D simple4

DTASelect v1.9
/home/51n/myMS/article/dbdigger/nathanPSM/tryptic/simple4
/home/51n/myMS/db/psmDB/20040623-Scale-17423.fasta
DBDigger 0.5 in SQT format.
-1 28.9254 -2 31.66214 -3 31.30806 --DB -d 0 -p 2
Jump to the summary table.

sequest.params modifications:

true	Use criteria
28.9254	Minimum +1 XCorr
31.66214	Minimum +2 XCorr
31.30806	Minimum +3 XCorr
0.0	Minimum DeltCN
1	Minimum charge state
3	Maximum charge state
0.0	Minimum ion proportion
1000	Maximum Sp rank
-1.0	Minimum Sp score
Include	Modified peptide inclusion
Any	Tryptic status requirement
true	Multiple, ambiguous IDs allowed
Ignore	Peptide validation handling
XCorr	Purge duplicate peptides by protein
false	Include only loci with unique peptide
false	Remove subset proteins
Ignore	Locus validation handling
0	Minimum modified peptides per locus
10	Minimum redundancy for low coverage loci
2	Minimum peptides per locus

Locus Key:

Validation Status

Locus

Sequence Count

Spectrum Count

Sequence Coverage

Length

MolWt

Descriptive Name

Similarity Key:

Locus

# of identical peptides

# of differing peptides

std_gi|2506462|sp|P02188|MYG_HORSE

100.0%

153

16951

7.8

MYOGLOBIN gi|494712|pdb|1YMB| Metmyoglobin (Horse Heart) gi|494713|pdb|1YMC| Cyanomet-Sulfmyoglobin (Horse Heart) gi|2914628|pdb|1WLA| Myoglobin (Horse Heart) Recombinant Wild-Type gi|2982074|pdb|1AZI| Myoglobin (Horse Heart) Recombinant Wild-Type Complexed With Azide [MASS=16951]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1030.1030.1	46.7143	0.541181	1816.76	1817.01	1	144.0	78.3%	1	-.GLSDGEWQQVLNVWGK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1029.1029.2	75.5249	0.573443	1817.24	1817.01	1	239.0	91.7%	1	-.GLSDGEWQQVLNVWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1190.1190.2	49.0407	0.555104	3404.12	3405.8	1	109.0	61.5%	1	-.GLSDGEWQQVLNVWGKVEADIAGHGQEVLIR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1186.1186.3	45.1688	0.394983	3406.3	3405.8	1	229.0	63.8%	1	-.GLSDGEWQQVLNVWGKVEADIAGHGQEVLIR.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.730.730.1	44.7754	0.378748	1606.92	1607.81	1	161.0	69.6%	1	K.VEADIAGHGQEVLIR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.729.729.2	72.0304	0.507047	1608.1	1607.81	1	232.0	88.0%	1	K.VEADIAGHGQEVLIR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.660.660.1	43.4274	0.344184	1271.7	1272.44	1	226.0	81.2%	1	R.LFTGHPETLEK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.662.662.2	50.0784	0.288721	1274.1	1272.44	1	172.0	75.0%	1	R.LFTGHPETLEK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.726.726.2	35.8428	0.255694	1663.62	1662.88	1	164.0	53.8%	1	R.LFTGHPETLEKFDK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.754.754.2	58.2318	0.502961	1938.0	1938.23	1	162.0	80.8%	1	R.LFTGHPETLEKFDKFK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.396.396.2	64.1778	0.54926	1363.88	1362.64	1	236.0	94.4%	1	K.FKHLKTEAEMK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.400.400.3	45.2589	0.413645	1364.05	1362.64	1	250.0	61.1%	1	K.FKHLKTEAEMK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.268.268.1	40.8241	0.464804	1086.6	1087.29	1	227.0	92.3%	2	K.HLKTEAEMK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.273.273.2	54.277	0.526781	1088.0	1087.29	1	237.0	100.0%	1	K.HLKTEAEMK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.494.494.2	58.0275	0.568906	1858.6	1859.15	1	6.0	77.8%	1	K.HLKTEAEMKASEDLKK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.146.146.1	30.3292	0.288811	708.59	708.81	1	184.0	90.0%	1	K.TEAEMK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.421.421.1	46.5011	0.351398	1479.68	1480.68	1	166.0	75.0%	1	K.TEAEMKASEDLKK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.419.419.2	70.2662	0.590433	1480.76	1480.68	1	186.0	95.2%	1	K.TEAEMKASEDLKK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.420.420.3	41.4086	0.391923	1481.77	1480.68	1	234.0	68.3%	1	K.TEAEMKASEDLKK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.233.233.1	31.4058	0.0128002	790.49	790.892	1	97.0	81.8%	2	K.ASEDLKK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.929.929.1	53.9155	0.478699	1378.86	1379.69	1	203.0	81.0%	1	K.HGTVVLTALGGILK.K	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.930.930.2	86.2231	0.615806	1379.72	1379.69	1	47.0	100.0%	1	K.HGTVVLTALGGILK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.935.935.3	53.2299	0.381344	1380.16	1379.69	1	63.0	60.9%	1	K.HGTVVLTALGGILK.K	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.854.854.1	56.5563	0.558161	1506.89	1507.86	1	224.0	78.3%	1	K.HGTVVLTALGGILKK.K	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.855.855.2	79.7181	0.685761	1508.36	1507.86	1	118.0	92.0%	1	K.HGTVVLTALGGILKK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.856.856.3	68.4337	0.59444	1508.56	1507.86	1	186.0	79.6%	1	K.HGTVVLTALGGILKK.K	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.319.319.2	63.1093	0.511302	2110.94	2111.41	1	208.0	73.3%	2	K.KKGHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.303.303.3	66.3732	0.561044	2112.19	2111.41	1	191.0	60.0%	1	K.KKGHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.324.324.1	63.1589	0.575457	1982.0	1983.24	1	44.0	80.8%	1	K.KGHHEAELKPLAQSHATK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.323.323.3	65.4288	0.440129	1983.19	1983.24	1	189.0	71.9%	1	K.KGHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.343.343.2	57.4269	0.5683	1983.86	1983.24	1	225.0	71.4%	2	K.KGHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.348.348.1	62.4866	0.608127	1853.86	1855.06	1	52.0	84.0%	1	K.GHHEAELKPLAQSHATK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.373.373.2	49.9343	0.509525	1854.18	1855.06	1	171.0	65.4%	3	K.GHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.349.349.3	42.3913	0.419857	1855.72	1855.06	1	169.0	54.9%	1	K.GHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.269.269.1	29.6415	0.0249549	736.66	735.948	1	217.0	88.9%	1	K.HKIPIK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1111.1111.2	74.0332	0.585244	2602.1	2603.13	1	208.0	88.9%	1	K.HKIPIKYLEFISDAIIHVLHSK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1109.1109.3	51.619	0.508204	2603.53	2603.13	1	94.0	72.3%	1	K.HKIPIKYLEFISDAIIHVLHSK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1055.1055.3	33.1323	0.385844	4087.42	4087.74	1	172.0	48.8%	1	K.HKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1097.1097.3	39.0121	0.471379	1886.95	1886.2	1	197.0	53.2%	1	K.YLEFISDAIIHVLHSK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1094.1094.2	77.5591	0.631891	1887.3	1886.2	1	222.0	88.5%	2	K.YLEFISDAIIHVLHSK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1106.1106.1	64.7517	0.620762	1887.82	1886.2	1	164.0	95.8%	2	K.YLEFISDAIIHVLHSK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1052.1052.2	55.0611	0.603399	3369.6	3370.81	1	200.0	75.0%	1	K.YLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1049.1049.3	55.5282	0.605881	3370.69	3370.81	1	216.0	66.7%	1	K.YLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.639.639.1	45.2231	0.571938	1502.58	1503.64	1	173.0	81.0%	1	K.HPGDFGADAQGAMTK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.642.642.3	59.2433	0.531036	1505.14	1503.64	1	255.0	60.9%	1	K.HPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.640.640.2	63.2358	0.636831	1505.38	1503.64	1	40.0	80.8%	1	K.HPGDFGADAQGAMTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.787.787.1	36.2048	0.244305	1360.72	1361.58	1	45.0	72.2%	1	K.ALELFRNDIAAK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.792.792.2	33.1476	0.0805759	1362.52	1361.58	1	158.0	52.4%	1	K.ALELFRNDIAAK.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.937.937.2	47.1659	0.521084	2284.52	2284.62	1	212.0	62.1%	1	K.ALELFRNDIAAKYKELGFQG.-	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.155.155.1	34.5707	0.102445	631.7	631.707	1	174.0	90.0%	5	R.NDIAAK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.687.687.1	32.3131	0.487022	941.59	942.059	1	193.0	76.9%	1	K.YKELGFQG.-	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.689.689.2	42.8707	0.440882	942.38	942.059	1	168.0	84.6%	1	K.YKELGFQG.-	2

