D simple

DTASelect v1.9
/home/51n/myMS/article/sequest/nathanPSM/tryptic/simple
/home/51n/myMS/db/psmDB/20040623-Scale-4490.fasta
SEQUEST-PVM v.27 in SQT format.
-1 1.638552 -2 1.891847 -3 2.639938 --DB -d 0 -p 2
Jump to the summary table.

sequest.params modifications:

true	Use criteria
1.638552	Minimum +1 XCorr
1.891847	Minimum +2 XCorr
2.639938	Minimum +3 XCorr
0.0	Minimum DeltCN
1	Minimum charge state
3	Maximum charge state
0.0	Minimum ion proportion
1000	Maximum Sp rank
-1.0	Minimum Sp score
Include	Modified peptide inclusion
Any	Tryptic status requirement
true	Multiple, ambiguous IDs allowed
Ignore	Peptide validation handling
XCorr	Purge duplicate peptides by protein
false	Include only loci with unique peptide
false	Remove subset proteins
Ignore	Locus validation handling
0	Minimum modified peptides per locus
10	Minimum redundancy for low coverage loci
2	Minimum peptides per locus

Locus Key:

Validation Status

Locus

Sequence Count

Spectrum Count

Sequence Coverage

Length

MolWt

Descriptive Name

Similarity Key:

Locus

# of identical peptides

# of differing peptides

std_gi|2506462|sp|P02188|MYG_HORSE

100.0%

153

16951

7.8

MYOGLOBIN gi|494712|pdb|1YMB| Metmyoglobin (Horse Heart) gi|494713|pdb|1YMC| Cyanomet-Sulfmyoglobin (Horse Heart) gi|2914628|pdb|1WLA| Myoglobin (Horse Heart) Recombinant Wild-Type gi|2982074|pdb|1AZI| Myoglobin (Horse Heart) Recombinant Wild-Type Complexed With Azide [MASS=16951]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1030.1030.1	3.0289	0.5501	1816.76	1817.011	1	399.5	46.7%	1	-.GLSDGEWQQVLNVWGK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1029.1029.2	4.6381	0.6512	1817.24	1817.011	1	2094.3	73.3%	1	-.GLSDGEWQQVLNVWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1190.1190.2	3.2229	0.6723	3404.12	3405.7947	1	295.1	26.7%	1	-.GLSDGEWQQVLNVWGKVEADIAGHGQEVLIR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1186.1186.3	7.0495	0.6211	3406.3	3405.7947	1	2090.8	33.3%	1	-.GLSDGEWQQVLNVWGKVEADIAGHGQEVLIR.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.730.730.1	3.1316	0.5051	1606.92	1607.8069	1	345.5	50.0%	1	K.VEADIAGHGQEVLIR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.729.729.2	4.4611	0.4945	1608.1	1607.8069	1	1869.6	85.7%	1	K.VEADIAGHGQEVLIR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.660.660.1	2.6236	0.4944	1271.7	1272.4435	1	572.9	65.0%	1	R.LFTGHPETLEK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.662.662.2	2.8677	0.5802	1274.1	1272.4435	1	645.7	75.0%	1	R.LFTGHPETLEK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.726.726.2	2.18	0.2658	1663.62	1662.8828	1	353.8	50.0%	1	R.LFTGHPETLEKFDK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.727.727.3	2.7017	0.4319	1665.19	1662.8828	1	377.8	38.5%	1	R.LFTGHPETLEKFDK.F	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.754.754.2	3.0801	0.6275	1938.0	1938.2334	1	533.8	53.3%	1	R.LFTGHPETLEKFDKFK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.396.396.2	3.4506	0.5961	1363.88	1362.6299	1	1501.9	90.0%	1	K.FKHLKTEAEMK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.400.400.3	3.1645	0.4511	1364.05	1362.6299	1	863.1	60.0%	1	K.FKHLKTEAEMK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.268.268.1	2.3572	0.5145	1086.6	1087.2793	1	527.9	68.8%	2	K.HLKTEAEMK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.273.273.2	3.0527	0.637	1088.0	1087.2793	1	961.2	87.5%	1	K.HLKTEAEMK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.494.494.2	4.4737	0.689	1858.6	1859.148	1	1660.4	76.7%	1	K.HLKTEAEMKASEDLKK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.421.421.1	3.1569	0.5976	1479.68	1480.6733	1	546.0	62.5%	1	K.TEAEMKASEDLKK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.419.419.2	3.979	0.5933	1480.76	1480.6733	1	1695.5	79.2%	1	K.TEAEMKASEDLKK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.929.929.1	3.4905	0.6546	1378.86	1379.686	1	712.2	61.5%	1	K.HGTVVLTALGGILK.K	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.930.930.2	4.3501	0.6375	1379.72	1379.686	1	1752.9	92.3%	1	K.HGTVVLTALGGILK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.935.935.3	3.265	0.4837	1380.16	1379.686	1	1121.4	50.0%	1	K.HGTVVLTALGGILK.K	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.854.854.1	3.3301	0.4915	1506.89	1507.8601	1	741.8	60.7%	1	K.HGTVVLTALGGILKK.K	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.855.855.2	4.4289	0.6497	1508.36	1507.8601	1	1889.2	78.6%	1	K.HGTVVLTALGGILKK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.856.856.3	4.424	0.4437	1508.56	1507.8601	1	2783.8	67.9%	1	K.HGTVVLTALGGILKK.K	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.319.319.2	4.6826	0.6915	2110.94	2111.4116	1	1168.7	58.3%	2	K.KKGHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.303.303.3	4.356	0.679	2112.19	2111.4116	1	1145.4	45.8%	1	K.KKGHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.324.324.1	4.6347	0.5886	1982.0	1983.2375	1	964.0	58.8%	1	K.KGHHEAELKPLAQSHATK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.323.323.3	4.3802	0.472	1983.19	1983.2375	1	1033.1	45.6%	1	K.KGHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.343.343.2	4.8896	0.5812	1983.86	1983.2375	1	1236.5	61.8%	2	K.KGHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.348.348.1	4.4345	0.546	1853.86	1855.0635	1	685.8	53.1%	1	K.GHHEAELKPLAQSHATK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.373.373.2	3.6839	0.5574	1854.18	1855.0635	1	661.5	56.2%	3	K.GHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.349.349.3	2.6698	0.4602	1855.72	1855.0635	1	998.2	45.3%	1	K.GHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.269.269.1	1.7035	0.4513	736.66	735.948	1	418.1	70.0%	1	K.HKIPIK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1111.1111.2	5.2261	0.6486	2602.1	2603.1257	1	1056.3	45.2%	1	K.HKIPIKYLEFISDAIIHVLHSK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1109.1109.3	5.5182	0.7358	2603.53	2603.1257	1	566.5	32.1%	1	K.HKIPIKYLEFISDAIIHVLHSK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1055.1055.3	4.5653	0.5953	4087.42	4087.732	1	512.2	23.6%	1	K.HKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1097.1097.3	3.0453	0.4965	1886.95	1886.201	1	727.6	50.0%	1	K.YLEFISDAIIHVLHSK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1094.1094.2	5.0902	0.6848	1887.3	1886.201	1	1425.0	73.3%	2	K.YLEFISDAIIHVLHSK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1106.1106.1	3.6728	0.6574	1887.82	1886.201	1	656.7	60.0%	2	K.YLEFISDAIIHVLHSK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1052.1052.2	3.5427	0.6745	3369.6	3370.8071	1	305.8	25.0%	1	K.YLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1049.1049.3	6.178	0.7194	3370.69	3370.8071	1	1023.3	31.7%	1	K.YLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.639.639.1	2.4895	0.5925	1502.58	1503.6293	1	430.1	60.7%	1	K.HPGDFGADAQGAMTK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.642.642.3	3.7425	0.6319	1505.14	1503.6293	1	1715.8	55.4%	1	K.HPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.640.640.2	3.3832	0.6062	1505.38	1503.6293	1	617.0	67.9%	1	K.HPGDFGADAQGAMTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.787.787.1	2.2634	0.4426	1360.72	1361.584	2	144.6	45.5%	1	K.ALELFRNDIAAK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.792.792.2	2.5303	0.2583	1362.52	1361.584	1	398.9	50.0%	1	K.ALELFRNDIAAK.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.937.937.2	4.1127	0.502	2284.52	2284.62	1	891.1	44.7%	1	K.ALELFRNDIAAKYKELGFQG.-	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.195.195.1	2.0482	0.2954	631.6	631.7068	1	404.2	80.0%	6	R.NDIAAK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.687.687.1	2.3096	0.6609	941.59	942.0593	1	411.8	71.4%	1	K.YKELGFQG.-	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.689.689.2	2.4491	0.2661	942.38	942.0593	1	838.0	85.7%	1	K.YKELGFQG.-	2

