D simple2

DTASelect v1.9
/home/51n/myMS/article/sequest/nathanPSM/tryptic/simple2
/home/51n/myMS/db/psmDB/20040623-Scale-8956.fasta
SEQUEST-PVM v.27 in SQT format.
-1 1.769716 -2 1.93009 -3 2.639938 --DB -d 0 -p 2
Jump to the summary table.

sequest.params modifications:

true	Use criteria
1.769716	Minimum +1 XCorr
1.93009	Minimum +2 XCorr
2.639938	Minimum +3 XCorr
0.0	Minimum DeltCN
1	Minimum charge state
3	Maximum charge state
0.0	Minimum ion proportion
1000	Maximum Sp rank
-1.0	Minimum Sp score
Include	Modified peptide inclusion
Any	Tryptic status requirement
true	Multiple, ambiguous IDs allowed
Ignore	Peptide validation handling
XCorr	Purge duplicate peptides by protein
false	Include only loci with unique peptide
false	Remove subset proteins
Ignore	Locus validation handling
0	Minimum modified peptides per locus
10	Minimum redundancy for low coverage loci
2	Minimum peptides per locus

Locus Key:

Validation Status

Locus

Sequence Count

Spectrum Count

Sequence Coverage

Length

MolWt

Descriptive Name

Similarity Key:

Locus

# of identical peptides

# of differing peptides

std_gi|2506462|sp|P02188|MYG_HORSE

100.0%

153

16951

7.8

MYOGLOBIN gi|494712|pdb|1YMB| Metmyoglobin (Horse Heart) gi|494713|pdb|1YMC| Cyanomet-Sulfmyoglobin (Horse Heart) gi|2914628|pdb|1WLA| Myoglobin (Horse Heart) Recombinant Wild-Type gi|2982074|pdb|1AZI| Myoglobin (Horse Heart) Recombinant Wild-Type Complexed With Azide [MASS=16951]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1030.1030.1	3.0289	0.5625	1816.76	1817.011	1	399.5	46.7%	1	-.GLSDGEWQQVLNVWGK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1029.1029.2	4.6381	0.593	1817.24	1817.011	1	2094.3	73.3%	1	-.GLSDGEWQQVLNVWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1190.1190.2	3.2229	0.5906	3404.12	3405.7947	1	295.1	26.7%	1	-.GLSDGEWQQVLNVWGKVEADIAGHGQEVLIR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1186.1186.3	7.0495	0.6673	3406.3	3405.7947	1	2090.8	33.3%	1	-.GLSDGEWQQVLNVWGKVEADIAGHGQEVLIR.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.730.730.1	3.1316	0.5267	1606.92	1607.8069	1	345.5	50.0%	1	K.VEADIAGHGQEVLIR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.729.729.2	4.4611	0.4957	1608.1	1607.8069	1	1869.6	85.7%	1	K.VEADIAGHGQEVLIR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.660.660.1	2.6236	0.4064	1271.7	1272.4435	1	572.9	65.0%	1	R.LFTGHPETLEK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.662.662.2	2.8677	0.3934	1274.1	1272.4435	1	645.7	75.0%	1	R.LFTGHPETLEK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.726.726.2	2.18	0.1404	1663.62	1662.8828	1	353.8	50.0%	1	R.LFTGHPETLEKFDK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.727.727.3	2.7017	0.4124	1665.19	1662.8828	1	377.8	38.5%	1	R.LFTGHPETLEKFDK.F	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.754.754.2	3.0801	0.4968	1938.0	1938.2334	1	533.8	53.3%	1	R.LFTGHPETLEKFDKFK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.396.396.2	3.4506	0.5422	1363.88	1362.6299	1	1501.9	90.0%	1	K.FKHLKTEAEMK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.400.400.3	3.1645	0.3144	1364.05	1362.6299	1	863.1	60.0%	1	K.FKHLKTEAEMK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.268.268.1	2.3572	0.5501	1086.6	1087.2793	1	527.9	68.8%	2	K.HLKTEAEMK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.273.273.2	3.0527	0.4332	1088.0	1087.2793	1	961.2	87.5%	1	K.HLKTEAEMK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.494.494.2	4.4737	0.5737	1858.6	1859.148	1	1660.4	76.7%	1	K.HLKTEAEMKASEDLKK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.421.421.1	3.1569	0.5353	1479.68	1480.6733	1	546.0	62.5%	1	K.TEAEMKASEDLKK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.419.419.2	3.979	0.5346	1480.76	1480.6733	1	1695.5	79.2%	1	K.TEAEMKASEDLKK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.929.929.1	3.4905	0.5168	1378.86	1379.686	1	712.2	61.5%	1	K.HGTVVLTALGGILK.K	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.930.930.2	4.3501	0.6859	1379.72	1379.686	1	1752.9	92.3%	1	K.HGTVVLTALGGILK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.935.935.3	3.265	0.4149	1380.16	1379.686	1	1121.4	50.0%	1	K.HGTVVLTALGGILK.K	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.854.854.1	3.3301	0.5421	1506.89	1507.8601	1	741.8	60.7%	1	K.HGTVVLTALGGILKK.K	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.855.855.2	4.4289	0.7364	1508.36	1507.8601	1	1889.2	78.6%	1	K.HGTVVLTALGGILKK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.856.856.3	4.424	0.6355	1508.56	1507.8601	1	2783.8	67.9%	1	K.HGTVVLTALGGILKK.K	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.319.319.2	4.6826	0.5821	2110.94	2111.4116	1	1168.7	58.3%	2	K.KKGHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.303.303.3	4.356	0.4885	2112.19	2111.4116	1	1145.4	45.8%	1	K.KKGHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.324.324.1	4.6347	0.6479	1982.0	1983.2375	1	964.0	58.8%	1	K.KGHHEAELKPLAQSHATK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.323.323.3	4.3802	0.396	1983.19	1983.2375	1	1033.1	45.6%	1	K.KGHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.343.343.2	4.8896	0.5907	1983.86	1983.2375	1	1236.5	61.8%	2	K.KGHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.348.348.1	4.4345	0.6763	1853.86	1855.0635	1	685.8	53.1%	1	K.GHHEAELKPLAQSHATK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.373.373.2	3.6839	0.6118	1854.18	1855.0635	1	661.5	56.2%	3	K.GHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.349.349.3	2.6698	0.5751	1855.72	1855.0635	1	998.2	45.3%	1	K.GHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1111.1111.2	5.2261	0.6679	2602.1	2603.1257	1	1056.3	45.2%	1	K.HKIPIKYLEFISDAIIHVLHSK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1109.1109.3	5.5182	0.637	2603.53	2603.1257	1	566.5	32.1%	1	K.HKIPIKYLEFISDAIIHVLHSK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1055.1055.3	4.5653	0.5422	4087.42	4087.732	1	512.2	23.6%	1	K.HKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1097.1097.3	3.0453	0.5025	1886.95	1886.201	1	727.6	50.0%	1	K.YLEFISDAIIHVLHSK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1094.1094.2	5.0902	0.7379	1887.3	1886.201	1	1425.0	73.3%	2	K.YLEFISDAIIHVLHSK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1106.1106.1	3.6728	0.6334	1887.82	1886.201	1	656.7	60.0%	2	K.YLEFISDAIIHVLHSK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1052.1052.2	3.5427	0.634	3369.6	3370.8071	1	305.8	25.0%	1	K.YLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1049.1049.3	6.178	0.6987	3370.69	3370.8071	1	1023.3	31.7%	1	K.YLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.639.639.1	2.4895	0.5154	1502.58	1503.6293	1	430.1	60.7%	1	K.HPGDFGADAQGAMTK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.642.642.3	3.7425	0.6073	1505.14	1503.6293	1	1715.8	55.4%	1	K.HPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.640.640.2	3.3832	0.6692	1505.38	1503.6293	1	617.0	67.9%	1	K.HPGDFGADAQGAMTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.787.787.1	2.2634	0.4169	1360.72	1361.584	6	144.6	45.5%	1	K.ALELFRNDIAAK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.792.792.2	2.5303	0.0518	1362.52	1361.584	5	398.9	50.0%	1	K.ALELFRNDIAAK.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.937.937.2	4.1127	0.629	2284.52	2284.62	1	891.1	44.7%	1	K.ALELFRNDIAAKYKELGFQG.-	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.195.195.1	2.0482	0.0306	631.6	631.7068	1	404.2	80.0%	3	R.NDIAAK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.687.687.1	2.3096	0.5445	941.59	942.0593	1	411.8	71.4%	1	K.YKELGFQG.-	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.689.689.2	2.4491	0.5315	942.38	942.0593	1	838.0	85.7%	1	K.YKELGFQG.-	2