std_gi|122572|sp|P02070|HBB_BOVIN

95.9%

145

15954

7.6

HEMOGLOBIN BETA CHAIN gi|70412|pir||HBBOB hemoglobin beta chain - bovine gi|576143|pdb|1HDA|B Bos taurus gi|576145|pdb|1HDA|D Bos taurus gi|395 (X00376) beta-globin [Bos taurus] gi|162741 (M63453) beta-globin [Bos taurus] [MASS=15954]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.289.289.1	32.2131	0.232194	821.44	821.97	1	193.0	83.3%	3	-.MLTAEEK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.294.294.2	37.9267	0.446045	823.22	821.97	1	149.0	83.3%	1	-.MLTAEEK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.917.917.2	72.386	0.579163	1753.92	1754.06	1	214.0	78.6%	1	-.MLTAEEKAAVTAFWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.766.766.1	39.0343	0.394581	950.79	951.113	1	91.0	92.3%	1	K.AAVTAFWGK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.776.776.2	54.199	0.40169	952.76	951.113	1	232.0	93.3%	1	K.AAVTAFWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.669.669.1	49.7315	0.449098	1328.84	1329.5	1	168.0	90.0%	1	K.VKVDEVGGEALGR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.670.670.2	77.209	0.535737	1330.0	1329.5	1	236.0	90.9%	1	K.VKVDEVGGEALGR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.629.629.1	32.9308	0.297518	1101.62	1102.19	1	169.0	64.7%	1	K.VDEVGGEALGR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.632.632.2	69.1014	0.384944	1102.62	1102.19	1	223.0	90.0%	1	K.VDEVGGEALGR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.895.895.2	48.8856	0.331834	1275.96	1275.54	1	231.0	81.2%	1	R.LLVVYPWTQR.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1169.1169.3	54.1485	0.528111	3348.55	3347.82	1	214.0	64.5%	1	R.LLVVYPWTQRFFESFGDLSTADAVMNNPK.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.939.939.2	81.8551	0.661184	2090.58	2091.31	1	247.0	80.6%	5	R.FFESFGDLSTADAVMNNPK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.945.945.3	75.4724	0.538529	2091.79	2091.31	1	219.0	74.2%	1	R.FFESFGDLSTADAVMNNPK.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.672.672.1	31.391	0.322602	1225.59	1226.44	1	2.0	81.2%	1	K.KVLDSFSNGMK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.709.709.1	38.3366	0.385256	1097.45	1098.26	1	74.0	87.5%	1	K.VLDSFSNGMK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.711.711.2	38.1571	0.335196	1098.68	1098.26	1	48.0	66.7%	1	K.VLDSFSNGMK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.290.290.1	34.0335	0.307712	740.66	740.835	1	224.0	90.0%	1	K.HLDDLK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.931.931.3	63.5463	0.586901	3194.02	3194.6	1	212.0	67.6%	1	K.HLDDLKGTFAALSELHCDKLHVDPENFK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.680.680.1	41.1257	0.467216	1098.65	1099.23	1	171.0	92.3%	1	K.LHVDPENFK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1069.1069.1	29.0749	0.119013	1265.88	1266.61	1	5.0	68.4%	1	K.LLGNVLVVVLAR.N	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1070.1070.2	66.8384	0.549273	1267.9	1266.61	1	234.0	86.4%	1	K.LLGNVLVVVLAR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.852.852.1	49.1575	0.532334	1869.79	1870.12	1	40.0	72.0%	1	R.NFGKEFTPVLQADFQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.850.850.2	83.0714	0.681649	1870.06	1870.12	1	185.0	92.6%	1	R.NFGKEFTPVLQADFQK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1156.1156.2	38.4617	0.449658	3328.38	3329.79	1	132.0	57.1%	1	R.NFGKEFTPVLQADFQKVVAGVANALAHRYH.-	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1149.1149.3	49.882	0.514127	3330.76	3329.79	1	178.0	64.1%	1	R.NFGKEFTPVLQADFQKVVAGVANALAHRYH.-	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.829.829.1	44.0746	0.528604	1422.66	1423.61	1	179.0	78.9%	1	K.EFTPVLQADFQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.684.684.1	30.9862	0.310674	1177.55	1178.38	1	68.0	66.7%	1	K.VVAGVANALAHR.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.685.685.2	75.7945	0.543678	1178.9	1178.38	1	122.0	100.0%	1	K.VVAGVANALAHR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.710.710.2	69.3296	0.630027	1478.84	1478.7	1	120.0	84.0%	1	K.VVAGVANALAHRYH.-	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.707.707.3	45.3617	0.412615	1480.09	1478.7	1	189.0	62.2%	1	K.VVAGVANALAHRYH.-	3

