGR.V +351.142465.1948
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA269124.135.610.217.143.1RPA2691 DUF88 3062237:3062887 reverse MW:24439
K.IALFIDGANLYATAK.T +127.0692
K.VKGNMDIELAVDAMELAEHIDQMVLFSGDGDFR.S +347.2035
M.STSSSNKIALFIDGANLYATAK.T +243.359931.8279
R.AGADDFED.- +131.0972
R.LLKEFQSR.G +127.453727.133333.5758
R.QADIFTDLVELQSK.I +136.192938.2673
R.QADIFTDLVELQSK.I +263.294963.773662.899961.8142
R.SLVEAVQR.R +241.4941
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA269278.597.797.797.797.7rnpO RNA polymerase omega subunit 3063234:3063626 forward MW:14368
K.EELVHSLQK.F +132.415138.693
K.FVEVDEPEPDTVPLIGSAGASVDADDTEVAMER.M +232.411238.840932.810339.9717
K.FVEVDEPEPDTVPLIGSAGASVDADDTEVAMER.M +350.2807
K.GLEGLAPPEEQPEEDE.- +133.342636.576137.1248
M.ARVTVEDCIDKVDNR.F +239.1755
M.ARVTVEDCIDKVDNRFDLVLLAAHR.A +354.007463.825757.423
R.EIADQTISPEDLK.E +145.4885
R.EIADQTISPEDLK.E +242.592940.7357
R.EIADQTISPEDLKEELVHSLQK.F +245.370245.058755.951751.6825
R.EIADQTISPEDLKEELVHSLQK.F +349.0748.4492
R.MISSGSPLTIDRDNDKNPVVSLR.E +233.691932.934832.9738
R.MISSGSPLTIDRDNDKNPVVSLR.E +360.880761.002374.314650.3395
R.MTEEELLK.G +127.372928.552
R.MTEEELLKGLEGLAPPEEQPEEDE.- +256.314453.226844.273352.5762
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA271246.644.364.336.667.1hemB delta-aminolevulinic acid dehydratase 3084385:3085437 reverse MW:38416
K.LDIPCIALFPFTEPSLR.D +246.917640.1197
K.LDIPCIALFPFTEPSLR.D +350.4311
K.LDIPCIALFPFTEPSLRDEHGTEAANPENLICK.T +356.4254.1547
K.RAGANGVLTYFAPAAAEK.L +238.0899
K.YASAFYGPFR.D +125.5319
K.YASAFYGPFR.D +240.064443.177944.2774
K.YASAFYGPFRDAIGSAK.A +262.007746.350938.7075
R.AAKLDIPCIALFPFTEPSLR.D +235.2174
R.AAKLDIPCIALFPFTEPSLRDEHGTEAANPENLICK.T +346.764448.3706
R.AGANGVLTYFAPAAAEK.L +135.526641.304232.0574
R.AGANGVLTYFAPAAAEK.L +250.052945.559443.6728
R.AGANGVLTYFAPAAAEKLR.Q +230.8671
R.AIKKEFPQIGVLCDVALDPYTSHGHDGLIEDGR.I +352.257547.6369
R.AMMESLLAFK.R +127.595126.889
R.AMMESLLAFK.R +242.091244.579643.072640.2983
R.AMMESLLAFKR.A +127.3349
R.AMMESLLAFKR.A +345.7653
R.DEHGTEAANPENLICK.T +243.252239.72633.3429
R.ENVLTTDDLIWPMFVVDGTNQR.V +258.185262.838233.375941.6936
R.ENVLTTDDLIWPMFVVDGTNQR.V +346.4636
R.ILNDETVAVLVQQSLVQAQAGCDVIAPSDMMDGR.I +233.261
R.LSVDQIVR.D +127.2195
R.LSVDQIVR.D +248.390749.776649.05247.2506
R.RLVRENVLTTDDLIWPMFVVDGTNQR.V +345.664
R.TYQMDPANTDEAIREVELDLAEGADMVMVKPGMPYLDIVR.R +350.816249.874649.6224