std_gi|122572|sp|P02070|HBB_BOVIN

95.9%

145

15954

7.6

HEMOGLOBIN BETA CHAIN gi|70412|pir||HBBOB hemoglobin beta chain - bovine gi|576143|pdb|1HDA|B Bos taurus gi|576145|pdb|1HDA|D Bos taurus gi|395 (X00376) beta-globin [Bos taurus] gi|162741 (M63453) beta-globin [Bos taurus] [MASS=15954]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.289.289.1	1.9175	0.1624	821.44	821.9641	1	542.2	83.3%	3	-.MLTAEEK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.917.917.2	4.5632	0.6315	1753.92	1754.054	1	1322.7	66.7%	1	-.MLTAEEKAAVTAFWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.766.766.1	2.1238	0.3834	950.79	951.113	1	609.7	62.5%	1	K.AAVTAFWGK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.776.776.2	2.8685	0.65	952.76	951.113	1	1052.2	87.5%	1	K.AAVTAFWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.669.669.1	3.2176	0.5642	1328.84	1329.496	1	427.4	62.5%	1	K.VKVDEVGGEALGR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.670.670.2	4.5399	0.6351	1330.0	1329.496	1	1643.4	83.3%	1	K.VKVDEVGGEALGR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.677.677.3	3.551	0.4855	1330.57	1329.496	1	1017.7	45.8%	1	K.VKVDEVGGEALGR.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.629.629.1	2.0632	0.4751	1101.62	1102.1895	1	307.7	60.0%	1	K.VDEVGGEALGR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.632.632.2	3.7129	0.5416	1102.62	1102.1895	1	1234.1	85.0%	1	K.VDEVGGEALGR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.895.895.2	2.703	0.5379	1275.96	1275.5363	1	1027.3	77.8%	1	R.LLVVYPWTQR.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1169.1169.3	5.5404	0.5489	3348.55	3347.8127	1	1294.1	31.2%	1	R.LLVVYPWTQRFFESFGDLSTADAVMNNPK.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.939.939.2	5.4983	0.6704	2090.58	2091.2996	1	1782.8	66.7%	5	R.FFESFGDLSTADAVMNNPK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.945.945.3	5.2429	0.6083	2091.79	2091.2996	1	1193.8	41.7%	1	R.FFESFGDLSTADAVMNNPK.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.672.672.1	2.5378	0.4772	1225.59	1226.4333	1	369.5	65.0%	1	K.KVLDSFSNGMK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.709.709.1	2.4596	0.5395	1097.45	1098.2592	1	411.5	66.7%	1	K.VLDSFSNGMK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.711.711.2	2.598	0.5329	1098.68	1098.2592	1	512.0	77.8%	1	K.VLDSFSNGMK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.290.290.1	2.046	0.547	740.66	740.8345	1	343.8	80.0%	1	K.HLDDLK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.931.931.3	4.7581	0.5831	3194.02	3194.589	1	1092.0	36.1%	1	K.HLDDLKGTFAALSELHCDKLHVDPENFK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.680.680.1	2.5344	0.3691	1098.65	1099.2314	1	352.0	68.8%	1	K.LHVDPENFK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1069.1069.1	2.1577	0.4357	1265.88	1266.6133	1	205.3	45.5%	1	K.LLGNVLVVVLAR.N	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1070.1070.2	4.0595	0.571	1267.9	1266.6133	1	1317.6	86.4%	1	K.LLGNVLVVVLAR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.852.852.1	3.5335	0.435	1869.79	1870.1149	1	423.3	53.3%	1	R.NFGKEFTPVLQADFQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.850.850.2	4.7543	0.561	1870.06	1870.1149	1	1350.9	76.7%	1	R.NFGKEFTPVLQADFQK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1156.1156.2	3.7011	0.6451	3328.38	3329.7886	1	352.7	31.0%	1	R.NFGKEFTPVLQADFQKVVAGVANALAHRYH.-	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1149.1149.3	4.6761	0.6251	3330.76	3329.7886	1	598.1	26.7%	1	R.NFGKEFTPVLQADFQKVVAGVANALAHRYH.-	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.829.829.1	2.8579	0.6046	1422.66	1423.6085	1	341.0	68.2%	1	K.EFTPVLQADFQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.684.684.1	2.2249	0.3864	1177.55	1178.3799	2	203.4	45.5%	1	K.VVAGVANALAHR.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.685.685.2	3.7331	0.6776	1178.9	1178.3799	1	1911.8	95.5%	1	K.VVAGVANALAHR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.710.710.2	3.7839	0.7319	1478.84	1478.6969	1	2148.1	80.8%	1	K.VVAGVANALAHRYH.-	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.707.707.3	2.8951	0.6229	1480.09	1478.6969	1	409.0	46.2%	1	K.VVAGVANALAHRYH.-	3