std_gi|122361|sp|P01966|HBA_BOVIN

95.0%

141

15053

8.4

HEMOGLOBIN ALPHA CHAIN gi|70238|pir||HABO hemoglobin alpha chain - bovine gi|576142|pdb|1HDA|A Bos taurus gi|576144|pdb|1HDA|C Bos taurus [MASS=15053]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.249.249.1	37.5333	0.123253	703.59	703.814	1	237.0	91.7%	1	-.VLSAADK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.278.278.1	49.0956	0.411265	1101.62	1102.28	1	209.0	93.8%	2	-.VLSAADKGNVK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.281.281.2	49.7811	0.450605	1102.62	1102.28	1	79.0	77.8%	1	-.VLSAADKGNVK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.296.296.2	37.9675	0.351393	1006.04	1003.14	1	0.0	76.5%	1	V.LSAADKGNVK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.675.675.1	51.1047	0.447554	1529.73	1530.64	1	172.0	81.8%	1	K.VGGHAAEYGAEALER.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.671.671.2	72.8971	0.636335	1531.3	1530.64	1	253.0	87.5%	1	K.VGGHAAEYGAEALER.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.676.676.3	48.3029	0.404123	1531.33	1530.64	1	247.0	63.8%	1	K.VGGHAAEYGAEALER.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.861.861.2	45.3367	0.480172	1073.02	1072.31	1	227.0	85.7%	1	R.MFLSFPTTK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.865.865.1	36.2059	0.228211	1074.59	1072.31	1	180.0	78.6%	2	R.MFLSFPTTK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.782.782.1	61.6508	0.616263	1833.78	1835.03	1	83.0	87.0%	2	K.TYFPHFDLSHGSAQVK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.779.779.2	66.0048	0.60062	1834.72	1835.03	1	23.0	88.5%	1	K.TYFPHFDLSHGSAQVK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.780.780.3	49.0287	0.482413	1836.22	1835.03	1	202.0	64.0%	1	K.TYFPHFDLSHGSAQVK.G	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.781.781.3	35.2167	0.20162	2939.5	2940.34	1	0.0	49.3%	1	K.TYFPHFDLSHGSAQVKGHGAKVAAALTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.280.280.1	38.7064	0.22959	675.68	673.831	1	170.0	100.0%	1	K.VAAALTK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.879.879.2	86.8138	0.671363	2367.96	2368.61	1	178.0	90.3%	1	K.AVEHLDDLPGALSELSDLHAHK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.880.880.3	79.7881	0.645247	2370.16	2368.61	1	253.0	69.1%	1	K.AVEHLDDLPGALSELSDLHAHK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.869.869.2	92.0881	0.674293	2636.82	2637.96	1	214.0	93.3%	1	K.AVEHLDDLPGALSELSDLHAHKLR.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.870.870.3	74.7218	0.619638	2638.36	2637.96	1	124.0	73.8%	1	K.AVEHLDDLPGALSELSDLHAHKLR.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.927.927.3	32.0203	0.222812	3439.06	3437.88	1	217.0	52.6%	1	K.AVEHLDDLPGALSELSDLHAHKLRVDPVNFK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.721.721.2	47.7905	0.456865	1088.7	1088.3	1	206.0	92.3%	1	K.LRVDPVNFK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.644.644.1	33.1629	0.376351	818.59	818.948	1	168.0	90.9%	1	R.VDPVNFK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1020.1020.2	62.8788	0.58813	2970.3	2971.43	1	52.0	70.0%	1	K.LLSHSLLVTLASHLPSDFTPAVHASLDK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1019.1019.3	72.8086	0.596815	2971.51	2971.43	1	230.0	74.3%	2	K.LLSHSLLVTLASHLPSDFTPAVHASLDK.F	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1240.1240.3	69.5215	0.63112	4231.87	4232.91	1	59.0	65.2%	1	K.LLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSK.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.849.849.1	34.9741	0.344555	1279.71	1280.51	1	75.0	77.8%	1	K.FLANVSTVLTSK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.851.851.2	65.8458	0.563796	1281.66	1280.51	1	203.0	86.4%	1	K.FLANVSTVLTSK.Y	2

std_sp|P00698|LYC_CHICK

80.6%

129

14313

9.0

Lysozyme C precursor (EC 3.2.1.17) (1,4-beta-N-acetylmuramidase C) (Allergen Gal d 4) (Gal d IV) - Gallus gallus (Chicken).

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.604.604.1	39.1991	0.461947	836.57	837.051	1	218.0	84.6%	1	R.CELAAAMK.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.540.540.2	56.0614	0.429927	993.8	993.239	1	221.0	86.7%	1	R.CELAAAMKR.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.283.283.1	31.3199	0.166565	874.65	874.932	1	176.0	81.8%	1	R.HGLDNYR.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.299.299.2	51.7071	0.405793	875.44	874.932	1	215.0	100.0%	1	R.HGLDNYR.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.836.836.2	44.8078	0.472335	2125.38	2125.38	1	2.0	66.7%	1	R.HGLDNYRGYSLGNWVCAAK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.857.857.1	32.3947	0.275551	1268.48	1269.47	1	44.0	72.2%	1	R.GYSLGNWVCAAK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.650.650.2	60.8061	0.561139	1429.56	1429.49	1	250.0	86.4%	1	K.FESNFNTQATNR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.805.805.2	78.3018	0.634636	1754.84	1754.85	1	244.0	92.0%	1	R.NTDGSTDYGILQINSR.W	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1079.1079.2	104.259	0.728157	2337.8	2338.73	1	171.0	90.6%	7	R.NLCNIPCSALLSSDITASVNCAK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.999.999.2	69.5467	0.617714	2465.9	2466.91	1	152.0	78.1%	2	R.NLCNIPCSALLSSDITASVNCAKK.I	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.847.847.2	91.0454	0.649089	1806.76	1805.07	1	187.0	92.3%	1	K.KIVSDGNGMNAWVAWR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.910.910.2	60.6847	0.511004	1677.92	1676.9	1	186.0	70.4%	1	K.IVSDGNGMNAWVAWR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.759.759.1	30.6806	0.415895	1045.58	1046.17	1	144.0	76.9%	1	K.GTDVQAWIR.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.767.767.2	58.8126	0.398942	1046.7	1046.17	1	172.0	93.3%	1	K.GTDVQAWIR.G	2