std_gi|122572|sp|P02070|HBB_BOVIN

95.9%

145

15954

7.6

HEMOGLOBIN BETA CHAIN gi|70412|pir||HBBOB hemoglobin beta chain - bovine gi|576143|pdb|1HDA|B Bos taurus gi|576145|pdb|1HDA|D Bos taurus gi|395 (X00376) beta-globin [Bos taurus] gi|162741 (M63453) beta-globin [Bos taurus] [MASS=15954]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.289.289.1	1.9175	0.2728	821.44	821.9641	1	542.2	83.3%	3	-.MLTAEEK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.917.917.2	4.5632	0.6623	1753.92	1754.054	1	1322.7	66.7%	1	-.MLTAEEKAAVTAFWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.766.766.1	2.1238	0.3749	950.79	951.113	1	609.7	62.5%	1	K.AAVTAFWGK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.776.776.2	2.8685	0.4337	952.76	951.113	1	1052.2	87.5%	1	K.AAVTAFWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.669.669.1	3.2176	0.4512	1328.84	1329.496	1	427.4	62.5%	1	K.VKVDEVGGEALGR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.670.670.2	4.5399	0.5679	1330.0	1329.496	1	1643.4	83.3%	1	K.VKVDEVGGEALGR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.677.677.3	3.551	0.3905	1330.57	1329.496	3	1017.7	45.8%	1	K.VKVDEVGGEALGR.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.629.629.1	2.0632	0.4133	1101.62	1102.1895	1	307.7	60.0%	1	K.VDEVGGEALGR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.632.632.2	3.7129	0.455	1102.62	1102.1895	1	1234.1	85.0%	1	K.VDEVGGEALGR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.895.895.2	2.703	0.4543	1275.96	1275.5363	1	1027.3	77.8%	1	R.LLVVYPWTQR.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1169.1169.3	5.5404	0.6515	3348.55	3347.8127	1	1294.1	31.2%	1	R.LLVVYPWTQRFFESFGDLSTADAVMNNPK.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.939.939.2	5.4983	0.6134	2090.58	2091.2996	1	1782.8	66.7%	5	R.FFESFGDLSTADAVMNNPK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.945.945.3	5.2429	0.4387	2091.79	2091.2996	1	1193.8	41.7%	1	R.FFESFGDLSTADAVMNNPK.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.672.672.1	2.5378	0.5631	1225.59	1226.4333	1	369.5	65.0%	1	K.KVLDSFSNGMK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.709.709.1	2.4596	0.4257	1097.45	1098.2592	1	411.5	66.7%	1	K.VLDSFSNGMK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.711.711.2	2.598	0.37	1098.68	1098.2592	1	512.0	77.8%	1	K.VLDSFSNGMK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.290.290.1	2.046	0.4808	740.66	740.8345	1	343.8	80.0%	1	K.HLDDLK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.931.931.3	4.7581	0.6276	3194.02	3194.589	1	1092.0	36.1%	1	K.HLDDLKGTFAALSELHCDKLHVDPENFK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.680.680.1	2.5344	0.4323	1098.65	1099.2314	1	352.0	68.8%	1	K.LHVDPENFK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1069.1069.1	2.1577	0.3624	1265.88	1266.6133	3	205.3	45.5%	1	K.LLGNVLVVVLAR.N	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1070.1070.2	4.0595	0.6121	1267.9	1266.6133	1	1317.6	86.4%	1	K.LLGNVLVVVLAR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.852.852.1	3.5335	0.6418	1869.79	1870.1149	1	423.3	53.3%	1	R.NFGKEFTPVLQADFQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.850.850.2	4.7543	0.645	1870.06	1870.1149	1	1350.9	76.7%	1	R.NFGKEFTPVLQADFQK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1156.1156.2	3.7011	0.6463	3328.38	3329.7886	1	352.7	31.0%	1	R.NFGKEFTPVLQADFQKVVAGVANALAHRYH.-	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1149.1149.3	4.6761	0.6456	3330.76	3329.7886	1	598.1	26.7%	1	R.NFGKEFTPVLQADFQKVVAGVANALAHRYH.-	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.829.829.1	2.8579	0.5808	1422.66	1423.6085	1	341.0	68.2%	1	K.EFTPVLQADFQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.684.684.1	2.2249	0.3716	1177.55	1178.3799	1	203.4	45.5%	1	K.VVAGVANALAHR.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.685.685.2	3.7331	0.5274	1178.9	1178.3799	1	1911.8	95.5%	1	K.VVAGVANALAHR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.710.710.2	3.7839	0.6191	1478.84	1478.6969	1	2148.1	80.8%	1	K.VVAGVANALAHRYH.-	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.707.707.3	2.8951	0.5523	1480.09	1478.6969	1	409.0	46.2%	1	K.VVAGVANALAHRYH.-	3