std_gi|122361|sp|P01966|HBA_BOVIN

86.5%

141

15053

8.4

HEMOGLOBIN ALPHA CHAIN gi|70238|pir||HABO hemoglobin alpha chain - bovine gi|576142|pdb|1HDA|A Bos taurus gi|576144|pdb|1HDA|C Bos taurus [MASS=15053]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.249.249.1	1.9334	0.4356	703.59	703.8137	1	634.9	83.3%	1	-.VLSAADK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.278.278.1	2.8129	0.4378	1101.62	1102.2761	1	548.4	70.0%	2	-.VLSAADKGNVK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.281.281.2	2.8409	0.5227	1102.62	1102.2761	1	858.7	80.0%	1	-.VLSAADKGNVK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.675.675.1	3.7343	0.553	1529.73	1530.6371	1	594.2	57.1%	1	K.VGGHAAEYGAEALER.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.671.671.2	4.3008	0.6263	1531.3	1530.6371	1	1838.5	71.4%	1	K.VGGHAAEYGAEALER.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.676.676.3	3.453	0.3967	1531.33	1530.6371	1	1322.8	44.6%	1	K.VGGHAAEYGAEALER.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.859.859.1	2.1012	0.6051	1071.52	1072.3075	1	433.9	68.8%	2	R.MFLSFPTTK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.861.861.2	2.4933	0.5911	1073.02	1072.3075	1	544.3	75.0%	1	R.MFLSFPTTK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.782.782.1	4.0399	0.5249	1833.78	1835.0287	1	812.4	60.0%	2	K.TYFPHFDLSHGSAQVK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.779.779.2	3.8447	0.6435	1834.72	1835.0287	1	1819.4	76.7%	1	K.TYFPHFDLSHGSAQVK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.780.780.3	3.4568	0.4719	1836.22	1835.0287	1	535.9	41.7%	1	K.TYFPHFDLSHGSAQVK.G	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.879.879.2	5.4586	0.6391	2367.96	2368.6084	1	1292.9	61.9%	1	K.AVEHLDDLPGALSELSDLHAHK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.880.880.3	6.4488	0.6534	2370.16	2368.6084	1	2826.1	46.4%	1	K.AVEHLDDLPGALSELSDLHAHK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.869.869.2	5.3936	0.7431	2636.82	2637.9553	1	1656.4	60.9%	1	K.AVEHLDDLPGALSELSDLHAHKLR.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.870.870.3	6.4392	0.7012	2638.36	2637.9553	1	2329.7	46.7%	1	K.AVEHLDDLPGALSELSDLHAHKLR.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.927.927.3	3.4963	0.5161	3439.06	3437.8804	1	865.1	24.2%	1	K.AVEHLDDLPGALSELSDLHAHKLRVDPVNFK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.721.721.2	2.5084	0.3545	1088.7	1088.295	1	481.3	75.0%	1	K.LRVDPVNFK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1020.1020.2	4.633	0.7219	2970.3	2971.4265	1	649.1	35.2%	1	K.LLSHSLLVTLASHLPSDFTPAVHASLDK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1019.1019.3	6.7806	0.6675	2971.51	2971.4265	1	1759.3	40.7%	2	K.LLSHSLLVTLASHLPSDFTPAVHASLDK.F	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1240.1240.3	8.4298	0.6509	4231.87	4232.91	1	2751.3	32.1%	1	K.LLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSK.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.849.849.1	2.4988	0.3963	1279.71	1280.5071	1	643.8	63.6%	1	K.FLANVSTVLTSK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.851.851.2	3.782	0.525	1281.66	1280.5071	1	1800.7	90.9%	1	K.FLANVSTVLTSK.Y	2