R.VQVASMPGVER.L +125.9051
R.VQVASMPGVER.L +248.328749.547149.573840.3524
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA271529.119.852.345.352.3RPA2715 possible transcriptional regulator, MarR family 3088091:3088609 forward MW:19653
M.IKAVATAAEASAPAVAANTPVQPLYLEALTLVER.L +230.6287
M.IKAVATAAEASAPAVAANTPVQPLYLEALTLVER.L +357.284
R.ADINSVQALLLYNIGDKELTAGELR.T +244.332836.999456.004137.7782
R.ADINSVQALLLYNIGDKELTAGELR.T +350.84171.0909
R.FWTDQILYRL.- +233.115241.22135.9426
R.HIVDALYQK.H +135.182341.182830.990131.6939
R.HIVDALYQK.H +238.148642.175533.3999
R.LLDVIK.D +126.514
R.RLLDVIKDEFDR.R +230.4421
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA272456.761.352.538.964.6glyA1 glycine hydroxymethyltransferase 3093944:3095242 forward MW:46185
K.ALAETLR.S +125.5746
K.AVAFKEALQPDFK.V +132.1944
K.AVAFKEALQPDFK.V +244.469938.2106
K.EALQPDFK.V +128.46733.701927.439
K.EALQPDFKVYTK.N +131.376933.463826.8057
K.EALQPDFKVYTK.N +233.3852
K.ELTDRFPIYQ.- +134.803137.7069
K.ELTDRFPIYQ.- +234.1662
K.FNSAIFPGLQGGPLMHVIAAK.A +241.176530.3735
K.FNSAIFPGLQGGPLMHVIAAK.A +346.2006
K.GLKGNVSEK.A +127.657327.906126.3815
K.KFNSAIFPGLQGGPLMHVIAAK.A +250.121551.409552.016440.4963
K.KFNSAIFPGLQGGPLMHVIAAK.A +394.1019102.73781.9439110.472
K.LIIAGGSAYPR.A +126.319129.9637
K.LIIAGGSAYPR.A +272.483962.668761.090960.5867
K.NGIPFDPEKPFVTSGLR.L +232.619931.6713
K.NVVENAK.A +133.298630.8529.11125.9122
K.WFKPVHYTVR.R +125.8055
K.WFKPVHYTVR.R +235.492334.8805
K.WFKPVHYTVR.R +346.3954
M.STANPASAPDSFFSASLEQADPEIAAAIR.G +262.323863.964761.05362.1256
M.STANPASAPDSFFSASLEQADPEIAAAIR.G +366.425976.5948
M.STANPASAPDSFFSASLEQADPEIAAAIRGELGR.Q +350.256149.191
R.AGITCNKNGIPFDPEKPFVTSGLR.L +244.850136.99239.996534.9181
R.AGITCNKNGIPFDPEKPFVTSGLR.L +356.808864.835156.368546.2111
R.AVLEAQGSVMTNKYAEGYPGNR.Y +242.8635
R.AVLEAQGSVMTNKYAEGYPGNR.Y +358.7162
R.EDQMIDMDAVAK.L +135.8232
R.EDQMIDMDAVAK.L +231.3195
R.GFGVAEFQQVGHLIAEVLNAIAQSSDGAAPLVEASVK.Q +246.751
R.GFGVAEFQQVGHLIAEVLNAIAQSSDGAAPLVEASVK.Q +348.522350.128446.047
R.GGLILTNDEALAK.K +134.388233.925830.833636.097
R.GGLILTNDEALAK.K +261.758664.343652.629963.2719
R.GGLILTNDEALAKK.F +246.757639.5386
R.REDQMIDMDAVAK.L +140.239138.35933.7903
R.REDQMIDMDAVAK.L +270.611463.768456.965650.8825
R.REDQMIDMDAVAK.L +350.157755.6765
R.SAGFDLVSGGTDNHLMLVDLRPK.G +255.507655.112862.039154.4919
R.SAGFDLVSGGTDNHLMLVDLRPK.G +359.100457.616258.2755