std_gi|2190337|gnl|PID|e321614

76.6%

607

69324

6.2

(X58989) serum albumin [Bos taurus] gi|3336842|gnl|PID|e1311980 (Y17769) bovine serum albumin [Bos taurus] [MASS=69323]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.223.223.1	38.2432	0.452684	1193.62	1194.29	1	152.0	87.5%	2	R.DTHKSEIAHR.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.205.205.2	56.8498	0.47029	1194.28	1194.29	1	153.0	88.2%	5	R.DTHKSEIAHR.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.635.635.1	46.0359	0.472381	1249.64	1250.4	1	226.0	86.7%	1	R.FKDLGEEHFK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.636.636.2	65.8764	0.452472	1250.54	1250.4	1	216.0	100.0%	1	R.FKDLGEEHFK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1145.1145.3	50.1991	0.608535	4812.7	4813.53	1	156.0	62.5%	1	R.FKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAK.T	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.477.477.1	32.1709	0.318804	974.5	975.046	1	204.0	69.2%	1	K.DLGEEHFK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1129.1129.2	72.5643	0.631064	2436.22	2436.84	1	201.0	81.5%	1	K.GLVLIAFSQYLQQCPFDEHVK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1181.1181.3	47.5733	0.444731	3581.65	3582.16	1	229.0	66.7%	1	K.GLVLIAFSQYLQQCPFDEHVKLVNELTEFAK.T	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.814.814.2	57.1295	0.579018	1164.62	1164.34	1	187.0	88.9%	1	K.LVNELTEFAK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.270.270.1	48.5165	0.567094	1349.59	1350.47	1	216.0	84.2%	1	K.TCVADESHAGCEK.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.831.831.1	55.2263	0.566849	1362.68	1363.58	1	244.0	88.9%	1	K.SLHTLFGDELCK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.835.835.2	60.5233	0.514321	1363.88	1363.58	1	46.0	81.8%	1	K.SLHTLFGDELCK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.699.699.2	37.9097	0.326761	2484.82	2485.69	1	0.0	59.3%	1	K.QEPERNECFLSHKDDSPDLPK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.450.450.1	36.0616	0.315119	886.43	886.934	1	186.0	83.3%	1	K.DDSPDLPK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1076.1076.3	45.2614	0.48554	4343.95	4344.98	1	90.0	63.6%	1	R.RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK.I	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.361.361.2	36.7452	0.138701	919.96	919.136	1	208.0	76.9%	1	R.LRCASIQK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.363.363.1	33.0134	0.197262	847.71	848.033	1	148.0	81.8%	2	R.LSQKFPK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.367.367.2	44.7435	0.344419	848.06	848.033	1	30.0	100.0%	1	R.LSQKFPK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.634.634.1	43.683	0.557153	922.68	923.054	1	224.0	100.0%	1	K.AEFVEVTK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.637.637.2	53.8103	0.512467	923.6	923.054	1	211.0	100.0%	1	K.AEFVEVTK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.584.584.1	35.0314	0.302135	789.68	789.948	1	207.0	81.8%	1	K.LVTDLTK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.714.714.2	50.0527	0.541401	2441.8	2442.76	1	87.0	64.5%	1	K.VHKECCHGDLLECADDRADLAK.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.715.715.3	32.3069	0.105179	2442.73	2442.76	1	66.0	50.7%	1	K.VHKECCHGDLLECADDRADLAK.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.622.622.1	37.2267	0.429047	1386.61	1387.51	1	169.0	72.2%	1	K.YICDNQDTISSK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.626.626.2	71.1827	0.541327	1387.74	1387.51	1	143.0	95.0%	1	K.YICDNQDTISSK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.620.620.1	41.2669	0.337576	1418.62	1419.75	1	104.0	77.8%	1	K.LKECCDKPLLEK.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.621.621.2	58.8423	0.52155	1419.8	1419.75	1	244.0	85.0%	1	K.LKECCDKPLLEK.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.630.630.3	41.9713	0.244033	1420.33	1419.75	1	181.0	59.0%	1	K.LKECCDKPLLEK.S	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.353.353.1	41.4493	0.346057	1015.53	1016.16	1	228.0	85.7%	1	K.SHCIAEVEK.D	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.911.911.3	76.4799	0.655574	3398.86	3399.82	1	240.0	73.8%	1	K.SHCIAEVEKDAIPENLPPLTADFAEDKDVCK.N	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.889.889.3	42.3091	0.462492	4133.08	4133.6	1	228.0	60.7%	1	K.SHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAK.D	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1026.1026.1	38.1141	0.48693	1567.74	1568.73	1	136.0	73.7%	1	K.DAFLGSFLYEYSR.