D simple4

DTASelect v1.9
/home/51n/myMS/article/sequest/nathanPSM/tryptic/simple4
/home/51n/myMS/db/psmDB/20040623-Scale-17423.fasta
SEQUEST-PVM v.27 in SQT format.
-1 1.891141 -2 2.084605 -3 2.896861 --DB -d 0 -p 2
Jump to the summary table.

sequest.params modifications:

true	Use criteria
1.891141	Minimum +1 XCorr
2.084605	Minimum +2 XCorr
2.896861	Minimum +3 XCorr
0.0	Minimum DeltCN
1	Minimum charge state
3	Maximum charge state
0.0	Minimum ion proportion
1000	Maximum Sp rank
-1.0	Minimum Sp score
Include	Modified peptide inclusion
Any	Tryptic status requirement
true	Multiple, ambiguous IDs allowed
Ignore	Peptide validation handling
XCorr	Purge duplicate peptides by protein
false	Include only loci with unique peptide
false	Remove subset proteins
Ignore	Locus validation handling
0	Minimum modified peptides per locus
10	Minimum redundancy for low coverage loci
2	Minimum peptides per locus

Locus Key:

Validation Status

Locus

Sequence Count

Spectrum Count

Sequence Coverage

Length

MolWt

Descriptive Name

Similarity Key:

Locus

# of identical peptides

# of differing peptides

std_gi|2506462|sp|P02188|MYG_HORSE

100.0%

153

16951

7.8

MYOGLOBIN gi|494712|pdb|1YMB| Metmyoglobin (Horse Heart) gi|494713|pdb|1YMC| Cyanomet-Sulfmyoglobin (Horse Heart) gi|2914628|pdb|1WLA| Myoglobin (Horse Heart) Recombinant Wild-Type gi|2982074|pdb|1AZI| Myoglobin (Horse Heart) Recombinant Wild-Type Complexed With Azide [MASS=16951]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1030.1030.1	3.0289	0.5625	1816.76	1817.011	1	399.5	46.7%	1	-.GLSDGEWQQVLNVWGK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1029.1029.2	4.6381	0.5454	1817.24	1817.011	1	2094.3	73.3%	1	-.GLSDGEWQQVLNVWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1190.1190.2	3.2229	0.5584	3404.12	3405.7947	1	295.1	26.7%	1	-.GLSDGEWQQVLNVWGKVEADIAGHGQEVLIR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1186.1186.3	7.0495	0.6224	3406.3	3405.7947	1	2090.8	33.3%	1	-.GLSDGEWQQVLNVWGKVEADIAGHGQEVLIR.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.730.730.1	3.1316	0.3469	1606.92	1607.8069	1	345.5	50.0%	1	K.VEADIAGHGQEVLIR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.729.729.2	4.4611	0.4957	1608.1	1607.8069	1	1869.6	85.7%	1	K.VEADIAGHGQEVLIR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.660.660.1	2.6236	0.2679	1271.7	1272.4435	1	572.9	65.0%	1	R.LFTGHPETLEK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.662.662.2	2.8677	0.3953	1274.1	1272.4435	1	645.7	75.0%	1	R.LFTGHPETLEK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.726.726.2	2.18	0.2392	1663.62	1662.8828	1	353.8	50.0%	1	R.LFTGHPETLEKFDK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.754.754.2	3.0801	0.4968	1938.0	1938.2334	1	533.8	53.3%	1	R.LFTGHPETLEKFDKFK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.396.396.2	3.4506	0.575	1363.88	1362.6299	1	1501.9	90.0%	1	K.FKHLKTEAEMK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.400.400.3	3.1645	0.3144	1364.05	1362.6299	1	863.1	60.0%	1	K.FKHLKTEAEMK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.268.268.1	2.3572	0.4446	1086.6	1087.2793	1	527.9	68.8%	1	K.HLKTEAEMK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.273.273.2	3.0527	0.5105	1088.0	1087.2793	1	961.2	87.5%	1	K.HLKTEAEMK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.494.494.2	4.4737	0.5983	1858.6	1859.148	1	1660.4	76.7%	1	K.HLKTEAEMKASEDLKK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.421.421.1	3.1569	0.3941	1479.68	1480.6733	1	546.0	62.5%	1	K.TEAEMKASEDLKK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.419.419.2	3.979	0.5346	1480.76	1480.6733	1	1695.5	79.2%	1	K.TEAEMKASEDLKK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.929.929.1	3.4905	0.5473	1378.86	1379.686	1	712.2	61.5%	1	K.HGTVVLTALGGILK.K	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.930.930.2	4.3501	0.6653	1379.72	1379.686	1	1752.9	92.3%	1	K.HGTVVLTALGGILK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.935.935.3	3.265	0.4799	1380.16	1379.686	1	1121.4	50.0%	1	K.HGTVVLTALGGILK.K	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.854.854.1	3.3301	0.4794	1506.89	1507.8601	1	741.8	60.7%	1	K.HGTVVLTALGGILKK.K	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.855.855.2	4.4289	0.6668	1508.36	1507.8601	1	1889.2	78.6%	1	K.HGTVVLTALGGILKK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.856.856.3	4.424	0.5506	1508.56	1507.8601	1	2783.8	67.9%	1	K.HGTVVLTALGGILKK.K	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.319.319.2	4.6826	0.6049	2110.94	2111.4116	1	1168.7	58.3%	2	K.KKGHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.303.303.3	4.356	0.5987	2112.19	2111.4116	1	1145.4	45.8%	1	K.KKGHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.324.324.1	4.6347	0.6479	1982.0	1983.2375	1	964.0	58.8%	1	K.KGHHEAELKPLAQSHATK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.323.323.3	4.3802	0.4908	1983.19	1983.2375	1	1033.1	45.6%	1	K.KGHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.343.343.2	4.8896	0.6034	1983.86	1983.2375	1	1236.5	61.8%	2	K.KGHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.348.348.1	4.4345	0.5964	1853.86	1855.0635	1	685.8	53.1%	1	K.GHHEAELKPLAQSHATK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.373.373.2	3.6839	0.5421	1854.18	1855.0635	1	661.5	56.2%	3	K.GHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1111.1111.2	5.2261	0.5272	2602.1	2603.1257	1	1056.3	45.2%	1	K.HKIPIKYLEFISDAIIHVLHSK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1109.1109.3	5.5182	0.637	2603.53	2603.1257	1	566.5	32.1%	1	K.HKIPIKYLEFISDAIIHVLHSK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1055.1055.3	4.5653	0.5334	4087.42	4087.732	1	512.2	23.6%	1	K.HKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1097.1097.3	3.0453	0.4814	1886.95	1886.201	1	727.6	50.0%	1	K.YLEFISDAIIHVLHSK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1094.1094.2	5.0902	0.6154	1887.3	1886.201	1	1425.0	73.3%	2	K.YLEFISDAIIHVLHSK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1106.1106.1	3.6728	0.558	1887.82	1886.201	1	656.7	60.0%	2	K.YLEFISDAIIHVLHSK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1052.1052.2	3.5427	0.6182	3369.6	3370.8071	1	305.8	25.0%	1	K.YLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1049.1049.3	6.178	0.6949	3370.69	3370.8071	1	1023.3	31.7%	1	K.YLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.639.639.1	2.4895	0.5791	1502.58	1503.6293	1	430.1	60.7%	1	K.HPGDFGADAQGAMTK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.642.642.3	3.7425	0.4346	1505.14	1503.6293	1	1715.8	55.4%	1	K.HPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.640.640.2	3.3832	0.6283	1505.38	1503.6293	1	617.0	67.9%	1	K.HPGDFGADAQGAMTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.787.787.1	2.2634	0.3777	1360.72	1361.584	7	144.6	45.5%	1	K.ALELFRNDIAAK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.792.792.2	2.5303	0.071	1362.52	1361.584	11	398.9	50.0%	1	K.ALELFRNDIAAK.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.937.937.2	4.1127	0.6621	2284.52	2284.62	1	891.1	44.7%	1	K.ALELFRNDIAAKYKELGFQG.-	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.195.195.1	2.0482	0.0306	631.6	631.7068	1	404.2	80.0%	3	R.NDIAAK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.687.687.1	2.3096	0.5206	941.59	942.0593	1	411.8	71.4%	1	K.YKELGFQG.-	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.689.689.2	2.4491	0.4231	942.38	942.0593	1	838.0	85.7%	1	K.YKELGFQG.-	2