std_gi|122361|sp|P01966|HBA_BOVIN

86.5%

141

15053

8.4

HEMOGLOBIN ALPHA CHAIN gi|70238|pir||HABO hemoglobin alpha chain - bovine gi|576142|pdb|1HDA|A Bos taurus gi|576144|pdb|1HDA|C Bos taurus [MASS=15053]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.249.249.1	1.9334	0.3932	703.59	703.8137	1	634.9	83.3%	1	-.VLSAADK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.278.278.1	2.8129	0.4494	1101.62	1102.2761	1	548.4	70.0%	2	-.VLSAADKGNVK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.281.281.2	2.8409	0.5116	1102.62	1102.2761	1	858.7	80.0%	1	-.VLSAADKGNVK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.675.675.1	3.7343	0.4902	1529.73	1530.6371	1	594.2	57.1%	1	K.VGGHAAEYGAEALER.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.671.671.2	4.3008	0.626	1531.3	1530.6371	1	1838.5	71.4%	1	K.VGGHAAEYGAEALER.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.676.676.3	3.453	0.4062	1531.33	1530.6371	1	1322.8	44.6%	1	K.VGGHAAEYGAEALER.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.859.859.1	2.1012	0.4591	1071.52	1072.3075	1	433.9	68.8%	2	R.MFLSFPTTK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.861.861.2	2.4933	0.5539	1073.02	1072.3075	1	544.3	75.0%	1	R.MFLSFPTTK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.782.782.1	4.0399	0.525	1833.78	1835.0287	1	812.4	60.0%	2	K.TYFPHFDLSHGSAQVK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.779.779.2	3.8447	0.4565	1834.72	1835.0287	1	1819.4	76.7%	1	K.TYFPHFDLSHGSAQVK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.780.780.3	3.4568	0.5673	1836.22	1835.0287	1	535.9	41.7%	1	K.TYFPHFDLSHGSAQVK.G	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.879.879.2	5.4586	0.5654	2367.96	2368.6084	1	1292.9	61.9%	1	K.AVEHLDDLPGALSELSDLHAHK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.880.880.3	6.4488	0.5671	2370.16	2368.6084	1	2826.1	46.4%	1	K.AVEHLDDLPGALSELSDLHAHK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.869.869.2	5.3936	0.5959	2636.82	2637.9553	1	1656.4	60.9%	1	K.AVEHLDDLPGALSELSDLHAHKLR.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.870.870.3	6.4392	0.5564	2638.36	2637.9553	1	2329.7	46.7%	1	K.AVEHLDDLPGALSELSDLHAHKLR.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.927.927.3	3.4963	0.371	3439.06	3437.8804	1	865.1	24.2%	1	K.AVEHLDDLPGALSELSDLHAHKLRVDPVNFK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.721.721.2	2.5084	0.4193	1088.7	1088.295	1	481.3	75.0%	1	K.LRVDPVNFK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1020.1020.2	4.633	0.6777	2970.3	2971.4265	1	649.1	35.2%	1	K.LLSHSLLVTLASHLPSDFTPAVHASLDK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1019.1019.3	6.7806	0.6446	2971.51	2971.4265	1	1759.3	40.7%	2	K.LLSHSLLVTLASHLPSDFTPAVHASLDK.F	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1240.1240.3	8.4298	0.6544	4231.87	4232.91	1	2751.3	32.1%	1	K.LLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSK.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.849.849.1	2.4988	0.4463	1279.71	1280.5071	1	643.8	63.6%	1	K.FLANVSTVLTSK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.851.851.2	3.782	0.6123	1281.66	1280.5071	1	1800.7	90.9%	1	K.FLANVSTVLTSK.Y	2

std_sp|P00698|LYC_CHICK

80.6%

129

14313

9.0

Lysozyme C precursor (EC 3.2.1.17) (1,4-beta-N-acetylmuramidase C) (Allergen Gal d 4) (Gal d IV) - Gallus gallus (Chicken).

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.604.604.1	2.3358	0.4668	836.57	837.04	1	692.6	78.6%	1	R.CELAAAMK.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.538.538.1	1.9277	0.3971	992.65	993.2275	1	289.3	68.8%	1	R.CELAAAMKR.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.540.540.2	2.542	0.4694	993.8	993.2275	1	1122.9	87.5%	1	R.CELAAAMKR.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.283.283.1	2.1167	0.4899	874.65	874.9315	1	324.6	75.0%	1	R.HGLDNYR.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.299.299.2	2.3842	0.4024	875.44	874.9315	1	794.2	100.0%	1	R.HGLDNYR.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.836.836.2	3.7672	0.5835	2125.38	2125.3691	1	637.6	47.2%	1	R.HGLDNYRGYSLGNWVCAAK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.857.857.1	2.2713	0.2739	1268.48	1269.4607	1	516.0	59.1%	1	R.GYSLGNWVCAAK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.649.649.1	1.8126	0.3523	1428.71	1429.4886	3	72.3	36.4%	1	K.FESNFNTQATNR.N	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.650.650.2	3.6067	0.5355	1429.56	1429.4886	1	1601.1	81.8%	1	K.FESNFNTQATNR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.805.805.2	5.4209	0.4973	1754.84	1754.851	1	1817.5	76.7%	1	R.NTDGSTDYGILQINSR.W	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1104.1104.2	5.3894	0.7237	2337.38	2338.7146	1	1102.4	61.4%	14	R.NLCNIPCSALLSSDITASVNCAK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.999.999.2	4.2114	0.6593	2465.9	2466.8887	1	459.7	43.5%	2	R.NLCNIPCSALLSSDITASVNCAKK.I	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1002.1002.3	2.7795	0.2922	2466.55	2466.8887	4	177.5	22.8%	1	R.NLCNIPCSALLSSDITASVNCAKK.I	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.847.847.2	4.8027	0.6137	1806.76	1805.0642	1	1978.6	83.3%	1	K.KIVSDGNGMNAWVAWR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.910.910.2	4.39	0.3648	1677.92	1676.8901	1	1620.8	67.9%	1	K.IVSDGNGMNAWVAWR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.759.759.1	1.8057	0.1946	1045.58	1046.171	3	156.1	56.2%	1	K.GTDVQAWIR.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.767.767.2	3.2643	0.3887	1046.7	1046.171	1	1039.7	87.5%	1	K.GTDVQAWIR.G	2

