D simple

DTASelect v1.9
/home/51n/myMS/article/dbdigger/nathanPSM/nonTryptic/simple
/home/51n/myMS/db/psmDB/20040623-Scale-4490.fasta
DBDigger 0.5 in SQT format.
-1 33.97202 -2 35.94482 -3 36.99605 --DB -d 0 -p 2
Jump to the summary table.

sequest.params modifications:

true	Use criteria
33.97202	Minimum +1 XCorr
35.94482	Minimum +2 XCorr
36.99605	Minimum +3 XCorr
0.0	Minimum DeltCN
1	Minimum charge state
3	Maximum charge state
0.0	Minimum ion proportion
1000	Maximum Sp rank
-1.0	Minimum Sp score
Include	Modified peptide inclusion
Any	Tryptic status requirement
true	Multiple, ambiguous IDs allowed
Ignore	Peptide validation handling
XCorr	Purge duplicate peptides by protein
false	Include only loci with unique peptide
false	Remove subset proteins
Ignore	Locus validation handling
0	Minimum modified peptides per locus
10	Minimum redundancy for low coverage loci
2	Minimum peptides per locus

Locus Key:

Validation Status

Locus

Sequence Count

Spectrum Count

Sequence Coverage

Length

MolWt

Descriptive Name

Similarity Key:

Locus

# of identical peptides

# of differing peptides

std_gi|2506462|sp|P02188|MYG_HORSE

100.0%

153

16951

7.8

MYOGLOBIN gi|494712|pdb|1YMB| Metmyoglobin (Horse Heart) gi|494713|pdb|1YMC| Cyanomet-Sulfmyoglobin (Horse Heart) gi|2914628|pdb|1WLA| Myoglobin (Horse Heart) Recombinant Wild-Type gi|2982074|pdb|1AZI| Myoglobin (Horse Heart) Recombinant Wild-Type Complexed With Azide [MASS=16951]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1030.1030.1	46.7143	0.40969	1816.76	1817.01	1	144.0	78.3%	1	-.GLSDGEWQQVLNVWGK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1029.1029.2	75.5249	0.460648	1817.24	1817.01	1	239.0	91.7%	1	-.GLSDGEWQQVLNVWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1190.1190.2	49.0407	0.388369	3404.12	3405.8	1	109.0	61.5%	1	-.GLSDGEWQQVLNVWGKVEADIAGHGQEVLIR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1186.1186.3	45.1688	0.356009	3406.3	3405.8	1	229.0	63.8%	1	-.GLSDGEWQQVLNVWGKVEADIAGHGQEVLIR.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.730.730.1	44.7754	0.271515	1606.92	1607.81	1	161.0	69.6%	1	K.VEADIAGHGQEVLIR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.729.729.2	72.0304	0.514544	1608.1	1607.81	1	232.0	88.0%	1	K.VEADIAGHGQEVLIR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.731.731.1	34.0746	0.296725	1079.64	1080.23	1	210.0	73.3%	1	I.AGHGQEVLIR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.660.660.1	43.4274	0.273931	1271.7	1272.44	1	226.0	81.2%	1	R.LFTGHPETLEK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.662.662.2	50.0784	0.350307	1274.1	1272.44	1	172.0	75.0%	1	R.LFTGHPETLEK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.754.754.2	58.2318	0.353092	1938.0	1938.23	1	162.0	80.8%	1	R.LFTGHPETLEKFDKFK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.666.666.2	43.0817	0.324235	1159.98	1159.28	1	148.0	77.8%	1	L.FTGHPETLEK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.396.396.2	64.1778	0.41543	1363.88	1362.64	1	236.0	94.4%	1	K.FKHLKTEAEMK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.400.400.3	45.2589	0.287318	1364.05	1362.64	1	250.0	61.1%	1	K.FKHLKTEAEMK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.268.268.1	40.8241	0.415541	1086.6	1087.29	1	227.0	92.3%	2	K.HLKTEAEMK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.273.273.2	54.277	0.409476	1088.0	1087.29	1	237.0	100.0%	1	K.HLKTEAEMK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.494.494.2	58.0275	0.462856	1858.6	1859.15	1	6.0	77.8%	1	K.HLKTEAEMKASEDLKK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.421.421.1	46.5011	0.383886	1479.68	1480.68	1	166.0	75.0%	1	K.TEAEMKASEDLKK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.419.419.2	70.2662	0.526603	1480.76	1480.68	1	186.0	95.2%	1	K.TEAEMKASEDLKK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.420.420.3	41.4086	0.231875	1481.77	1480.68	1	234.0	68.3%	1	K.TEAEMKASEDLKK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.929.929.1	53.9155	0.405954	1378.86	1379.69	1	203.0	81.0%	1	K.HGTVVLTALGGILK.K	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.930.930.2	86.2231	0.583014	1379.72	1379.69	1	47.0	100.0%	1	K.HGTVVLTALGGILK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.935.935.3	53.2299	0.227214	1380.16	1379.69	1	63.0	60.9%	1	K.HGTVVLTALGGILK.K	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.854.854.1	56.5563	0.441116	1506.89	1507.86	1	224.0	78.3%	1	K.HGTVVLTALGGILKK.K	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.855.855.2	79.7181	0.613563	1508.36	1507.86	1	118.0	92.0%	1	K.HGTVVLTALGGILKK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.856.856.3	68.4337	0.46676	1508.56	1507.86	1	186.0	79.6%	1	K.HGTVVLTALGGILKK.K	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.319.319.2	63.1093	0.331718	2110.94	2111.41	1	208.0	73.3%	2	K.KKGHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.303.303.3	66.3732	0.431108	2112.19	2111.41	1	191.0	60.0%	1	K.KKGHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.414.414.3	51.9773	0.313029	1260.28	1259.45	1	61.0	82.4%	1	K.KGHHEAELKPL.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.324.324.1	63.1589	0.486677	1982.0	1983.24	1	44.0	80.8%	1	K.KGHHEAELKPLAQSHATK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.323.323.3	65.4288	0.274812	1983.19	1983.24	1	189.0	71.9%	1	K.KGHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.343.343.2	57.4269	0.368192	1983.86	1983.24	1	225.0	71.4%	2	K.KGHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.348.348.1	62.4866	0.484776	1853.86	1855.06	1	52.0	84.0%	1	K.GHHEAELKPLAQSHATK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.373.373.2	49.9343	0.372475	1854.18	1855.06	1	171.0	65.4%	2	K.GHHEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.349.349.3	42.3913	0.359189	1855.72	1855.06	1	169.0	54.9%	1	K.GHHEAELKPLAQSHATK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.356.356.2	54.8855	0.448084	1662.66	1660.87	1	2.0	84.0%	2	H.HEAELKPLAQSHATK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.310.310.1	36.7013	0.287243	952.44	953.087	1	216.0	78.6%	2	K.PLAQSHATK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1111.1111.2	74.0332	0.491173	2602.1	2603.13	1	208.0	88.9%	1	K.HKIPIKYLEFISDAIIHVLHSK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1109.1109.3	51.619	0.421872	2603.53	2603.13	1	94.0	72.3%	1	K.HKIPIKYLEFISDAIIHVLHSK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1097.1097.3	39.0121	0.246313	1886.95	1886.2	1	197.0	53.2%	1	K.YLEFISDAIIHVLHSK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1094.1094.2	77.5591	0.50726	1887.3	1886.2	1	222.0	88.5%	2	K.YLEFISDAIIHVLHSK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1106.1106.1	64.7517	0.526292	1887.82	1886.2	1	164.0	95.8%	2	K.YLEFISDAIIHVLHSK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1052.1052.2	55.0611	0.422794	3369.6	3370.81	1	200.0	75.0%	1	K.YLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1049.1049.3	55.5282	0.490653	3370.69	3370.81	1	216.0	66.7%	1	K.YLEFISDAIIHVLHSKHPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1101.1101.2	71.1643	0.472844	1611.24	1609.87	1	214.0	80.8%	1	L.EFISDAIIHVLHSK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.639.639.1	45.2231	0.480566	1502.58	1503.64	1	173.0	81.0%	1	K.HPGDFGADAQGAMTK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.642.642.3	59.2433	0.45752	1505.14	1503.64	1	255.0	60.9%	1	K.HPGDFGADAQGAMTK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.640.640.2	63.2358	0.503133	1505.38	1503.64	1	40.0	80.8%	1	K.HPGDFGADAQGAMTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.787.787.1	36.2048	0.154463	1360.72	1361.58	1	45.0	72.2%	1	K.ALELFRNDIAAK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.937.937.2	47.1659	0.347599	2284.52	2284.62	1	212.0	62.1%	1	K.ALELFRNDIAAKYKELGFQG.-	2
2	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.155.155.1	34.5707	0.091242	631.7	631.707	1	174.0	90.0%	3	R.NDIAAK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.689.689.2	42.8707	0.253926	942.38	942.059	1	168.0	84.6%	1	K.YKELGFQG.-	2