R.VKELTDRFPIYQ.- +135.568936.709131.285626.6772
R.VKELTDRFPIYQ.- +261.205567.791156.165552.6109
R.YYGGCEFVDVAENLAIDR.A +230.538934.7109
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA27264.99.812.110.017.2ribD putative riboflavin-specific deaminase / reductase 3095824:3096993 forward MW:40746
R.ILEEQIGQK.L +130.1772
R.TAPNPAVGAVLVKDGVIVGR.G +234.2036
R.TTPLWLMASEIAEAATAAR.L +247.158235.937849.56
R.TTPLWLMASEIAEAATAAR.L +345.084653.1484
R.VVSAIEDPNPLVAGQGHAR.L +233.779144.0131
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA272721.823.321.821.823.3ribC riboflavin synthase alpha chain 3097004:3097612 forward MW:21515
-.MFTGIVTDIGEIETVKPVAQGQLHR.L +235.724645.79340.399138.9079
-.MFTGIVTDIGEIETVKPVAQGQLHR.L +354.5739
K.IGDELGGHIVTGHVDGIAK.V +133.193633.3381
K.IGDELGGHIVTGHVDGIAK.V +257.926645.688844.6998
K.IGDELGGHIVTGHVDGIAK.V +357.908161.03752.5671
R.ALKIGDELGGHIVTGHVDGIAK.V +239.0431
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA272825.225.239.339.353.4ribE riboflavin synthase, beta chain 3097743:3098234 forward MW:17087
K.AAGATHDVLTVPGALEIPAAVAIAIDSAEAAGKPYDAAIALGCVVR.G +354.572646.1063
R.ALMDLSVAR.K +233.226240.1544
R.FYDDIQDALLEGAVAELK.A +276.522472.482557.530284.4997
R.FYDDIQDALLEGAVAELK.A +358.7638
R.RAPLKDQTDVSGAR.V +126.5524
R.RAPLKDQTDVSGAR.V +233.8068
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA27312.01.84.54.54.5RPA2731 H+ translocating pyrophosphate synthase 3100167:3102287 forward MW:71953
K.AVDLLTK.A +133.534931.9584
K.STDALDAVGNTTK.A +140.804938.982243.646741.4755
K.STDALDAVGNTTK.A +262.398557.696755.472551.3277
R.AAGAIVEEVRR.Q +241.654239.5924
R.KSTDALDAVGNTTK.A +130.833151.049643.6513
R.KSTDALDAVGNTTK.A +263.335955.4086
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA273231.237.540.083.883.8RPA2732 conserved hypothetical protein 3102449:3102691 forward MW:8528
K.GHHHFIDGGLVAEVEGDKVR.L +235.4944
M.SGVSGIKEHMEVIGADGTHVGTVDR.V +251.831956.942469.543374.2123
M.SGVSGIKEHMEVIGADGTHVGTVDR.V +357.2179.097100.658104.824
M.SGVSGIKEHMEVIGADGTHVGTVDRVDGDR.I +347.590462.710658.1131
M.SGVSGIKEHMEVIGADGTHVGTVDRVDGDRIK.L +364.1361.541
R.LSANADVAVTMEEEK.- +128.7208
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA274242.455.173.763.673.7himA integration host factor alpha subunit 3112791:3113147 forward MW:12834
K.LSSFGSFLVR.Q +233.554934.513640.7915
K.TGTEVPISPR.R +125.2121
K.TGTEVPISPR.R +231.108232.86433.122730.3922