std_gi|2190337|gnl|PID|e321614

77.9%

607

69324

6.2

(X58989) serum albumin [Bos taurus] gi|3336842|gnl|PID|e1311980 (Y17769) bovine serum albumin [Bos taurus] [MASS=69323]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.243.243.1	2.3951	0.2728	1193.62	1194.2925	1	306.6	66.7%	6	R.DTHKSEIAHR.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.165.165.2	2.8848	0.489	1194.84	1194.2925	1	621.8	72.2%	5	R.DTHKSEIAHR.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.635.635.1	2.6045	0.383	1249.64	1250.3965	1	617.7	66.7%	1	R.FKDLGEEHFK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.636.636.2	3.139	0.3902	1250.54	1250.3965	1	1085.1	88.9%	1	R.FKDLGEEHFK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1091.1091.3	3.2109	0.3509	3668.95	3668.2043	1	228.1	20.8%	1	R.FKDLGEEHFKGLVLIAFSQYLQQCPFDEHVK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1145.1145.3	5.2326	0.6444	4812.7	4813.525	1	943.0	21.9%	1	R.FKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAK.T	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.477.477.1	2.208	0.3977	974.5	975.0459	1	335.0	64.3%	1	K.DLGEEHFK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1129.1129.2	4.9916	0.6141	2436.22	2436.831	1	1353.4	52.5%	2	K.GLVLIAFSQYLQQCPFDEHVK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1181.1181.3	4.7858	0.5148	3581.65	3582.1516	1	978.0	28.3%	1	K.GLVLIAFSQYLQQCPFDEHVKLVNELTEFAK.T	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.814.814.2	3.461	0.5634	1164.62	1164.344	1	633.3	83.3%	1	K.LVNELTEFAK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.270.270.1	3.2268	0.5997	1349.59	1350.4609	1	558.5	62.5%	1	K.TCVADESHAGCEK.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.831.831.1	3.4849	0.5515	1362.68	1363.5713	1	949.4	68.2%	1	K.SLHTLFGDELCK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.835.835.2	3.3688	0.5794	1363.88	1363.5713	1	1217.4	81.8%	1	K.SLHTLFGDELCK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.699.699.2	2.6128	0.5143	2484.82	2485.6875	1	155.3	30.0%	1	K.QEPERNECFLSHKDDSPDLPK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.701.701.3	3.3809	0.245	2486.23	2485.6875	1	578.3	31.2%	1	K.QEPERNECFLSHKDDSPDLPK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.716.716.1	1.8491	0.2686	927.59	928.0758	2	220.8	66.7%	1	K.YLYEIAR.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1076.1076.3	4.958	0.4115	4343.95	4344.967	1	710.7	22.9%	1	R.RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK.I	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.363.363.1	2.1952	0.3294	847.71	848.033	3	257.0	66.7%	2	R.LSQKFPK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.367.367.2	2.5211	0.3727	848.06	848.033	1	664.4	83.3%	1	R.LSQKFPK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.634.634.1	2.5964	0.375	922.68	923.0538	1	796.3	71.4%	1	K.AEFVEVTK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.637.637.2	2.5459	0.4147	923.6	923.0538	1	595.0	92.9%	1	K.AEFVEVTK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.714.714.2	3.9614	0.5636	2441.8	2442.742	1	685.0	40.5%	1	K.VHKECCHGDLLECADDRADLAK.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.622.622.1	2.1296	0.5216	1386.61	1387.5042	1	336.0	54.5%	1	K.YICDNQDTISSK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.626.626.2	3.8414	0.634	1387.74	1387.5042	1	821.6	86.4%	1	K.YICDNQDTISSK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.620.620.1	2.1381	0.3178	1418.62	1419.7375	1	528.6	59.1%	1	K.LKECCDKPLLEK.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.621.621.2	3.7722	0.4595	1419.8	1419.7375	1	1124.2	77.3%	1	K.LKECCDKPLLEK.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.630.630.3	2.9472	0.3858	1420.33	1419.7375	1	699.1	52.3%	1	K.LKECCDKPLLEK.S	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.353.353.1	2.3335	0.3409	1015.53	1016.1571	1	565.0	75.0%	1	K.SHCIAEVEK.D	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.911.911.3	4.7894	0.5801	3398.86	3399.8123	1	1207.8	33.3%	1	K.SHCIAEVEKDAIPENLPPLTADFAEDKDVCK.N	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.889.889.3	4.5392	0.6065	4133.08	4133.5913	1	1029.7	25.7%	1	K.SHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAK.D	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1026.1026.1	3.0326	0.5789	1567.74	1568.7258	1	249.6	62.5%	1	K.DAFLGSFLYEYSR.