std_gi|122572|sp|P02070|HBB_BOVIN

95.2%

145

15954

7.6

HEMOGLOBIN BETA CHAIN gi|70412|pir||HBBOB hemoglobin beta chain - bovine gi|576143|pdb|1HDA|B Bos taurus gi|576145|pdb|1HDA|D Bos taurus gi|395 (X00376) beta-globin [Bos taurus] gi|162741 (M63453) beta-globin [Bos taurus] [MASS=15954]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.294.294.2	37.9267	0.131322	823.22	821.97	1	149.0	83.3%	1	-.MLTAEEK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.917.917.2	72.386	0.520775	1753.92	1754.06	1	214.0	78.6%	1	-.MLTAEEKAAVTAFWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.766.766.1	39.0343	0.293929	950.79	951.113	1	91.0	92.3%	1	K.AAVTAFWGK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.776.776.2	54.199	0.396212	952.76	951.113	1	232.0	93.3%	1	K.AAVTAFWGK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.669.669.1	49.7315	0.463332	1328.84	1329.5	1	168.0	90.0%	1	K.VKVDEVGGEALGR.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.670.670.2	77.209	0.485267	1330.0	1329.5	1	236.0	90.9%	1	K.VKVDEVGGEALGR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.632.632.2	69.1014	0.385662	1102.62	1102.19	1	223.0	90.0%	1	K.VDEVGGEALGR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.677.677.2	41.0632	0.181036	887.38	887.969	1	226.0	72.2%	1	D.EVGGEALGR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.895.895.2	48.8856	0.297206	1275.96	1275.54	1	231.0	81.2%	1	R.LLVVYPWTQR.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1169.1169.3	54.1485	0.42779	3348.55	3347.82	1	214.0	64.5%	1	R.LLVVYPWTQRFFESFGDLSTADAVMNNPK.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1170.1170.2	39.2823	0.147222	2761.2	2760.06	1	204.0	62.1%	1	Y.PWTQRFFESFGDLSTADAVMNNPK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.939.939.2	81.8551	0.563074	2090.58	2091.31	1	247.0	80.6%	5	R.FFESFGDLSTADAVMNNPK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.945.945.3	75.4724	0.484368	2091.79	2091.31	1	219.0	74.2%	1	R.FFESFGDLSTADAVMNNPK.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.709.709.1	38.3366	0.369923	1097.45	1098.26	1	74.0	87.5%	1	K.VLDSFSNGMK.H	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.711.711.2	38.1571	0.139673	1098.68	1098.26	1	48.0	66.7%	1	K.VLDSFSNGMK.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.290.290.1	34.0335	0.215491	740.66	740.835	1	224.0	90.0%	1	K.HLDDLK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.931.931.3	63.5463	0.506799	3194.02	3194.6	1	212.0	67.6%	1	K.HLDDLKGTFAALSELHCDKLHVDPENFK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.680.680.1	41.1257	0.276696	1098.65	1099.23	1	171.0	92.3%	1	K.LHVDPENFK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1070.1070.2	66.8384	0.446849	1267.9	1266.61	1	234.0	86.4%	1	K.LLGNVLVVVLAR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.852.852.1	49.1575	0.454399	1869.79	1870.12	1	40.0	72.0%	1	R.NFGKEFTPVLQADFQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.850.850.2	83.0714	0.617435	1870.06	1870.12	1	185.0	92.6%	1	R.NFGKEFTPVLQADFQK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1156.1156.2	38.4617	0.210448	3328.38	3329.79	1	132.0	57.1%	1	R.NFGKEFTPVLQADFQKVVAGVANALAHRYH.-	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1149.1149.3	49.882	0.415148	3330.76	3329.79	1	178.0	64.1%	1	R.NFGKEFTPVLQADFQKVVAGVANALAHRYH.-	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.829.829.1	44.0746	0.435124	1422.66	1423.61	1	179.0	78.9%	1	K.EFTPVLQADFQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.832.832.1	48.8338	0.381951	1045.79	1046.21	1	213.0	92.9%	1	T.PVLQADFQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.685.685.2	75.7945	0.534534	1178.9	1178.38	1	122.0	100.0%	1	K.VVAGVANALAHR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.710.710.2	69.3296	0.482031	1478.84	1478.7	1	120.0	84.0%	1	K.VVAGVANALAHRYH.-	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.707.707.3	45.3617	0.421433	1480.09	1478.7	1	189.0	62.2%	1	K.VVAGVANALAHRYH.-	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.696.696.2	56.3412	0.348106	980.72	980.116	1	236.0	93.8%	1	V.AGVANALAHR.Y	2