std_gi|2190337|gnl|PID|e321614

80.6%

607

69324

6.2

(X58989) serum albumin [Bos taurus] gi|3336842|gnl|PID|e1311980 (Y17769) bovine serum albumin [Bos taurus] [MASS=69323]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.243.243.1	2.3951	0.521	1193.62	1194.2925	1	306.6	66.7%	6	R.DTHKSEIAHR.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.165.165.2	2.8848	0.5502	1194.84	1194.2925	1	621.8	72.2%	5	R.DTHKSEIAHR.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.635.635.1	2.6045	0.4743	1249.64	1250.3965	1	617.7	66.7%	1	R.FKDLGEEHFK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.636.636.2	3.139	0.4695	1250.54	1250.3965	1	1085.1	88.9%	1	R.FKDLGEEHFK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1091.1091.3	3.2109	0.4531	3668.95	3668.2043	1	228.1	20.8%	1	R.FKDLGEEHFKGLVLIAFSQYLQQCPFDEHVK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1145.1145.3	5.2326	0.6601	4812.7	4813.525	1	943.0	21.9%	1	R.FKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAK.T	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.477.477.1	2.208	0.4597	974.5	975.0459	1	335.0	64.3%	1	K.DLGEEHFK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1129.1129.2	4.9916	0.7309	2436.22	2436.831	1	1353.4	52.5%	2	K.GLVLIAFSQYLQQCPFDEHVK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1181.1181.3	4.7858	0.6753	3581.65	3582.1516	1	978.0	28.3%	1	K.GLVLIAFSQYLQQCPFDEHVKLVNELTEFAK.T	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.814.814.2	3.461	0.5158	1164.62	1164.344	1	633.3	83.3%	1	K.LVNELTEFAK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.270.270.1	3.2268	0.6264	1349.59	1350.4609	1	558.5	62.5%	1	K.TCVADESHAGCEK.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.831.831.1	3.4849	0.6211	1362.68	1363.5713	1	949.4	68.2%	1	K.SLHTLFGDELCK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.835.835.2	3.3688	0.7143	1363.88	1363.5713	1	1217.4	81.8%	1	K.SLHTLFGDELCK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.699.699.2	2.6128	0.5038	2484.82	2485.6875	1	155.3	30.0%	1	K.QEPERNECFLSHKDDSPDLPK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.701.701.3	3.3809	0.5053	2486.23	2485.6875	1	578.3	31.2%	1	K.QEPERNECFLSHKDDSPDLPK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.450.450.1	1.7259	0.124	886.43	886.9341	1	308.8	64.3%	1	K.DDSPDLPK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.716.716.1	1.8491	0.3386	927.59	928.0758	1	220.8	66.7%	1	K.YLYEIAR.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1076.1076.3	4.958	0.6121	4343.95	4344.967	1	710.7	22.9%	1	R.RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK.I	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.655.655.1	1.6485	0.338	1001.75	1002.2046	2	104.8	50.0%	1	R.ALKAWSVAR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.363.363.1	2.1952	0.0857	847.71	848.033	3	257.0	66.7%	2	R.LSQKFPK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.367.367.2	2.5211	0.1849	848.06	848.033	2	664.4	83.3%	1	R.LSQKFPK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.634.634.1	2.5964	0.4207	922.68	923.0538	1	796.3	71.4%	1	K.AEFVEVTK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.637.637.2	2.5459	0.2579	923.6	923.0538	1	595.0	92.9%	1	K.AEFVEVTK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.584.584.1	1.724	0.2793	789.68	789.9475	1	487.2	75.0%	1	K.LVTDLTK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.714.714.2	3.9614	0.5943	2441.8	2442.742	1	685.0	40.5%	1	K.VHKECCHGDLLECADDRADLAK.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.622.622.1	2.1296	0.6116	1386.61	1387.5042	1	336.0	54.5%	1	K.YICDNQDTISSK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.626.626.2	3.8414	0.6468	1387.74	1387.5042	1	821.6	86.4%	1	K.YICDNQDTISSK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.620.620.1	2.1381	0.2472	1418.62	1419.7375	1	528.6	59.1%	1	K.LKECCDKPLLEK.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.621.621.2	3.7722	0.434	1419.8	1419.7375	1	1124.2	77.3%	1	K.LKECCDKPLLEK.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.630.630.3	2.9472	0.4142	1420.33	1419.7375	1	699.1	52.3%	1	K.LKECCDKPLLEK.S	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.353.353.1	2.3335	0.3827	1015.53	1016.1571	1	565.0	75.0%	1	K.SHCIAEVEK.D	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.911.911.3	4.7894	0.6081	3398.86	3399.8123	1	1207.8	33.3%	1	K.SHCIAEVEKDAIPENLPPLTADFAEDKDVCK.N	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.889.889.3	4.5392	0.5867	4133.08	4133.5913	1	1029.7	25.7%	1	K.SHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAK.D	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1026.1026.1	3.0326	0.534	1567.74	1568.7258	1	249.6	62.5%	1	K.DAFLGSFLYEYSR.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.746.746.1	1.827	0.4866	1439.8	1440.6884	1	318.8	68.2%	1	R.RHPEYAVSVLLR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.744.744.2	3.0187	0.588	1441.2	1440.6884	1	1050.7	77.3%	1	R.RHPEYAVSVLLR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.752.752.3	3.4977	0.5588	1441.69	1440.6884	1	2401.9	63.6%	1	R.RHPEYAVSVLLR.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.906.906.3	3.587	0.2749	3421.96	3422.8643	1	734.0	25.9%	1	R.LAKEYEATLEECCAKDDPHACYSTVFDKLK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.724.724.1	2.5389	0.612	1305.72	1306.5046	1	543.1	65.0%	1	K.HLVDEPQNLIK.Q	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.725.725.2	3.0048	0.6632	1308.14	1306.5046	1	757.1	75.0%	1	K.HLVDEPQNLIK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.811.811.2	5.4856	0.6669	2299.84	2299.5635	1	1666.9	63.9%	1	K.HLVDEPQNLIKQNCDQFEK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1044.1044.3	5.8865	0.6786	3760.54	3761.2468	1	1115.7	28.2%	1	K.HLVDEPQNLIKQNCDQFEKLGEYGFQNALIVR.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.959.959.2	3.8823	0.5675	2473.0	2473.7656	1	298.6	37.5%	1	K.QNCDQFEKLGEYGFQNALIVR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.881.881.1	2.3819	0.4215	1479.68	1480.7068	1	443.5	62.5%	1	K.LGEYGFQNALIVR.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.882.882.2	4.1627	0.6744	1481.72	1480.7068	1	1294.9	75.0%	1	K.LGEYGFQNALIVR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.749.749.1	3.0238	0.5256	1639.92	1640.9207	1	295.7	53.6%	1	R.KVPQVSTPTLVEVSR.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.745.745.2	2.9416	0.6464	1640.64	1640.9207	1	884.6	75.0%	1	R.KVPQVSTPTLVEVSR.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.751.751.3	4.3548	0.5179	1641.16	1640.9207	1	1895.7	51.8%	1	R.KVPQVSTPTLVEVSR.S	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1051.1051.1	2.1157	0.5213	1667.7	1668.9637	1	188.8	42.3%	1	R.MPCTEDYLSLILNR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1050.1050.2	4.4231	0.6615	1668.92	1668.9637	1	2436.9	84.6%	1	R.MPCTEDYLSLILNR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.445.445.2	2.7029	0.4599	842.54	842.0441	1	693.9	91.7%	1	R.LCVLHEK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.657.657.2	3.7844	0.6624	1484.22	1483.7662	1	1547.2	75.0%	1	R.LCVLHEKTPVSEK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.148.148.1	1.6759	0.4884	660.43	660.7453	1	223.7	80.0%	1	K.TPVSEK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.574.574.1	2.0329	0.4015	1024.6	1025.1829	1	195.5	62.5%	1	K.CCTESLVNR.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.799.799.2	3.5424	0.5877	1825.74	1825.0894	1	438.5	56.7%	1	R.RPCFSALTPDETYVPK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.800.800.3	2.6687	0.2997	1826.89	1825.0894	2	634.0	40.0%	1	R.RPCFSALTPDETYVPK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.941.941.2	5.6549	0.646	2441.8	2442.7456	1	1963.2	65.0%	1	K.AFDEKLFTFHADICTLPDTEK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.920.920.2	4.1145	0.5541	2811.82	2812.2097	1	782.6	41.3%	1	K.AFDEKLFTFHADICTLPDTEKQIK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.912.912.1	4.141	0.5687	1850.74	1852.112	1	785.9	63.3%	1	K.LFTFHADICTLPDTEK.Q	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.909.909.2	5.5056	0.6583	1852.1	1852.112	1	1942.0	76.7%	1	K.LFTFHADICTLPDTEK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.770.770.1	2.6086	0.3955	1142.76	1143.4124	1	494.9	66.7%	1	K.KQTALVELLK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.238.238.1	2.0697	0.2245	818.59	818.9023	1	379.8	75.0%	2	K.ATEEQLK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1134.1134.2	5.1316	0.5282	2199.94	2200.5115	1	1341.6	63.9%	1	K.ATEEQLKTVMENFVAFVDK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1142.1142.3	3.9779	0.5797	2201.83	2200.5115	1	1030.5	37.5%	1	K.ATEEQLKTVMENFVAFVDK.C	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1220.1220.3	5.4913	0.5482	3938.41	3939.4773	1	2008.4	27.9%	1	K.ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1175.1175.2	3.7311	0.6399	3138.04	3139.5981	1	415.7	28.6%	1	K.TVMENFVAFVDKCCAADDKEACFAVEGPK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1174.1174.3	4.938	0.6686	3138.76	3139.5981	1	1275.5	29.5%	1	K.TVMENFVAFVDKCCAADDKEACFAVEGPK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1214.1214.3	3.1672	0.4211	4122.79	4123.759	1	718.7	21.1%	1	K.TVMENFVAFVDKCCAADDKEACFAVEGPKLVVSTQTALA.-	3