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.746.746.1	1.827	0.2894	1439.8	1440.6884	1	318.8	68.2%	1	R.RHPEYAVSVLLR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.744.744.2	3.0187	0.5864	1441.2	1440.6884	1	1050.7	77.3%	1	R.RHPEYAVSVLLR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.752.752.3	3.4977	0.3977	1441.69	1440.6884	1	2401.9	63.6%	1	R.RHPEYAVSVLLR.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.906.906.3	3.587	0.4242	3421.96	3422.8643	1	734.0	25.9%	1	R.LAKEYEATLEECCAKDDPHACYSTVFDKLK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.724.724.1	2.5389	0.5113	1305.72	1306.5046	1	543.1	65.0%	1	K.HLVDEPQNLIK.Q	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.725.725.2	3.0048	0.5723	1308.14	1306.5046	1	757.1	75.0%	1	K.HLVDEPQNLIK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.811.811.2	5.4856	0.6922	2299.84	2299.5635	1	1666.9	63.9%	1	K.HLVDEPQNLIKQNCDQFEK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1044.1044.3	5.8865	0.6366	3760.54	3761.2468	1	1115.7	28.2%	1	K.HLVDEPQNLIKQNCDQFEKLGEYGFQNALIVR.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.959.959.2	3.8823	0.5603	2473.0	2473.7656	1	298.6	37.5%	1	K.QNCDQFEKLGEYGFQNALIVR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.881.881.1	2.3819	0.339	1479.68	1480.7068	1	443.5	62.5%	1	K.LGEYGFQNALIVR.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.882.882.2	4.1627	0.6024	1481.72	1480.7068	1	1294.9	75.0%	1	K.LGEYGFQNALIVR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.749.749.1	3.0238	0.5312	1639.92	1640.9207	1	295.7	53.6%	1	R.KVPQVSTPTLVEVSR.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.745.745.2	2.9416	0.6521	1640.64	1640.9207	1	884.6	75.0%	1	R.KVPQVSTPTLVEVSR.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.751.751.3	4.3548	0.5724	1641.16	1640.9207	1	1895.7	51.8%	1	R.KVPQVSTPTLVEVSR.S	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1051.1051.1	2.1157	0.4569	1667.7	1668.9637	1	188.8	42.3%	1	R.MPCTEDYLSLILNR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1050.1050.2	4.4231	0.6397	1668.92	1668.9637	1	2436.9	84.6%	1	R.MPCTEDYLSLILNR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.445.445.2	2.7029	0.3317	842.54	842.0441	1	693.9	91.7%	1	R.LCVLHEK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.657.657.2	3.7844	0.5768	1484.22	1483.7662	1	1547.2	75.0%	1	R.LCVLHEKTPVSEK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.574.574.1	2.0329	0.5209	1024.6	1025.1829	1	195.5	62.5%	1	K.CCTESLVNR.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.799.799.2	3.5424	0.4936	1825.74	1825.0894	1	438.5	56.7%	1	R.RPCFSALTPDETYVPK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.800.800.3	2.6687	0.299	1826.89	1825.0894	2	634.0	40.0%	1	R.RPCFSALTPDETYVPK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.941.941.2	5.6549	0.7265	2441.8	2442.7456	1	1963.2	65.0%	1	K.AFDEKLFTFHADICTLPDTEK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.920.920.2	4.1145	0.6713	2811.82	2812.2097	1	782.6	41.3%	1	K.AFDEKLFTFHADICTLPDTEKQIK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.912.912.1	4.141	0.5181	1850.74	1852.112	1	785.9	63.3%	1	K.LFTFHADICTLPDTEK.Q	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.909.909.2	5.5056	0.5949	1852.1	1852.112	1	1942.0	76.7%	1	K.LFTFHADICTLPDTEK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.770.770.1	2.6086	0.3834	1142.76	1143.4124	1	494.9	66.7%	1	K.KQTALVELLK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.238.238.1	2.0697	0.2027	818.59	818.9023	1	379.8	75.0%	1	K.ATEEQLK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1134.1134.2	5.1316	0.6421	2199.94	2200.5115	1	1341.6	63.9%	1	K.ATEEQLKTVMENFVAFVDK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1142.1142.3	3.9779	0.5386	2201.83	2200.5115	1	1030.5	37.5%	1	K.ATEEQLKTVMENFVAFVDK.C	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1220.1220.3	5.4913	0.6755	3938.41	3939.4773	1	2008.4	27.9%	1	K.ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1175.1175.2	3.7311	0.4536	3138.04	3139.5981	1	415.7	28.6%	1	K.TVMENFVAFVDKCCAADDKEACFAVEGPK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1174.1174.3	4.938	0.3783	3138.76	3139.5981	1	1275.5	29.5%	1	K.TVMENFVAFVDKCCAADDKEACFAVEGPK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1214.1214.3	3.1672	0.3333	4122.79	4123.759	1	718.7	21.1%	1	K.TVMENFVAFVDKCCAADDKEACFAVEGPKLVVSTQTALA.-	3