std_gi|122361|sp|P01966|HBA_BOVIN

91.5%

141

15053

8.4

HEMOGLOBIN ALPHA CHAIN gi|70238|pir||HABO hemoglobin alpha chain - bovine gi|576142|pdb|1HDA|A Bos taurus gi|576144|pdb|1HDA|C Bos taurus [MASS=15053]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.249.249.1	37.5333	0.126709	703.59	703.814	1	237.0	91.7%	1	-.VLSAADK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.278.278.1	49.0956	0.359165	1101.62	1102.28	1	209.0	93.8%	2	-.VLSAADKGNVK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.281.281.2	49.7811	0.282499	1102.62	1102.28	1	79.0	77.8%	1	-.VLSAADKGNVK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.296.296.2	37.9675	0.0463027	1006.04	1003.14	1	0.0	76.5%	1	V.LSAADKGNVK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.675.675.1	51.1047	0.354077	1529.73	1530.64	1	172.0	81.8%	1	K.VGGHAAEYGAEALER.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.671.671.2	72.8971	0.486343	1531.3	1530.64	1	253.0	87.5%	1	K.VGGHAAEYGAEALER.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.676.676.3	48.3029	0.0348053	1531.33	1530.64	1	247.0	63.8%	1	K.VGGHAAEYGAEALER.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.861.861.2	45.3367	0.189683	1073.02	1072.31	1	227.0	85.7%	1	R.MFLSFPTTK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.865.865.1	36.2059	0.163968	1074.59	1072.31	1	180.0	78.6%	2	R.MFLSFPTTK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.782.782.1	61.6508	0.493681	1833.78	1835.03	1	83.0	87.0%	2	K.TYFPHFDLSHGSAQVK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.779.779.2	66.0048	0.476003	1834.72	1835.03	1	23.0	88.5%	1	K.TYFPHFDLSHGSAQVK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.780.780.3	49.0287	0.379121	1836.22	1835.03	1	202.0	64.0%	1	K.TYFPHFDLSHGSAQVK.G	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.280.280.1	38.7064	0.026807	675.68	673.831	1	170.0	100.0%	1	K.VAAALTK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.879.879.2	86.8138	0.481301	2367.96	2368.61	1	178.0	90.3%	1	K.AVEHLDDLPGALSELSDLHAHK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.880.880.3	79.7881	0.536366	2370.16	2368.61	1	253.0	69.1%	1	K.AVEHLDDLPGALSELSDLHAHK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.869.869.2	92.0881	0.600708	2636.82	2637.96	1	214.0	93.3%	1	K.AVEHLDDLPGALSELSDLHAHKLR.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.870.870.3	74.7218	0.541629	2638.36	2637.96	1	124.0	73.8%	1	K.AVEHLDDLPGALSELSDLHAHKLR.V	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.721.721.2	47.7905	0.350674	1088.7	1088.3	1	206.0	92.3%	1	K.LRVDPVNFK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1020.1020.2	62.8788	0.538611	2970.3	2971.43	1	52.0	70.0%	1	K.LLSHSLLVTLASHLPSDFTPAVHASLDK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1019.1019.3	72.8086	0.486975	2971.51	2971.43	1	230.0	74.3%	2	K.LLSHSLLVTLASHLPSDFTPAVHASLDK.F	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1240.1240.3	69.5215	0.551428	4231.87	4232.91	1	59.0	65.2%	1	K.LLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSK.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.849.849.1	34.9741	0.271464	1279.71	1280.51	1	75.0	77.8%	1	K.FLANVSTVLTSK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.851.851.2	65.8458	0.490367	1281.66	1280.51	1	203.0	86.4%	1	K.FLANVSTVLTSK.Y	2