std_sp|P00698|LYC_CHICK

80.6%

129

14313

9.0

Lysozyme C precursor (EC 3.2.1.17) (1,4-beta-N-acetylmuramidase C) (Allergen Gal d 4) (Gal d IV) - Gallus gallus (Chicken).

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.604.604.1	2.3358	0.574	836.57	837.04	1	692.6	78.6%	1	R.CELAAAMK.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.538.538.1	1.9277	0.4236	992.65	993.2275	1	289.3	68.8%	1	R.CELAAAMKR.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.540.540.2	2.542	0.5264	993.8	993.2275	1	1122.9	87.5%	1	R.CELAAAMKR.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.283.283.1	2.1167	0.3901	874.65	874.9315	1	324.6	75.0%	1	R.HGLDNYR.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.299.299.2	2.3842	0.5117	875.44	874.9315	1	794.2	100.0%	1	R.HGLDNYR.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.836.836.2	3.7672	0.5296	2125.38	2125.3691	1	637.6	47.2%	1	R.HGLDNYRGYSLGNWVCAAK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.857.857.1	2.2713	0.4225	1268.48	1269.4607	1	516.0	59.1%	1	R.GYSLGNWVCAAK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.649.649.1	1.8126	0.2198	1428.71	1429.4886	2	72.3	36.4%	1	K.FESNFNTQATNR.N	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.650.650.2	3.6067	0.4957	1429.56	1429.4886	1	1601.1	81.8%	1	K.FESNFNTQATNR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.806.806.1	1.663	0.4158	1753.74	1754.851	1	110.9	33.3%	1	R.NTDGSTDYGILQINSR.W	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.805.805.2	5.4209	0.6542	1754.84	1754.851	1	1817.5	76.7%	1	R.NTDGSTDYGILQINSR.W	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1104.1104.2	5.3894	0.7046	2337.38	2338.7146	1	1102.4	61.4%	14	R.NLCNIPCSALLSSDITASVNCAK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.999.999.2	4.2114	0.6455	2465.9	2466.8887	1	459.7	43.5%	2	R.NLCNIPCSALLSSDITASVNCAKK.I	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1002.1002.3	2.7795	0.4016	2466.55	2466.8887	4	177.5	22.8%	1	R.NLCNIPCSALLSSDITASVNCAKK.I	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.847.847.2	4.8027	0.6296	1806.76	1805.0642	1	1978.6	83.3%	1	K.KIVSDGNGMNAWVAWR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.910.910.2	4.39	0.5274	1677.92	1676.8901	1	1620.8	67.9%	1	K.IVSDGNGMNAWVAWR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.759.759.1	1.8057	0.2317	1045.58	1046.171	3	156.1	56.2%	1	K.GTDVQAWIR.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.767.767.2	3.2643	0.3845	1046.7	1046.171	1	1039.7	87.5%	1	K.GTDVQAWIR.G	2