std_tr|Q865Y7

70.8%

260

29114

6.9

Carbonic anhydrase II (EC 4.2.1.1) - Bos taurus (Bovine).

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.253.253.1	2.2676	0.3716	1141.59	1142.2217	1	220.1	56.2%	1	K.HNGPEHWHK.D	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.654.654.2	5.506	0.6761	2141.66	2142.3005	1	1121.4	67.6%	1	K.HNGPEHWHKDFPIANGER.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.536.536.2	2.3793	0.4591	1003.76	1003.0972	1	581.2	87.5%	2	R.QSPVDIDTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.961.961.2	3.8538	0.7034	2199.94	2199.5554	1	540.6	55.0%	1	K.AVVQDPALKPLALVYGEATSR.R	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.964.964.3	3.9933	0.6102	2201.83	2199.5554	1	1595.1	42.5%	1	K.AVVQDPALKPLALVYGEATSR.R	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.756.756.1	2.8418	0.5048	1581.81	1582.8021	1	910.7	70.8%	1	K.YAAELHLVHWNTK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1066.1066.2	4.9038	0.6489	2255.12	2254.5474	1	797.0	59.5%	2	K.YGDFGTAAQQPDGLAVVGVFLK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.338.338.1	1.9973	0.3379	1012.65	1013.1387	1	714.8	66.7%	1	K.VGDANPALQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.339.339.2	3.7344	0.3502	1014.9	1013.1387	1	1389.9	94.4%	1	K.VGDANPALQK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.775.775.1	2.2059	0.3884	973.64	974.1424	1	576.6	68.8%	1	K.VLDALDSIK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1385.1385.3	4.24	0.6024	5923.24	5924.7793	1	402.8	16.3%	1	K.STDFPNFDPGSLLPNVLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSQQMLK.F	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.734.734.1	2.3565	0.4133	1346.7	1347.5695	2	130.0	50.0%	1	K.EPISVSSQQMLK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1011.1011.3	4.0224	0.4372	3429.01	3427.952	1	449.1	22.3%	1	K.FRTLNFNAEGEPELLMLANWRPAQPLKNR.Q	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1064.1064.2	3.7473	0.5478	2854.08	2854.2964	1	266.3	33.3%	1	R.TLNFNAEGEPELLMLANWRPAQPLK.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1065.1065.3	3.4342	0.5415	2855.32	2854.2964	1	480.5	27.1%	1	R.TLNFNAEGEPELLMLANWRPAQPLK.N	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1014.1014.3	4.0691	0.5324	3124.78	3124.5876	1	476.5	23.1%	1	R.TLNFNAEGEPELLMLANWRPAQPLKNR.Q	3