std_gi|122572|sp|P02070|HBB_BOVIN

95.9%

145

15954

7.6

HEMOGLOBIN BETA CHAIN gi|70412|pir||HBBOB hemoglobin beta chain - bovine gi|576143|pdb|1HDA|B Bos taurus gi|576145|pdb|1HDA|D Bos taurus gi|395 (X00376) beta-globin [Bos taurus] gi|162741 (M63453) beta-globin [Bos taurus] [MASS=15954]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.289.289.1	1.9175	0.3161	821.44	821.9641	1	542.2	83.3%	1	-.MLTAEEK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.917.917.2	4.5632	0.6317	1753.92	1754.054	1	1322.7	66.7%	1	-.MLTAEEKAAVTAFWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.766.766.1	2.1238	0.3537	950.79	951.113	1	609.7	62.5%	1	K.AAVTAFWGK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.776.776.2	2.8685	0.322	952.76	951.113	1	1052.2	87.5%	1	K.AAVTAFWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.669.669.1	3.2176	0.4627	1328.84	1329.496	1	427.4	62.5%	1	K.VKVDEVGGEALGR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.670.670.2	4.5399	0.4976	1330.0	1329.496	1	1643.4	83.3%	1	K.VKVDEVGGEALGR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.677.677.3	3.551	0.3663	1330.57	1329.496	2	1017.7	45.8%	1	K.VKVDEVGGEALGR.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.629.629.1	2.0632	0.3097	1101.62	1102.1895	1	307.7	60.0%	1	K.VDEVGGEALGR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.632.632.2	3.7129	0.3142	1102.62	1102.1895	1	1234.1	85.0%	1	K.VDEVGGEALGR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.895.895.2	2.703	0.318	1275.96	1275.5363	1	1027.3	77.8%	1	R.LLVVYPWTQR.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1169.1169.3	5.5404	0.5362	3348.55	3347.8127	1	1294.1	31.2%	1	R.LLVVYPWTQRFFESFGDLSTADAVMNNPK.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.939.939.2	5.4983	0.6504	2090.58	2091.2996	1	1782.8	66.7%	5	R.FFESFGDLSTADAVMNNPK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.945.945.3	5.2429	0.4387	2091.79	2091.2996	1	1193.8	41.7%	1	R.FFESFGDLSTADAVMNNPK.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.672.672.1	2.5378	0.3943	1225.59	1226.4333	1	369.5	65.0%	1	K.KVLDSFSNGMK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.709.709.1	2.4596	0.4257	1097.45	1098.2592	1	411.5	66.7%	1	K.VLDSFSNGMK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.711.711.2	2.598	0.3627	1098.68	1098.2592	1	512.0	77.8%	1	K.VLDSFSNGMK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.290.290.1	2.046	0.3288	740.66	740.8345	1	343.8	80.0%	1	K.HLDDLK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.931.931.3	4.7581	0.5288	3194.02	3194.589	1	1092.0	36.1%	1	K.HLDDLKGTFAALSELHCDKLHVDPENFK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.680.680.1	2.5344	0.4323	1098.65	1099.2314	1	352.0	68.8%	1	K.LHVDPENFK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1069.1069.1	2.1577	0.3054	1265.88	1266.6133	3	205.3	45.5%	1	K.LLGNVLVVVLAR.N	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1070.1070.2	4.0595	0.4602	1267.9	1266.6133	1	1317.6	86.4%	1	K.LLGNVLVVVLAR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.852.852.1	3.5335	0.6125	1869.79	1870.1149	1	423.3	53.3%	1	R.NFGKEFTPVLQADFQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.850.850.2	4.7543	0.6922	1870.06	1870.1149	1	1350.9	76.7%	1	R.NFGKEFTPVLQADFQK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1156.1156.2	3.7011	0.5505	3328.38	3329.7886	1	352.7	31.0%	1	R.NFGKEFTPVLQADFQKVVAGVANALAHRYH.-	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1149.1149.3	4.6761	0.5556	3330.76	3329.7886	1	598.1	26.7%	1	R.NFGKEFTPVLQADFQKVVAGVANALAHRYH.-	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.829.829.1	2.8579	0.5808	1422.66	1423.6085	1	341.0	68.2%	1	K.EFTPVLQADFQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.684.684.1	2.2249	0.3048	1177.55	1178.3799	1	203.4	45.5%	1	K.VVAGVANALAHR.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.685.685.2	3.7331	0.5592	1178.9	1178.3799	1	1911.8	95.5%	1	K.VVAGVANALAHR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.710.710.2	3.7839	0.5879	1478.84	1478.6969	1	2148.1	80.8%	1	K.VVAGVANALAHRYH.-	2