std_tr|Q865Y7

70.8%

260

29114

6.9

Carbonic anhydrase II (EC 4.2.1.1) - Bos taurus (Bovine).

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.253.253.1	2.2676	0.4523	1141.59	1142.2217	1	220.1	56.2%	1	K.HNGPEHWHK.D	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.654.654.2	5.506	0.6027	2141.66	2142.3005	1	1121.4	67.6%	1	K.HNGPEHWHKDFPIANGER.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.536.536.2	2.3793	0.4743	1003.76	1003.0972	1	581.2	87.5%	2	R.QSPVDIDTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.961.961.2	3.8538	0.6845	2199.94	2199.5554	1	540.6	55.0%	1	K.AVVQDPALKPLALVYGEATSR.R	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.964.964.3	3.9933	0.6174	2201.83	2199.5554	1	1595.1	42.5%	1	K.AVVQDPALKPLALVYGEATSR.R	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.756.756.1	2.8418	0.5704	1581.81	1582.8021	1	910.7	70.8%	1	K.YAAELHLVHWNTK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1066.1066.2	4.9038	0.7295	2255.12	2254.5474	1	797.0	59.5%	2	K.YGDFGTAAQQPDGLAVVGVFLK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.338.338.1	1.9973	0.4692	1012.65	1013.1387	1	714.8	66.7%	1	K.VGDANPALQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.339.339.2	3.7344	0.4809	1014.9	1013.1387	1	1389.9	94.4%	1	K.VGDANPALQK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.775.775.1	2.2059	0.4349	973.64	974.1424	1	576.6	68.8%	1	K.VLDALDSIK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1385.1385.3	4.24	0.6569	5923.24	5924.7793	1	402.8	16.3%	1	K.STDFPNFDPGSLLPNVLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSQQMLK.F	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.734.734.1	2.3565	0.3629	1346.7	1347.5695	2	130.0	50.0%	1	K.EPISVSSQQMLK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1011.1011.3	4.0224	0.4671	3429.01	3427.952	3	449.1	22.3%	1	K.FRTLNFNAEGEPELLMLANWRPAQPLKNR.Q	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1064.1064.2	3.7473	0.6019	2854.08	2854.2964	1	266.3	33.3%	1	R.TLNFNAEGEPELLMLANWRPAQPLK.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1065.1065.3	3.4342	0.5188	2855.32	2854.2964	1	480.5	27.1%	1	R.TLNFNAEGEPELLMLANWRPAQPLK.N	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1014.1014.3	4.0691	0.5049	3124.78	3124.5876	1	476.5	23.1%	1	R.TLNFNAEGEPELLMLANWRPAQPLKNR.Q	3