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.744.744.2	59.9955	0.583089	1441.2	1440.69	1	164.0	86.4%	1	R.RHPEYAVSVLLR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.752.752.3	48.3442	0.36677	1441.69	1440.69	1	233.0	65.8%	1	R.RHPEYAVSVLLR.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.906.906.3	38.2211	0.278174	3421.96	3422.88	1	208.0	56.4%	1	R.LAKEYEATLEECCAKDDPHACYSTVFDKLK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.724.724.1	42.0054	0.402877	1305.72	1306.51	1	205.0	81.2%	1	K.HLVDEPQNLIK.Q	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.725.725.2	61.2466	0.599597	1308.14	1306.51	1	190.0	88.9%	1	K.HLVDEPQNLIK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.811.811.2	76.7163	0.62589	2299.84	2299.57	1	225.0	89.3%	1	K.HLVDEPQNLIKQNCDQFEK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1044.1044.3	52.2706	0.550185	3760.54	3761.25	1	174.0	65.0%	1	K.HLVDEPQNLIKQNCDQFEKLGEYGFQNALIVR.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.959.959.2	48.8654	0.47821	2473.0	2473.77	1	37.0	64.3%	1	K.QNCDQFEKLGEYGFQNALIVR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.881.881.1	36.2	0.42663	1479.68	1480.71	1	136.0	70.0%	1	K.LGEYGFQNALIVR.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.882.882.2	69.8211	0.453975	1481.72	1480.71	1	234.0	82.6%	1	K.LGEYGFQNALIVR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.749.749.1	36.4322	0.412662	1639.92	1640.92	1	16.0	69.6%	1	R.KVPQVSTPTLVEVSR.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.745.745.2	66.2781	0.578734	1640.64	1640.92	1	106.0	87.5%	1	R.KVPQVSTPTLVEVSR.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.751.751.3	45.7976	0.387051	1641.16	1640.92	1	252.0	65.3%	1	R.KVPQVSTPTLVEVSR.S	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1051.1051.1	33.5923	0.470626	1667.7	1668.97	1	192.0	76.2%	1	R.MPCTEDYLSLILNR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1050.1050.2	76.0292	0.567656	1668.92	1668.97	1	246.0	95.7%	1	R.MPCTEDYLSLILNR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.441.441.1	30.1928	0.293279	841.56	842.05	1	184.0	81.8%	1	R.LCVLHEK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.445.445.2	47.5733	0.242676	842.54	842.05	1	244.0	100.0%	1	R.LCVLHEK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.657.657.2	59.555	0.592944	1484.22	1483.77	1	252.0	86.4%	1	R.LCVLHEKTPVSEK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.265.265.1	29.6507	0.223856	990.69	989.158	1	24.0	71.4%	1	K.TPVSEKVTK.C	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.799.799.2	50.6921	0.339556	1825.74	1825.09	1	153.0	64.3%	1	R.RPCFSALTPDETYVPK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.800.800.3	38.9432	0.247442	1826.89	1825.09	1	189.0	58.0%	1	R.RPCFSALTPDETYVPK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.941.941.2	95.6942	0.745118	2441.8	2442.75	1	201.0	86.2%	1	K.AFDEKLFTFHADICTLPDTEK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.920.920.2	67.5318	0.625273	2811.82	2812.22	1	201.0	78.6%	1	K.AFDEKLFTFHADICTLPDTEKQIK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.912.912.1	64.7564	0.529733	1850.74	1852.12	1	138.0	91.7%	1	K.LFTFHADICTLPDTEK.Q	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.909.909.2	84.3468	0.626235	1852.1	1852.12	1	250.0	96.3%	1	K.LFTFHADICTLPDTEK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.770.770.1	38.9355	0.326617	1142.76	1143.41	1	169.0	81.2%	1	K.KQTALVELLK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.238.238.1	35.1644	0.240027	818.59	818.903	1	156.0	90.9%	1	K.ATEEQLK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1134.1134.2	73.6449	0.648449	2199.94	2200.52	1	178.0	82.1%	1	K.ATEEQLKTVMENFVAFVDK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1142.1142.3	56.7911	0.551851	2201.83	2200.52	1	247.0	63.8%	1	K.ATEEQLKTVMENFVAFVDK.C	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1220.1220.3	57.1223	0.601214	3938.41	3939.5	1	107.0	65.1%	1	K.ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1175.1175.2	54.7826	0.48313	3138.04	3139.62	1	217.0	65.5%	1	K.TVMENFVAFVDKCCAADDKEACFAVEGPK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1174.1174.3	52.7543	0.495499	3138.76	3139.62	1	224.0	66.2%	1	K.TVMENFVAFVDKCCAADDKEACFAVEGPK.L	3