std_sp|P00698|LYC_CHICK

80.6%

129

14313

9.0

Lysozyme C precursor (EC 3.2.1.17) (1,4-beta-N-acetylmuramidase C) (Allergen Gal d 4) (Gal d IV) - Gallus gallus (Chicken).

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.604.604.1	39.1991	0.276466	836.57	837.051	1	218.0	84.6%	1	R.CELAAAMK.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.540.540.2	56.0614	0.340002	993.8	993.239	1	221.0	86.7%	1	R.CELAAAMKR.H	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.299.299.2	51.7071	0.280343	875.44	874.932	1	215.0	100.0%	1	R.HGLDNYR.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.581.581.1	34.6615	0.327112	1094.66	1095.16	1	148.0	84.6%	1	R.HGLDNYRGY.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.836.836.2	44.8078	0.291826	2125.38	2125.38	1	2.0	66.7%	1	R.HGLDNYRGYSLGNWVCAAK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.650.650.2	60.8061	0.525123	1429.56	1429.49	1	250.0	86.4%	1	K.FESNFNTQATNR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.805.805.2	78.3018	0.488512	1754.84	1754.85	1	244.0	92.0%	1	R.NTDGSTDYGILQINSR.W	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1079.1079.2	104.259	0.621403	2337.8	2338.73	1	171.0	90.6%	7	R.NLCNIPCSALLSSDITASVNCAK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.999.999.2	69.5467	0.504231	2465.9	2466.91	1	152.0	78.1%	2	R.NLCNIPCSALLSSDITASVNCAKK.I	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.847.847.2	91.0454	0.600988	1806.76	1805.07	1	187.0	92.3%	1	K.KIVSDGNGMNAWVAWR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.910.910.2	60.6847	0.211202	1677.92	1676.9	1	186.0	70.4%	1	K.IVSDGNGMNAWVAWR.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.767.767.2	58.8126	0.257265	1046.7	1046.17	1	172.0	93.3%	1	K.GTDVQAWIR.G	2