R.INANGAMPMSTEESDENTAQSASGG.- +255.585253.98655.2129
R.RVMVFKPSAILK.Q +231.7594
R.TESSAFVELVLKEITDCLER.G +249.1096
R.TESSAFVELVLKEITDCLER.G +363.977148.004662.704857.2713
R.VDLCEAVYQK.V +138.097434.174331.9738
R.VDLCEAVYQK.V +238.079630.9109
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA275562.558.134.441.266.2RPA2755 possible DNA-binding stress protein 3128515:3128997 reverse MW:18247
K.AMEMVR.H +129.256529.4336
K.IADGLSR.L +126.3056
K.INIGIPEDK.R +235.98
K.INIGIPEDKREK.I +128.3192
K.INIGIPEDKREK.I +233.0679
K.LASIAEVEGQPK.A +137.425736.929332.015533.6801
K.LASIAEVEGQPK.A +265.821265.851448.545862.3204
K.TAWMLR.S +128.186926.7514
M.TKPAKINIGIPEDK.R +126.5829
M.TKPAKINIGIPEDKR.E +233.6172
M.TKPAKINIGIPEDKREK.I +135.6602
M.TKPAKINIGIPEDKREK.I +264.740261.46645.0157
R.ALGFPAPGTYKEFVK.L +125.903340.3336
R.ALGFPAPGTYKEFVK.L +231.0803
R.ELFPLVEDANDQPTADLLTQR.L +266.24666.864677.403577.2429
R.ELFPLVEDANDQPTADLLTQR.L +359.323274.5348
R.ELFPLVEDANDQPTADLLTQRLDVHEK.T +230.3381
R.HLVTAQEATAR.T +140.529236.685442.405336.3352
R.HLVTAQEATAR.T +259.010762.670360.802561.2921
R.SLLED.- +128.67225.221326.58925.2501
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA276343.235.935.723.952.1RPA2763 putative O-acetylhomoserine sulfhydrylase 3135410:3136690 reverse MW:45155
K.AVDEVNYSGLASSK.Y +135.853531.3602
K.AVDEVNYSGLASSK.Y +230.9763
K.LFSHLANVGDTR.S +129.4221
K.LFSHLANVGDTR.S +232.1941
K.SFGWNVVWADTDDLASFQR.A +235.7072
K.TAAGAAPNMVR.V +126.29
K.TAAGAAPNMVR.V +241.0948
M.TERNPGFATLAVHAGAQPDPTTGAR.A +243.0245.6597
M.TERNPGFATLAVHAGAQPDPTTGAR.A +379.117468.298364.646877.3012
R.ATPIYQTTSFVFNDADHAASLFGLQAFGNIYTR.I +241.887934.842141.760643.4428
R.ATPIYQTTSFVFNDADHAASLFGLQAFGNIYTR.I +359.471362.817366.860362.1143
R.DLGPALSPFNAFMLLTGIETLPLR.M +243.5712
R.ITNPTTSVLEER.V +251.952339.561843.6627
R.ITNPTTSVLEERVAALEGGTAALATASGHAAQLVALQQLMQPGDEFIAAR.K +349.9682
R.KLYGGSINQFTHAFK.S +140.9215
R.KLYGGSINQFTHAFK.S +242.58339.822
R.KLYGGSINQFTHAFK.S +347.178846.2104
R.NPGFATLAVHAGAQPDPTTGAR.A +241.189843.432346.3648
R.NPGFATLAVHAGAQPDPTTGAR.A +356.5685
R.SLIIHPASTTHSQLDDAQK.T +264.630265.079274.385361.5442
R.SLIIHPASTTHSQLDDAQK.T +367.697169.592553.376953.5047
R.SLIIHPASTTHSQLDDAQKTAAGAAPNMVR.V +235.224553.27444.140551.1283
R.SLIIHPASTTHSQLDDAQKTAAGAAPNMVR.V +377.94270.131291.537887.4427
R.VAALEGGTAALATASGHAAQLVALQQLMQPGDEFIAAR.K +240.4373