std_gi|122361|sp|P01966|HBA_BOVIN

86.5%

141

15053

8.4

HEMOGLOBIN ALPHA CHAIN gi|70238|pir||HABO hemoglobin alpha chain - bovine gi|576142|pdb|1HDA|A Bos taurus gi|576144|pdb|1HDA|C Bos taurus [MASS=15053]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.249.249.1	1.9334	0.1777	703.59	703.8137	1	634.9	83.3%	1	-.VLSAADK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.278.278.1	2.8129	0.4045	1101.62	1102.2761	1	548.4	70.0%	2	-.VLSAADKGNVK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.281.281.2	2.8409	0.4879	1102.62	1102.2761	1	858.7	80.0%	1	-.VLSAADKGNVK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.675.675.1	3.7343	0.4712	1529.73	1530.6371	1	594.2	57.1%	1	K.VGGHAAEYGAEALER.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.671.671.2	4.3008	0.5769	1531.3	1530.6371	1	1838.5	71.4%	1	K.VGGHAAEYGAEALER.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.676.676.3	3.453	0.3493	1531.33	1530.6371	1	1322.8	44.6%	1	K.VGGHAAEYGAEALER.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.859.859.1	2.1012	0.4901	1071.52	1072.3075	1	433.9	68.8%	1	R.MFLSFPTTK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.861.861.2	2.4933	0.5539	1073.02	1072.3075	1	544.3	75.0%	1	R.MFLSFPTTK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.782.782.1	4.0399	0.5455	1833.78	1835.0287	1	812.4	60.0%	2	K.TYFPHFDLSHGSAQVK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.779.779.2	3.8447	0.6326	1834.72	1835.0287	1	1819.4	76.7%	1	K.TYFPHFDLSHGSAQVK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.780.780.3	3.4568	0.5093	1836.22	1835.0287	1	535.9	41.7%	1	K.TYFPHFDLSHGSAQVK.G	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.879.879.2	5.4586	0.6511	2367.96	2368.6084	1	1292.9	61.9%	1	K.AVEHLDDLPGALSELSDLHAHK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.880.880.3	6.4488	0.6532	2370.16	2368.6084	1	2826.1	46.4%	1	K.AVEHLDDLPGALSELSDLHAHK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.869.869.2	5.3936	0.6698	2636.82	2637.9553	1	1656.4	60.9%	1	K.AVEHLDDLPGALSELSDLHAHKLR.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.870.870.3	6.4392	0.5564	2638.36	2637.9553	1	2329.7	46.7%	1	K.AVEHLDDLPGALSELSDLHAHKLR.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.927.927.3	3.4963	0.3275	3439.06	3437.8804	1	865.1	24.2%	1	K.AVEHLDDLPGALSELSDLHAHKLRVDPVNFK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.721.721.2	2.5084	0.5234	1088.7	1088.295	1	481.3	75.0%	1	K.LRVDPVNFK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1020.1020.2	4.633	0.6821	2970.3	2971.4265	1	649.1	35.2%	1	K.LLSHSLLVTLASHLPSDFTPAVHASLDK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1019.1019.3	6.7806	0.6367	2971.51	2971.4265	1	1759.3	40.7%	2	K.LLSHSLLVTLASHLPSDFTPAVHASLDK.F	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1240.1240.3	8.4298	0.6909	4231.87	4232.91	1	2751.3	32.1%	1	K.LLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSK.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.849.849.1	2.4988	0.5595	1279.71	1280.5071	1	643.8	63.6%	1	K.FLANVSTVLTSK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.851.851.2	3.782	0.5593	1281.66	1280.5071	1	1800.7	90.9%	1	K.FLANVSTVLTSK.Y	2

std_sp|P00698|LYC_CHICK

80.6%

129

14313

9.0

Lysozyme C precursor (EC 3.2.1.17) (1,4-beta-N-acetylmuramidase C) (Allergen Gal d 4) (Gal d IV) - Gallus gallus (Chicken).

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.604.604.1	2.3358	0.4769	836.57	837.04	1	692.6	78.6%	1	R.CELAAAMK.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.538.538.1	1.9277	0.3075	992.65	993.2275	1	289.3	68.8%	1	R.CELAAAMKR.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.540.540.2	2.542	0.3563	993.8	993.2275	1	1122.9	87.5%	1	R.CELAAAMKR.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.283.283.1	2.1167	0.2799	874.65	874.9315	1	324.6	75.0%	1	R.HGLDNYR.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.299.299.2	2.3842	0.4024	875.44	874.9315	1	794.2	100.0%	1	R.HGLDNYR.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.836.836.2	3.7672	0.6312	2125.38	2125.3691	1	637.6	47.2%	1	R.HGLDNYRGYSLGNWVCAAK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.857.857.1	2.2713	0.2739	1268.48	1269.4607	1	516.0	59.1%	1	R.GYSLGNWVCAAK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.650.650.2	3.6067	0.5284	1429.56	1429.4886	1	1601.1	81.8%	1	K.FESNFNTQATNR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.805.805.2	5.4209	0.4973	1754.84	1754.851	1	1817.5	76.7%	1	R.NTDGSTDYGILQINSR.W	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1104.1104.2	5.3894	0.6673	2337.38	2338.7146	1	1102.4	61.4%	14	R.NLCNIPCSALLSSDITASVNCAK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.999.999.2	4.2114	0.6351	2465.9	2466.8887	1	459.7	43.5%	2	R.NLCNIPCSALLSSDITASVNCAKK.I	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.847.847.2	4.8027	0.6179	1806.76	1805.0642	1	1978.6	83.3%	1	K.KIVSDGNGMNAWVAWR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.910.910.2	4.39	0.5369	1677.92	1676.8901	1	1620.8	67.9%	1	K.IVSDGNGMNAWVAWR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.767.767.2	3.2643	0.3728	1046.7	1046.171	1	1039.7	87.5%	1	K.GTDVQAWIR.G	2