std_gi|1168350|sp|P00330|ADH1_YEAST

67.8%

348

36823

6.7

ALCOHOL DEHYDROGENASE I gi|3339 (V01292) alcohol dehydrogenase [Saccharomyces cerevisiae] gi|171025 (M38456) alcohol dehydrogenase [Saccharomyces cerevisiae] gi|171027 (J01313) alcohol dehydrogenase 1 [Saccharomyces cerevisiae] [MASS=36823]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.619.619.1	2.2444	0.3002	1136.59	1137.2804	1	436.7	66.7%	1	K.GVIFYESHGK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.624.624.2	2.0403	0.3725	1137.64	1137.2804	1	658.7	77.8%	1	K.GVIFYESHGK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.761.761.2	3.2928	0.3341	1014.24	1014.2101	1	1282.6	93.8%	1	K.ANELLINVK.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.762.762.1	2.3676	0.1274	1016.48	1014.2101	2	219.5	62.5%	3	K.ANELLINVK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.936.936.3	3.5509	0.4849	4421.89	4421.053	1	430.3	17.1%	1	K.YSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVGMGENVK.G	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.824.824.2	6.0352	0.7028	2021.08	2020.3544	1	3086.5	72.5%	1	K.LPLVGGHEGAGVVVGMGENVK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.827.827.3	3.6682	0.4844	2022.67	2020.3544	1	1260.4	40.0%	1	K.LPLVGGHEGAGVVVGMGENVK.G	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.614.614.2	2.6312	0.5518	838.04	836.9634	1	422.8	85.7%	1	K.IGDYAGIK.W	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.986.986.2	4.7435	0.6316	3013.38	3014.5156	1	727.2	35.0%	1	K.ALKSANLMAGHWVAISGAAGGLGSLAVQYAK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1074.1074.2	5.7875	0.6449	2701.16	2702.1033	1	1841.3	50.0%	12	K.SANLMAGHWVAISGAAGGLGSLAVQYAK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.997.997.3	2.8466	0.3846	2701.99	2702.1033	1	1312.4	30.6%	1	K.SANLMAGHWVAISGAAGGLGSLAVQYAK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.809.809.1	2.0143	0.4577	1618.85	1619.815	1	165.9	42.9%	1	R.VLGIDGGEGKEELFR.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.804.804.2	3.6407	0.6421	1619.38	1619.815	1	1225.6	75.0%	1	R.VLGIDGGEGKEELFR.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.974.974.1	3.0868	0.6039	1312.64	1313.493	1	810.2	68.2%	2	R.SIGGEVFIDFTK.E	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1059.1059.2	5.252	0.6588	2366.32	2366.76	1	1008.3	45.2%	2	R.SIGGEVFIDFTKEKDIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1072.1072.3	3.0501	0.5652	2369.47	2366.76	1	369.6	32.1%	1	R.SIGGEVFIDFTKEKDIVGAVLK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.719.719.1	2.486	0.3206	1071.74	1072.2902	1	446.5	72.2%	1	K.EKDIVGAVLK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.722.722.2	2.0835	0.404	1073.02	1072.2902	1	764.0	77.8%	1	K.EKDIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.784.784.1	2.3484	0.1448	814.69	815.0006	2	460.6	64.3%	1	K.DIVGAVLK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.786.786.2	1.9544	0.3242	815.62	815.0006	1	301.1	71.4%	1	K.DIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.846.846.2	5.7789	0.6533	2312.98	2313.4863	1	2252.7	63.0%	3	K.ATDGGAHGVINVSVSEAAIEASTR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.839.839.3	3.3322	0.4938	2313.61	2313.4863	1	700.0	28.3%	1	K.ATDGGAHGVINVSVSEAAIEASTR.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.737.737.2	2.6891	0.4672	1805.72	1806.1333	1	284.3	35.3%	1	R.YVRANGTTVLVGMPAGAK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.739.739.2	3.9541	0.6782	1388.18	1387.6373	1	1096.8	75.0%	1	R.ANGTTVLVGMPAGAK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.740.740.1	2.8264	0.6052	1389.64	1387.6373	1	415.9	53.6%	2	R.ANGTTVLVGMPAGAK.C	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.789.789.1	2.2104	0.4439	1251.72	1252.4128	1	174.7	63.6%	2	K.SISIVGSYVGNR.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.771.771.2	3.5999	0.6206	1252.66	1252.4128	1	1382.4	86.4%	1	K.SISIVGSYVGNR.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.845.845.2	2.1307	0.4033	969.64	969.0849	1	752.4	92.9%	1	R.EALDFFAR.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.580.580.1	2.1314	0.4353	841.81	842.0696	1	421.6	64.3%	1	R.GLVKSPIK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.919.919.2	4.4096	0.6474	2271.2	2271.7458	1	1507.1	57.5%	1	R.GLVKSPIKVVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.915.915.3	5.1411	0.5737	2272.75	2271.7458	1	1786.9	45.0%	1	R.GLVKSPIKVVGLSTLPEIYEK.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.975.975.3	4.0153	0.5631	3271.15	3270.9421	1	523.2	23.3%	1	R.GLVKSPIKVVGLSTLPEIYEKMEKGQIVGR.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.904.904.1	3.8144	0.5631	1872.91	1874.2279	1	850.1	59.4%	1	K.SPIKVVGLSTLPEIYEK.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.905.905.3	3.4355	0.4247	1874.71	1874.2279	1	462.4	39.1%	1	K.SPIKVVGLSTLPEIYEK.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.901.901.2	6.1535	0.6904	1875.28	1874.2279	1	2291.6	75.0%	1	K.SPIKVVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.874.874.1	2.6567	0.6013	1447.8	1448.6995	1	422.8	58.3%	1	K.VVGLSTLPEIYEK.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.875.875.2	3.309	0.6762	1448.96	1448.6995	1	976.9	75.0%	1	K.VVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.304.304.1	1.7559	0.3233	1017.71	1018.2194	1	232.6	62.5%	1	K.MEKGQIVGR.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.258.258.1	1.7182	0.1744	629.65	629.7373	1	206.9	70.0%	1	K.GQIVGR.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.288.288.1	2.4671	0.397	811.59	811.9103	1	614.9	83.3%	2	R.YVVDTSK.-	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.295.295.2	1.9178	0.4141	812.68	811.9103	1	534.5	100.0%	1	R.YVVDTSK.-	2

	Proteins	Peptide IDs	Copies
Unfiltered	1418	2260	2491
Redundant	7	245	315
Nonredundant	7	245	315

/home/51n/myMS/article/sequest/nathanPSM/tryptic/simple