std_gi|1168350|sp|P00330|ADH1_YEAST

67.8%

348

36823

6.7

ALCOHOL DEHYDROGENASE I gi|3339 (V01292) alcohol dehydrogenase [Saccharomyces cerevisiae] gi|171025 (M38456) alcohol dehydrogenase [Saccharomyces cerevisiae] gi|171027 (J01313) alcohol dehydrogenase 1 [Saccharomyces cerevisiae] [MASS=36823]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.619.619.1	2.2444	0.4844	1136.59	1137.2804	1	436.7	66.7%	1	K.GVIFYESHGK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.624.624.2	2.0403	0.4588	1137.64	1137.2804	1	658.7	77.8%	1	K.GVIFYESHGK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.761.761.2	3.2928	0.322	1014.24	1014.2101	1	1282.6	93.8%	1	K.ANELLINVK.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.762.762.1	2.3676	0.2681	1016.48	1014.2101	1	219.5	62.5%	3	K.ANELLINVK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.936.936.3	3.5509	0.4304	4421.89	4421.053	1	430.3	17.1%	1	K.YSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVGMGENVK.G	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.824.824.2	6.0352	0.5842	2021.08	2020.3544	1	3086.5	72.5%	1	K.LPLVGGHEGAGVVVGMGENVK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.827.827.3	3.6682	0.4554	2022.67	2020.3544	1	1260.4	40.0%	1	K.LPLVGGHEGAGVVVGMGENVK.G	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.614.614.2	2.6312	0.4542	838.04	836.9634	1	422.8	85.7%	1	K.IGDYAGIK.W	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.986.986.2	4.7435	0.5204	3013.38	3014.5156	1	727.2	35.0%	1	K.ALKSANLMAGHWVAISGAAGGLGSLAVQYAK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1074.1074.2	5.7875	0.7202	2701.16	2702.1033	1	1841.3	50.0%	12	K.SANLMAGHWVAISGAAGGLGSLAVQYAK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.997.997.3	2.8466	0.2023	2701.99	2702.1033	1	1312.4	30.6%	1	K.SANLMAGHWVAISGAAGGLGSLAVQYAK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.809.809.1	2.0143	0.2639	1618.85	1619.815	1	165.9	42.9%	1	R.VLGIDGGEGKEELFR.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.804.804.2	3.6407	0.5428	1619.38	1619.815	1	1225.6	75.0%	1	R.VLGIDGGEGKEELFR.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.974.974.1	3.0868	0.599	1312.64	1313.493	1	810.2	68.2%	2	R.SIGGEVFIDFTK.E	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1059.1059.2	5.252	0.5839	2366.32	2366.76	1	1008.3	45.2%	2	R.SIGGEVFIDFTKEKDIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1072.1072.3	3.0501	0.4986	2369.47	2366.76	1	369.6	32.1%	1	R.SIGGEVFIDFTKEKDIVGAVLK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.719.719.1	2.486	0.2388	1071.74	1072.2902	1	446.5	72.2%	1	K.EKDIVGAVLK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.722.722.2	2.0835	0.386	1073.02	1072.2902	1	764.0	77.8%	1	K.EKDIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.784.784.1	2.3484	0.2611	814.69	815.0006	3	460.6	64.3%	1	K.DIVGAVLK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.786.786.2	1.9544	0.347	815.62	815.0006	1	301.1	71.4%	1	K.DIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.846.846.2	5.7789	0.7315	2312.98	2313.4863	1	2252.7	63.0%	3	K.ATDGGAHGVINVSVSEAAIEASTR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.839.839.3	3.3322	0.2598	2313.61	2313.4863	1	700.0	28.3%	1	K.ATDGGAHGVINVSVSEAAIEASTR.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.737.737.2	2.6891	0.497	1805.72	1806.1333	1	284.3	35.3%	1	R.YVRANGTTVLVGMPAGAK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.739.739.2	3.9541	0.5924	1388.18	1387.6373	1	1096.8	75.0%	1	R.ANGTTVLVGMPAGAK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.740.740.1	2.8264	0.468	1389.64	1387.6373	1	415.9	53.6%	2	R.ANGTTVLVGMPAGAK.C	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.789.789.1	2.2104	0.3722	1251.72	1252.4128	1	174.7	63.6%	1	K.SISIVGSYVGNR.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.771.771.2	3.5999	0.6163	1252.66	1252.4128	1	1382.4	86.4%	1	K.SISIVGSYVGNR.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.845.845.2	2.1307	0.1266	969.64	969.0849	1	752.4	92.9%	1	R.EALDFFAR.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.580.580.1	2.1314	0.2709	841.81	842.0696	1	421.6	64.3%	1	R.GLVKSPIK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.919.919.2	4.4096	0.5236	2271.2	2271.7458	1	1507.1	57.5%	1	R.GLVKSPIKVVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.915.915.3	5.1411	0.5667	2272.75	2271.7458	1	1786.9	45.0%	1	R.GLVKSPIKVVGLSTLPEIYEK.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.975.975.3	4.0153	0.5092	3271.15	3270.9421	1	523.2	23.3%	1	R.GLVKSPIKVVGLSTLPEIYEKMEKGQIVGR.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.904.904.1	3.8144	0.6156	1872.91	1874.2279	1	850.1	59.4%	1	K.SPIKVVGLSTLPEIYEK.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.905.905.3	3.4355	0.4572	1874.71	1874.2279	1	462.4	39.1%	1	K.SPIKVVGLSTLPEIYEK.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.901.901.2	6.1535	0.699	1875.28	1874.2279	1	2291.6	75.0%	1	K.SPIKVVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.874.874.1	2.6567	0.5565	1447.8	1448.6995	1	422.8	58.3%	1	K.VVGLSTLPEIYEK.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.875.875.2	3.309	0.5338	1448.96	1448.6995	1	976.9	75.0%	1	K.VVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.288.288.1	2.4671	0.4779	811.59	811.9103	1	614.9	83.3%	2	R.YVVDTSK.-	1

	Proteins	Peptide IDs	Copies
Unfiltered	1686	2260	2505
Redundant	7	236	301
Nonredundant	7	236	301

/home/51n/myMS/article/sequest/nathanPSM/tryptic/simple2