std_gi|2190337|gnl|PID|e321614

76.8%

607

69324

6.2

(X58989) serum albumin [Bos taurus] gi|3336842|gnl|PID|e1311980 (Y17769) bovine serum albumin [Bos taurus] [MASS=69323]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.243.243.1	2.3951	0.2728	1193.62	1194.2925	1	306.6	66.7%	5	R.DTHKSEIAHR.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.165.165.2	2.8848	0.4526	1194.84	1194.2925	1	621.8	72.2%	5	R.DTHKSEIAHR.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.635.635.1	2.6045	0.383	1249.64	1250.3965	1	617.7	66.7%	1	R.FKDLGEEHFK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.636.636.2	3.139	0.2922	1250.54	1250.3965	1	1085.1	88.9%	1	R.FKDLGEEHFK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1091.1091.3	3.2109	0.3534	3668.95	3668.2043	1	228.1	20.8%	1	R.FKDLGEEHFKGLVLIAFSQYLQQCPFDEHVK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1145.1145.3	5.2326	0.4763	4812.7	4813.525	1	943.0	21.9%	1	R.FKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAK.T	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.477.477.1	2.208	0.3924	974.5	975.0459	1	335.0	64.3%	1	K.DLGEEHFK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1129.1129.2	4.9916	0.6974	2436.22	2436.831	1	1353.4	52.5%	2	K.GLVLIAFSQYLQQCPFDEHVK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1181.1181.3	4.7858	0.4993	3581.65	3582.1516	1	978.0	28.3%	1	K.GLVLIAFSQYLQQCPFDEHVKLVNELTEFAK.T	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.814.814.2	3.461	0.5393	1164.62	1164.344	1	633.3	83.3%	1	K.LVNELTEFAK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.270.270.1	3.2268	0.5813	1349.59	1350.4609	1	558.5	62.5%	1	K.TCVADESHAGCEK.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.831.831.1	3.4849	0.5531	1362.68	1363.5713	1	949.4	68.2%	1	K.SLHTLFGDELCK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.835.835.2	3.3688	0.5927	1363.88	1363.5713	1	1217.4	81.8%	1	K.SLHTLFGDELCK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.699.699.2	2.6128	0.4023	2484.82	2485.6875	1	155.3	30.0%	1	K.QEPERNECFLSHKDDSPDLPK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.701.701.3	3.3809	0.245	2486.23	2485.6875	1	578.3	31.2%	1	K.QEPERNECFLSHKDDSPDLPK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1076.1076.3	4.958	0.544	4343.95	4344.967	1	710.7	22.9%	1	R.RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK.I	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.363.363.1	2.1952	0.1319	847.71	848.033	4	257.0	66.7%	2	R.LSQKFPK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.367.367.2	2.5211	0.2263	848.06	848.033	2	664.4	83.3%	1	R.LSQKFPK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.634.634.1	2.5964	0.3514	922.68	923.0538	1	796.3	71.4%	1	K.AEFVEVTK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.637.637.2	2.5459	0.4286	923.6	923.0538	1	595.0	92.9%	1	K.AEFVEVTK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.714.714.2	3.9614	0.5636	2441.8	2442.742	1	685.0	40.5%	1	K.VHKECCHGDLLECADDRADLAK.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.622.622.1	2.1296	0.4824	1386.61	1387.5042	1	336.0	54.5%	1	K.YICDNQDTISSK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.626.626.2	3.8414	0.633	1387.74	1387.5042	1	821.6	86.4%	1	K.YICDNQDTISSK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.620.620.1	2.1381	0.3362	1418.62	1419.7375	1	528.6	59.1%	1	K.LKECCDKPLLEK.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.621.621.2	3.7722	0.3858	1419.8	1419.7375	1	1124.2	77.3%	1	K.LKECCDKPLLEK.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.630.630.3	2.9472	0.3305	1420.33	1419.7375	2	699.1	52.3%	1	K.LKECCDKPLLEK.S	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.353.353.1	2.3335	0.3815	1015.53	1016.1571	1	565.0	75.0%	1	K.SHCIAEVEK.D	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.911.911.3	4.7894	0.5743	3398.86	3399.8123	1	1207.8	33.3%	1	K.SHCIAEVEKDAIPENLPPLTADFAEDKDVCK.N	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.889.889.3	4.5392	0.5699	4133.08	4133.5913	1	1029.7	25.7%	1	K.SHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAK.D	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1026.1026.1	3.0326	0.5277	1567.74	1568.7258	1	249.6	62.5%	1	K.DAFLGSFLYEYSR.