std_gi|1168350|sp|P00330|ADH1_YEAST

64.1%

348

36823

6.7

ALCOHOL DEHYDROGENASE I gi|3339 (V01292) alcohol dehydrogenase [Saccharomyces cerevisiae] gi|171025 (M38456) alcohol dehydrogenase [Saccharomyces cerevisiae] gi|171027 (J01313) alcohol dehydrogenase 1 [Saccharomyces cerevisiae] [MASS=36823]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.619.619.1	40.9672	0.349812	1136.59	1137.28	1	208.0	85.7%	1	K.GVIFYESHGK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.624.624.2	48.1017	0.387306	1137.64	1137.28	1	196.0	100.0%	1	K.GVIFYESHGK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.549.549.1	34.9736	0.44738	893.68	894.102	1	224.0	91.7%	1	K.DIPVPKPK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.761.761.2	55.0284	0.354177	1014.24	1014.21	1	252.0	82.4%	1	K.ANELLINVK.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.762.762.1	38.4118	0.266423	1016.48	1014.21	1	136.0	92.9%	3	K.ANELLINVK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.824.824.2	91.5702	0.692459	2021.08	2020.36	1	253.0	82.9%	1	K.LPLVGGHEGAGVVVGMGENVK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.827.827.3	46.1301	0.303006	2022.67	2020.36	1	109.0	52.9%	1	K.LPLVGGHEGAGVVVGMGENVK.G	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.614.614.2	44.8667	0.291345	838.04	836.964	1	205.0	84.6%	1	K.IGDYAGIK.W	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.616.616.1	34.0679	0.215514	839.46	836.964	1	184.0	84.6%	1	K.IGDYAGIK.W	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.986.986.2	59.9826	0.477087	3013.38	3014.52	1	125.0	67.6%	1	K.ALKSANLMAGHWVAISGAAGGLGSLAVQYAK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1034.1034.2	94.293	0.642561	2701.16	2702.11	1	174.0	85.7%	11	K.SANLMAGHWVAISGAAGGLGSLAVQYAK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.997.997.3	35.9655	0.299192	2701.99	2702.11	1	2.0	43.4%	1	K.SANLMAGHWVAISGAAGGLGSLAVQYAK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.809.809.1	33.8532	0.269147	1618.85	1619.82	1	168.0	60.9%	1	R.VLGIDGGEGKEELFR.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.804.804.2	70.2778	0.607254	1619.38	1619.82	1	104.0	77.8%	1	R.VLGIDGGEGKEELFR.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.807.807.3	37.6125	0.495131	1622.32	1619.82	1	187.0	44.7%	1	R.VLGIDGGEGKEELFR.S	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.949.949.1	49.1976	0.50359	1312.64	1313.49	1	216.0	83.3%	2	R.SIGGEVFIDFTK.E	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1059.1059.2	74.4819	0.549027	2366.32	2366.76	1	145.0	86.2%	2	R.SIGGEVFIDFTKEKDIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1072.1072.3	42.2639	0.363435	2369.47	2366.76	1	143.0	54.0%	1	R.SIGGEVFIDFTKEKDIVGAVLK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.719.719.1	33.142	0.0875958	1071.74	1072.29	1	177.0	68.8%	1	K.EKDIVGAVLK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.722.722.2	47.354	0.114011	1073.02	1072.29	1	120.0	83.3%	1	K.EKDIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.784.784.1	35.7955	0.280208	814.69	815.001	1	210.0	78.6%	1	K.DIVGAVLK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.786.786.2	39.6792	0.291619	815.62	815.001	1	204.0	84.6%	1	K.DIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.846.846.2	92.5054	0.688861	2312.98	2313.49	1	213.0	85.7%	3	K.ATDGGAHGVINVSVSEAAIEASTR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.839.839.3	38.3988	0.309708	2313.61	2313.49	1	211.0	48.5%	1	K.ATDGGAHGVINVSVSEAAIEASTR.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.737.737.2	32.9009	0.259048	1805.72	1806.14	1	172.0	44.8%	1	R.YVRANGTTVLVGMPAGAK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.739.739.2	50.3211	0.452132	1388.18	1387.64	1	236.0	72.0%	1	R.ANGTTVLVGMPAGAK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.740.740.1	42.2832	0.374626	1389.64	1387.64	1	206.0	72.7%	2	R.ANGTTVLVGMPAGAK.C	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.789.789.1	35.2107	0.437958	1251.72	1252.41	1	66.0	72.2%	1	K.SISIVGSYVGNR.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.771.771.2	66.7166	0.612104	1252.66	1252.41	1	231.0	95.0%	1	K.SISIVGSYVGNR.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.844.844.1	29.0655	0.184642	968.6	969.085	1	176.0	81.8%	1	R.EALDFFAR.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.845.845.2	41.4116	0.264419	969.64	969.085	1	156.0	92.3%	1	R.EALDFFAR.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.580.580.1	38.0641	0.378832	841.81	842.07	1	235.0	84.6%	1	R.GLVKSPIK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.919.919.2	67.4166	0.621881	2271.2	2271.75	1	248.0	71.9%	1	R.GLVKSPIKVVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.915.915.3	57.4076	0.568935	2272.75	2271.75	1	236.0	62.5%	1	R.GLVKSPIKVVGLSTLPEIYEK.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.975.975.3	33.189	0.294278	3271.15	3270.95	1	22.0	56.6%	1	R.GLVKSPIKVVGLSTLPEIYEKMEKGQIVGR.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.904.904.1	53.5894	0.418172	1872.91	1874.23	1	162.0	84.0%	1	K.SPIKVVGLSTLPEIYEK.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.905.905.3	43.7661	0.398564	1874.71	1874.23	1	160.0	56.9%	1	K.SPIKVVGLSTLPEIYEK.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.901.901.2	95.6016	0.702345	1875.28	1874.23	1	249.0	96.2%	1	K.SPIKVVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.874.874.1	46.2227	0.523771	1447.8	1448.7	1	189.0	73.7%	1	K.VVGLSTLPEIYEK.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.875.875.2	61.3315	0.580583	1448.96	1448.7	1	207.0	90.0%	1	K.VVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.304.304.1	29.2525	0.305584	1017.71	1018.23	1	140.0	78.6%	1	K.MEKGQIVGR.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.313.313.1	39.3421	0.314226	811.59	811.91	1	236.0	91.7%	2	R.YVVDTSK.-	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.295.295.2	44.5286	0.511038	812.68	811.91	1	161.0	100.0%	1	R.YVVDTSK.-	2