R.VAALEGGTAALATASGHAAQLVALQQLMQPGDEFIAAR.K +349.2195
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA276768.259.151.353.278.6rplM, L13 ribosomal protein L13 3139021:3139485 forward MW:17173
-.MKTFSAKPAEVTKK.W +235.3588
K.AILEGRFPER.V +230.250234.2228
K.HLPTYTPHVDCGDNVIIINASK.V +248.856338.056361.55539.7896
K.HLPTYTPHVDCGDNVIIINASK.V +349.3153
K.KWVIIDATGLVVGR.L +235.63241.5929
K.LDIGAMNRK.N +232.592
K.VYYHHTGFIGGIK.E +136.5005
K.VYYHHTGFIGGIKER.S +233.2985
K.VYYHHTGFIGGIKER.S +350.2884
K.WVIIDATGLVVGR.L +245.874443.395939.281134.1214
R.DNKVYYHHTGFIGGIKER.S +236.090734.7772
R.GKHLPTYTPHVDCGDNVIIINASK.V +246.173
R.KRDNKVYYHHTGFIGGIKER.S +348.926260.9761
R.LATLVAMR.L +246.903744.76846.128744.5412
R.VQMGNLR.V +236.1792
R.VYPGAEHPHEAQQPEK.L +133.3044
R.VYPGAEHPHEAQQPEKLDIGAMNRK.N +244.74243.69450.425445.0235
R.VYPGAEHPHEAQQPEKLDIGAMNRK.N +352.878368.595258.62450.2562
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA276850.645.050.645.050.6rpsI, S9 ribosomal protein S9 3139487:3139969 forward MW:17497
K.ALTNFEPELR.S +130.034726.924838.321528.9498
K.ALTNFEPELR.S +247.954144.559348.705444.3302
K.TTVTGADAPTYTK.K +128.391630.588436.0168
K.TTVTGADAPTYTK.K +247.933537.378933.884641.7848
M.SETMQSLDQLAALK.T +127.868228.0602
M.SETMQSLDQLAALK.T +259.121750.594146.52846.5867
M.SETMQSLDQLAALKTTVTGADAPTYTK.K +234.338159.295946.8157
R.AGQYDVICTVAGGGLSGQAGAVR.H +294.142672.747689.385278.6194
R.AGQYDVICTVAGGGLSGQAGAVR.H +375.752249.9939
R.MMIQQPLVAAAR.A +138.385734.589938.14638.042
R.MMIQQPLVAAAR.A +268.00664.374465.963166.92
R.VWIKPGAGK.I +131.430237.8076
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA278244.848.141.641.048.1dctP2 TrapT family, dctP subunit, C4-dicarboxylate periplasmic binding protein 3155357:3156376 reverse MW:37341
K.AFDAAPASINFSEVYSALQTK.V +255.7670.643574.262653.7785
K.AGLMVMDK.I +138.763932.4188
K.AGLMVMDK.I +234.4043
K.GKYGDQAWSLLEK.S +146.465251.193339.874743.0757
K.GKYGDQAWSLLEK.S +274.696768.867968.105159.5874
K.GKYGDQAWSLLEK.S +347.622
K.GLIFNQPPVMPFR.D +231.970833.950337.2005
K.GLIFNQPPVMPFRDK.L +234.113237.359734.952140.6468
K.GLIFNQPPVMPFRDKLR.S +230.930936.240732.0348
K.HINAAAVKEREDTAKLNATVKEELTAK.G +241.3646
K.HINAAAVKEREDTAKLNATVKEELTAK.G +355.982558.56183.405671.7616
K.IRVPVSPLWTSMFK.A +236.246231.8586
K.IRVPVSPLWTSMFK.A +361.672162.1031
K.VQIDVFPNNQLGSDTDMLSQIR.A +243.744150.991841.897937.6511
K.VVEGQENPLVLISAAK.L +126.333827.7552