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.744.744.2	3.0187	0.5937	1441.2	1440.6884	1	1050.7	77.3%	1	R.RHPEYAVSVLLR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.752.752.3	3.4977	0.3163	1441.69	1440.6884	1	2401.9	63.6%	1	R.RHPEYAVSVLLR.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.906.906.3	3.587	0.3211	3421.96	3422.8643	1	734.0	25.9%	1	R.LAKEYEATLEECCAKDDPHACYSTVFDKLK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.724.724.1	2.5389	0.4292	1305.72	1306.5046	1	543.1	65.0%	1	K.HLVDEPQNLIK.Q	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.725.725.2	3.0048	0.5314	1308.14	1306.5046	1	757.1	75.0%	1	K.HLVDEPQNLIK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.811.811.2	5.4856	0.6804	2299.84	2299.5635	1	1666.9	63.9%	1	K.HLVDEPQNLIKQNCDQFEK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1044.1044.3	5.8865	0.6645	3760.54	3761.2468	1	1115.7	28.2%	1	K.HLVDEPQNLIKQNCDQFEKLGEYGFQNALIVR.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.959.959.2	3.8823	0.5603	2473.0	2473.7656	1	298.6	37.5%	1	K.QNCDQFEKLGEYGFQNALIVR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.881.881.1	2.3819	0.4023	1479.68	1480.7068	1	443.5	62.5%	1	K.LGEYGFQNALIVR.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.882.882.2	4.1627	0.4986	1481.72	1480.7068	1	1294.9	75.0%	1	K.LGEYGFQNALIVR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.749.749.1	3.0238	0.556	1639.92	1640.9207	1	295.7	53.6%	1	R.KVPQVSTPTLVEVSR.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.745.745.2	2.9416	0.6509	1640.64	1640.9207	1	884.6	75.0%	1	R.KVPQVSTPTLVEVSR.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.751.751.3	4.3548	0.4887	1641.16	1640.9207	1	1895.7	51.8%	1	R.KVPQVSTPTLVEVSR.S	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1051.1051.1	2.1157	0.469	1667.7	1668.9637	1	188.8	42.3%	1	R.MPCTEDYLSLILNR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1050.1050.2	4.4231	0.5858	1668.92	1668.9637	1	2436.9	84.6%	1	R.MPCTEDYLSLILNR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.445.445.2	2.7029	0.2471	842.54	842.0441	2	693.9	91.7%	1	R.LCVLHEK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.657.657.2	3.7844	0.6404	1484.22	1483.7662	1	1547.2	75.0%	1	R.LCVLHEKTPVSEK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.574.574.1	2.0329	0.4607	1024.6	1025.1829	1	195.5	62.5%	1	K.CCTESLVNR.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.799.799.2	3.5424	0.412	1825.74	1825.0894	1	438.5	56.7%	1	R.RPCFSALTPDETYVPK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.941.941.2	5.6549	0.7161	2441.8	2442.7456	1	1963.2	65.0%	1	K.AFDEKLFTFHADICTLPDTEK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.920.920.2	4.1145	0.6251	2811.82	2812.2097	1	782.6	41.3%	1	K.AFDEKLFTFHADICTLPDTEKQIK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.912.912.1	4.141	0.5181	1850.74	1852.112	1	785.9	63.3%	1	K.LFTFHADICTLPDTEK.Q	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.909.909.2	5.5056	0.5949	1852.1	1852.112	1	1942.0	76.7%	1	K.LFTFHADICTLPDTEK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.770.770.1	2.6086	0.355	1142.76	1143.4124	1	494.9	66.7%	1	K.KQTALVELLK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.238.238.1	2.0697	0.1744	818.59	818.9023	1	379.8	75.0%	1	K.ATEEQLK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1134.1134.2	5.1316	0.5283	2199.94	2200.5115	1	1341.6	63.9%	1	K.ATEEQLKTVMENFVAFVDK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1142.1142.3	3.9779	0.5825	2201.83	2200.5115	1	1030.5	37.5%	1	K.ATEEQLKTVMENFVAFVDK.C	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1220.1220.3	5.4913	0.6183	3938.41	3939.4773	1	2008.4	27.9%	1	K.ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1175.1175.2	3.7311	0.5822	3138.04	3139.5981	1	415.7	28.6%	1	K.TVMENFVAFVDKCCAADDKEACFAVEGPK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1174.1174.3	4.938	0.5054	3138.76	3139.5981	1	1275.5	29.5%	1	K.TVMENFVAFVDKCCAADDKEACFAVEGPK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1214.1214.3	3.1672	0.2376	4122.79	4123.759	1	718.7	21.1%	1	K.TVMENFVAFVDKCCAADDKEACFAVEGPKLVVSTQTALA.-	3