std_tr|Q865Y7

54.6%

260

29114

6.9

Carbonic anhydrase II (EC 4.2.1.1) - Bos taurus (Bovine).

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.253.253.1	33.1553	0.392694	1141.59	1142.22	1	90.0	83.3%	1	K.HNGPEHWHK.D	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.654.654.2	71.6736	0.632914	2141.66	2142.3	1	163.0	85.7%	1	K.HNGPEHWHKDFPIANGER.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.511.511.1	32.9311	0.374697	1002.53	1003.1	1	38.0	78.6%	2	R.QSPVDIDTK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.512.512.2	47.125	0.488785	1005.06	1003.1	1	49.0	100.0%	2	R.QSPVDIDTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.961.961.2	65.7762	0.607496	2199.94	2199.56	1	132.0	75.0%	1	K.AVVQDPALKPLALVYGEATSR.R	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.964.964.3	49.3874	0.46604	2201.83	2199.56	1	254.0	65.0%	1	K.AVVQDPALKPLALVYGEATSR.R	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.925.925.3	34.0928	0.346601	2358.43	2355.74	1	227.0	40.3%	1	K.AVVQDPALKPLALVYGEATSRR.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.756.756.1	52.7923	0.512247	1581.81	1582.8	1	120.0	93.3%	1	K.YAAELHLVHWNTK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1066.1066.2	70.204	0.567086	2255.12	2254.55	1	157.0	77.1%	1	K.YGDFGTAAQQPDGLAVVGVFLK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.338.338.1	34.3764	0.386268	1012.65	1013.14	1	242.0	80.0%	1	K.VGDANPALQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.339.339.2	59.8789	0.536703	1014.9	1013.14	1	217.0	88.9%	1	K.VGDANPALQK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.775.775.1	40.5571	0.295051	973.64	974.143	1	172.0	85.7%	1	K.VLDALDSIK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.734.734.1	40.768	0.405806	1346.7	1347.58	1	178.0	68.4%	1	K.EPISVSSQQMLK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1064.1064.2	56.881	0.545535	2854.08	2854.3	1	93.0	70.4%	1	R.TLNFNAEGEPELLMLANWRPAQPLK.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1065.1065.3	39.0519	0.398557	2855.32	2854.3	1	185.0	45.7%	1	R.TLNFNAEGEPELLMLANWRPAQPLK.N	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1014.1014.3	36.1403	0.417304	3124.78	3124.59	1	81.0	47.9%	1	R.TLNFNAEGEPELLMLANWRPAQPLKNR.Q	3

	Proteins	Peptide IDs	Copies
Unfiltered	2132	2260	2818
Redundant	7	245	300
Nonredundant	7	245	300

/home/51n/myMS/article/dbdigger/nathanPSM/tryptic/simple4