K.VVEGQENPLVLISAAK.L +257.52959.598152.2554
K.YANNLPDTHPLNVR.A +131.661233.257633.053336.7433
K.YANNLPDTHPLNVR.A +255.629248.803647.96749.9192
K.YANNLPDTHPLNVR.A +352.497862.053654.995156.0074
K.YGDQAWSLLEK.S +133.256539.449237.154630.0342
K.YGDQAWSLLEK.S +250.523455.153954.7136
K.YKYANNLPDTHPLNVR.A +138.099826.9406
K.YKYANNLPDTHPLNVR.A +247.336540.63736.177946.3816
K.YKYANNLPDTHPLNVR.A +351.124845.790748.6214
R.SAGFYAEWK.G +128.888534.002130.8075
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA280127.355.880.080.080.0RPA2801 Collagen triple helix repeat 3176255:3176752 reverse MW:15559
K.AGQEVEVVGTGDK.A +126.470744.808747.185747.5241
K.AGQEVEVVGTGDKAK.S +148.256157.59652.862653.2201
K.AGQEVEVVGTGDKAK.S +255.915952.095162.118264.8832
K.FSLSDVPETCK.L +243.040245.4367
K.FSLSDVPETCKLDLK.S +128.243727.268729.9835
K.FSLSDVPETCKLDLK.S +236.705438.084937.7207
K.FSLSDVPETCKLDLK.S +347.447
K.GDAGPAGPAGPAGPAGPSGATGPAGPKGEAGEAAPKN.- +234.3258
K.GDAGPAGPAGPAGPAGPSGATGPAGPKGEAGEAAPKN.- +359.781456.3974
K.GEAGAAGAPGPAGPAGPAGPAGPAGPKGDAGPAGPAGPAGPAGPSGATGPAGPK.G +345.791259.4349
K.LVITGK.T +129.138134.304131.850834.0206
K.SGTETLTGLLVANCGPR.G +125.707
K.SGTETLTGLLVANCGPR.G +243.122657.499444.9081
K.SGTETLTGLLVANCGPRGPK.G +241.452341.5545
K.SGTETLTGLLVANCGPRGPKGEAGAAGAPGPAGPAGPAGPAGPAGPK.G +366.2712
K.TTKAGQEVEVVGTGDK.A +231.427338.572
K.TTKAGQEVEVVGTGDKAK.S +139.217139.517
K.TTKAGQEVEVVGTGDKAK.S +241.881855.5102
R.FKFSLSDVPETCK.L +149.46730.8708
R.FKFSLSDVPETCK.L +246.263461.078154.5464
R.FKFSLSDVPETCKLDLK.S +127.7187
R.FKFSLSDVPETCKLDLK.S +240.009232.589249.438461.4958
R.FKFSLSDVPETCKLDLK.S +359.350845.6465
R.GPKGEAGAAGAPGPAGPAGPAGPAGPAGPK.G +249.5611
R.GPKGEAGAAGAPGPAGPAGPAGPAGPAGPKGDAGPAGPAGPAGPAGPSGATGPAGPK.G +357.146155.4173
R.LAIESGK.L +133.451429.8097
R.LAIESGKLVITGK.T +135.332527.293243.187936.458
R.LAIESGKLVITGK.T +252.916549.3261
Locuswt_anaer_light_1
2pep_def
wt_anaer_light_2
2pep_def
wt_anaer_auto_1
2pep_def
wt_anaer_auto_2
2pep_def
TotalDescription
RPA281452.752.758.752.758.7ssb single-strand DNA-binding protein 3188088:3188591 reverse MW:17827
K.VAEQYLR.K +128.0491
K.VAEQYLR.K +245.003237.745643.8025
K.VILVGNLGADPEIKR.T +235.971932.417530.4285
K.VYIEGQLQTR.K +231.8715
M.AGSVNKVILVGNLGADPEIKR.T +273.045967.897462.907964.9988
M.AGSVNKVILVGNLGADPEIKR.T +368.344183.875584.367278.4359
R.SGGGGGGGYGDDNSGGDFGSSGPSGGGGAR.R +247.455352.750454.0572<