std_tr|Q865Y7

70.8%

260

29114

6.9

Carbonic anhydrase II (EC 4.2.1.1) - Bos taurus (Bovine).

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.253.253.1	2.2676	0.3716	1141.59	1142.2217	1	220.1	56.2%	1	K.HNGPEHWHK.D	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.654.654.2	5.506	0.5682	2141.66	2142.3005	1	1121.4	67.6%	1	K.HNGPEHWHKDFPIANGER.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.536.536.2	2.3793	0.4591	1003.76	1003.0972	1	581.2	87.5%	2	R.QSPVDIDTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.961.961.2	3.8538	0.5873	2199.94	2199.5554	1	540.6	55.0%	1	K.AVVQDPALKPLALVYGEATSR.R	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.964.964.3	3.9933	0.5886	2201.83	2199.5554	1	1595.1	42.5%	1	K.AVVQDPALKPLALVYGEATSR.R	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.756.756.1	2.8418	0.5615	1581.81	1582.8021	1	910.7	70.8%	1	K.YAAELHLVHWNTK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1066.1066.2	4.9038	0.6489	2255.12	2254.5474	1	797.0	59.5%	2	K.YGDFGTAAQQPDGLAVVGVFLK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.338.338.1	1.9973	0.4052	1012.65	1013.1387	1	714.8	66.7%	1	K.VGDANPALQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.339.339.2	3.7344	0.4803	1014.9	1013.1387	1	1389.9	94.4%	1	K.VGDANPALQK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.775.775.1	2.2059	0.416	973.64	974.1424	1	576.6	68.8%	1	K.VLDALDSIK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1385.1385.3	4.24	0.5545	5923.24	5924.7793	1	402.8	16.3%	1	K.STDFPNFDPGSLLPNVLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSQQMLK.F	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.734.734.1	2.3565	0.2922	1346.7	1347.5695	2	130.0	50.0%	1	K.EPISVSSQQMLK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1011.1011.3	4.0224	0.3663	3429.01	3427.952	1	449.1	22.3%	1	K.FRTLNFNAEGEPELLMLANWRPAQPLKNR.Q	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1064.1064.2	3.7473	0.5991	2854.08	2854.2964	1	266.3	33.3%	1	R.TLNFNAEGEPELLMLANWRPAQPLK.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1065.1065.3	3.4342	0.5433	2855.32	2854.2964	1	480.5	27.1%	1	R.TLNFNAEGEPELLMLANWRPAQPLK.N	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1014.1014.3	4.0691	0.3983	3124.78	3124.5876	1	476.5	23.1%	1	R.TLNFNAEGEPELLMLANWRPAQPLKNR.Q	3