std_gi|2190337|gnl|PID|e321614

76.1%

607

69324

6.2

(X58989) serum albumin [Bos taurus] gi|3336842|gnl|PID|e1311980 (Y17769) bovine serum albumin [Bos taurus] [MASS=69323]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.223.223.1	38.2432	0.417413	1193.62	1194.29	1	152.0	87.5%	2	R.DTHKSEIAHR.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.205.205.2	56.8498	0.408005	1194.28	1194.29	1	153.0	88.2%	5	R.DTHKSEIAHR.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.635.635.1	46.0359	0.33501	1249.64	1250.4	1	226.0	86.7%	1	R.FKDLGEEHFK.G	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.636.636.2	65.8764	0.384825	1250.54	1250.4	1	216.0	100.0%	1	R.FKDLGEEHFK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1145.1145.3	50.1991	0.502025	4812.7	4813.53	1	156.0	62.5%	1	R.FKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAK.T	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1129.1129.2	72.5643	0.557175	2436.22	2436.84	1	201.0	81.5%	1	K.GLVLIAFSQYLQQCPFDEHVK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1181.1181.3	47.5733	0.407941	3581.65	3582.16	1	229.0	66.7%	1	K.GLVLIAFSQYLQQCPFDEHVKLVNELTEFAK.T	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.814.814.2	57.1295	0.423345	1164.62	1164.34	1	187.0	88.9%	1	K.LVNELTEFAK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.270.270.1	48.5165	0.431921	1349.59	1350.47	1	216.0	84.2%	1	K.TCVADESHAGCEK.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.831.831.1	55.2263	0.521022	1362.68	1363.58	1	244.0	88.9%	1	K.SLHTLFGDELCK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.835.835.2	60.5233	0.511049	1363.88	1363.58	1	46.0	81.8%	1	K.SLHTLFGDELCK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.699.699.2	37.9097	0.200031	2484.82	2485.69	1	0.0	59.3%	1	K.QEPERNECFLSHKDDSPDLPK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.450.450.1	36.0616	0.0473329	886.43	886.934	1	186.0	83.3%	1	K.DDSPDLPK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1076.1076.3	45.2614	0.4215	4343.95	4344.98	1	90.0	63.6%	1	R.RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK.I	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.361.361.2	36.7452	0.00418291	919.96	919.136	1	208.0	76.9%	1	R.LRCASIQK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.367.367.2	44.7435	0.203898	848.06	848.033	1	30.0	100.0%	1	R.LSQKFPK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.634.634.1	43.683	0.179679	922.68	923.054	1	224.0	100.0%	1	K.AEFVEVTK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.637.637.2	53.8103	0.317038	923.6	923.054	1	211.0	100.0%	1	K.AEFVEVTK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.584.584.1	35.0314	0.185711	789.68	789.948	1	207.0	81.8%	1	K.LVTDLTK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.589.589.1	34.9589	0.0996255	676.73	676.788	1	182.0	90.0%	1	L.VTDLTK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.714.714.2	50.0527	0.294502	2441.8	2442.76	1	87.0	64.5%	1	K.VHKECCHGDLLECADDRADLAK.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.622.622.1	37.2267	0.402698	1386.61	1387.51	1	169.0	72.2%	1	K.YICDNQDTISSK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.626.626.2	71.1827	0.409816	1387.74	1387.51	1	143.0	95.0%	1	K.YICDNQDTISSK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.620.620.1	41.2669	0.309071	1418.62	1419.75	1	104.0	77.8%	1	K.LKECCDKPLLEK.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.621.621.2	58.8423	0.441607	1419.8	1419.75	1	244.0	85.0%	1	K.LKECCDKPLLEK.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.630.630.3	41.9713	0.1875	1420.33	1419.75	1	181.0	59.0%	1	K.LKECCDKPLLEK.S	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.353.353.1	41.4493	0.262357	1015.53	1016.16	1	228.0	85.7%	1	K.SHCIAEVEK.D	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.911.911.3	76.4799	0.56658	3398.86	3399.82	1	240.0	73.8%	1	K.SHCIAEVEKDAIPENLPPLTADFAEDKDVCK.N	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.889.889.3	42.3091	0.36473	4133.08	4133.6	1	228.0	60.7%	1	K.SHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAK.D	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1026.1026.1	38.1141	0.348441	1567.74	1568.73	1	136.0	73.7%	1	K.DAFLGSFLYEYSR.