std_gi|1168350|sp|P00330|ADH1_YEAST

67.8%

348

36823

6.7

ALCOHOL DEHYDROGENASE I gi|3339 (V01292) alcohol dehydrogenase [Saccharomyces cerevisiae] gi|171025 (M38456) alcohol dehydrogenase [Saccharomyces cerevisiae] gi|171027 (J01313) alcohol dehydrogenase 1 [Saccharomyces cerevisiae] [MASS=36823]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.619.619.1	2.2444	0.3987	1136.59	1137.2804	1	436.7	66.7%	1	K.GVIFYESHGK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.761.761.2	3.2928	0.322	1014.24	1014.2101	1	1282.6	93.8%	1	K.ANELLINVK.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.762.762.1	2.3676	0.2681	1016.48	1014.2101	3	219.5	62.5%	3	K.ANELLINVK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.936.936.3	3.5509	0.421	4421.89	4421.053	1	430.3	17.1%	1	K.YSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVGMGENVK.G	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.824.824.2	6.0352	0.696	2021.08	2020.3544	1	3086.5	72.5%	1	K.LPLVGGHEGAGVVVGMGENVK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.827.827.3	3.6682	0.3612	2022.67	2020.3544	1	1260.4	40.0%	1	K.LPLVGGHEGAGVVVGMGENVK.G	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.614.614.2	2.6312	0.2512	838.04	836.9634	1	422.8	85.7%	1	K.IGDYAGIK.W	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.986.986.2	4.7435	0.5204	3013.38	3014.5156	1	727.2	35.0%	1	K.ALKSANLMAGHWVAISGAAGGLGSLAVQYAK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1074.1074.2	5.7875	0.6792	2701.16	2702.1033	1	1841.3	50.0%	12	K.SANLMAGHWVAISGAAGGLGSLAVQYAK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.809.809.1	2.0143	0.1816	1618.85	1619.815	1	165.9	42.9%	1	R.VLGIDGGEGKEELFR.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.804.804.2	3.6407	0.5428	1619.38	1619.815	1	1225.6	75.0%	1	R.VLGIDGGEGKEELFR.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.974.974.1	3.0868	0.5212	1312.64	1313.493	1	810.2	68.2%	2	R.SIGGEVFIDFTK.E	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1059.1059.2	5.252	0.5903	2366.32	2366.76	1	1008.3	45.2%	2	R.SIGGEVFIDFTKEKDIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1072.1072.3	3.0501	0.4185	2369.47	2366.76	1	369.6	32.1%	1	R.SIGGEVFIDFTKEKDIVGAVLK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.719.719.1	2.486	0.1587	1071.74	1072.2902	2	446.5	72.2%	1	K.EKDIVGAVLK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.784.784.1	2.3484	0.2198	814.69	815.0006	5	460.6	64.3%	1	K.DIVGAVLK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.846.846.2	5.7789	0.6651	2312.98	2313.4863	1	2252.7	63.0%	3	K.ATDGGAHGVINVSVSEAAIEASTR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.839.839.3	3.3322	0.3518	2313.61	2313.4863	1	700.0	28.3%	1	K.ATDGGAHGVINVSVSEAAIEASTR.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.737.737.2	2.6891	0.489	1805.72	1806.1333	1	284.3	35.3%	1	R.YVRANGTTVLVGMPAGAK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.739.739.2	3.9541	0.5811	1388.18	1387.6373	1	1096.8	75.0%	1	R.ANGTTVLVGMPAGAK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.740.740.1	2.8264	0.468	1389.64	1387.6373	1	415.9	53.6%	2	R.ANGTTVLVGMPAGAK.C	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.789.789.1	2.2104	0.3722	1251.72	1252.4128	1	174.7	63.6%	1	K.SISIVGSYVGNR.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.771.771.2	3.5999	0.6452	1252.66	1252.4128	1	1382.4	86.4%	1	K.SISIVGSYVGNR.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.845.845.2	2.1307	0.1386	969.64	969.0849	1	752.4	92.9%	1	R.EALDFFAR.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.580.580.1	2.1314	0.2688	841.81	842.0696	1	421.6	64.3%	1	R.GLVKSPIK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.919.919.2	4.4096	0.6731	2271.2	2271.7458	1	1507.1	57.5%	1	R.GLVKSPIKVVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.915.915.3	5.1411	0.5938	2272.75	2271.7458	1	1786.9	45.0%	1	R.GLVKSPIKVVGLSTLPEIYEK.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.975.975.3	4.0153	0.4489	3271.15	3270.9421	1	523.2	23.3%	1	R.GLVKSPIKVVGLSTLPEIYEKMEKGQIVGR.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.904.904.1	3.8144	0.4705	1872.91	1874.2279	1	850.1	59.4%	1	K.SPIKVVGLSTLPEIYEK.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.905.905.3	3.4355	0.2877	1874.71	1874.2279	1	462.4	39.1%	1	K.SPIKVVGLSTLPEIYEK.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.901.901.2	6.1535	0.6938	1875.28	1874.2279	1	2291.6	75.0%	1	K.SPIKVVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.874.874.1	2.6567	0.5383	1447.8	1448.6995	1	422.8	58.3%	1	K.VVGLSTLPEIYEK.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.875.875.2	3.309	0.6018	1448.96	1448.6995	1	976.9	75.0%	1	K.VVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.288.288.1	2.4671	0.4779	811.59	811.9103	1	614.9	83.3%	2	R.YVVDTSK.-	1

	Proteins	Peptide IDs	Copies
Unfiltered	1941	2260	2667
Redundant	7	223	283
Nonredundant	7	223	283

/home/51n/myMS/article/sequest/nathanPSM/tryptic/simple4