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.744.744.2	59.9955	0.456981	1441.2	1440.69	1	164.0	86.4%	1	R.RHPEYAVSVLLR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.752.752.3	48.3442	0.362587	1441.69	1440.69	1	233.0	65.8%	1	R.RHPEYAVSVLLR.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.906.906.3	38.2211	0.264302	3421.96	3422.88	1	208.0	56.4%	1	R.LAKEYEATLEECCAKDDPHACYSTVFDKLK.H	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.724.724.1	42.0054	0.281497	1305.72	1306.51	1	205.0	81.2%	1	K.HLVDEPQNLIK.Q	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.725.725.2	61.2466	0.372835	1308.14	1306.51	1	190.0	88.9%	1	K.HLVDEPQNLIK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.811.811.2	76.7163	0.480391	2299.84	2299.57	1	225.0	89.3%	1	K.HLVDEPQNLIKQNCDQFEK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1044.1044.3	52.2706	0.483857	3760.54	3761.25	1	174.0	65.0%	1	K.HLVDEPQNLIKQNCDQFEKLGEYGFQNALIVR.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.959.959.2	48.8654	0.336174	2473.0	2473.77	1	37.0	64.3%	1	K.QNCDQFEKLGEYGFQNALIVR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1045.1045.2	38.1144	0.296484	1882.18	1885.17	1	6.0	53.6%	1	Q.FEKLGEYGFQNALIVR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.881.881.1	36.2	0.340829	1479.68	1480.71	1	136.0	70.0%	1	K.LGEYGFQNALIVR.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.882.882.2	69.8211	0.510184	1481.72	1480.71	1	234.0	82.6%	1	K.LGEYGFQNALIVR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.749.749.1	36.4322	0.342365	1639.92	1640.92	1	16.0	69.6%	1	R.KVPQVSTPTLVEVSR.S	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.745.745.2	66.2781	0.466213	1640.64	1640.92	1	106.0	87.5%	1	R.KVPQVSTPTLVEVSR.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.751.751.3	45.7976	0.33362	1641.16	1640.92	1	252.0	65.3%	1	R.KVPQVSTPTLVEVSR.S	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1050.1050.2	76.0292	0.500763	1668.92	1668.97	1	246.0	95.7%	1	R.MPCTEDYLSLILNR.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.445.445.2	47.5733	0.278036	842.54	842.05	1	244.0	100.0%	1	R.LCVLHEK.T	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.657.657.2	59.555	0.425694	1484.22	1483.77	1	252.0	86.4%	1	R.LCVLHEKTPVSEK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.799.799.2	50.6921	0.30836	1825.74	1825.09	1	153.0	64.3%	1	R.RPCFSALTPDETYVPK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.800.800.3	38.9432	0.0920752	1826.89	1825.09	1	189.0	58.0%	1	R.RPCFSALTPDETYVPK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.941.941.2	95.6942	0.641978	2441.8	2442.75	1	201.0	86.2%	1	K.AFDEKLFTFHADICTLPDTEK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.920.920.2	67.5318	0.497758	2811.82	2812.22	1	201.0	78.6%	1	K.AFDEKLFTFHADICTLPDTEKQIK.K	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.912.912.1	64.7564	0.52853	1850.74	1852.12	1	138.0	91.7%	1	K.LFTFHADICTLPDTEK.Q	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.909.909.2	84.3468	0.515356	1852.1	1852.12	1	250.0	96.3%	1	K.LFTFHADICTLPDTEK.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.770.770.1	38.9355	0.202186	1142.76	1143.41	1	169.0	81.2%	1	K.KQTALVELLK.H	1
*2	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.238.238.1	35.1644	0.226527	818.59	818.903	1	156.0	90.9%	1	K.ATEEQLK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1134.1134.2	73.6449	0.538976	2199.94	2200.52	1	178.0	82.1%	1	K.ATEEQLKTVMENFVAFVDK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1142.1142.3	56.7911	0.424114	2201.83	2200.52	1	247.0	63.8%	1	K.ATEEQLKTVMENFVAFVDK.C	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1220.1220.3	57.1223	0.530131	3938.41	3939.5	1	107.0	65.1%	1	K.ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1175.1175.2	54.7826	0.399939	3138.04	3139.62	1	217.0	65.5%	1	K.TVMENFVAFVDKCCAADDKEACFAVEGPK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1174.1174.3	52.7543	0.444705	3138.76	3139.62	1	224.0	66.2%	1	K.TVMENFVAFVDKCCAADDKEACFAVEGPK.L	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1177.1177.3	67.1972	0.468802	2939.5	2939.38	1	237.0	73.3%	1	V.MENFVAFVDKCCAADDKEACFAVEGPK.L	3

std_tr|Q865Y7

64.6%

260

29114

6.9

Carbonic anhydrase II (EC 4.2.1.1) - Bos taurus (Bovine).

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.654.654.2	71.6736	0.583562	2141.66	2142.3	1	163.0	85.7%	1	K.HNGPEHWHKDFPIANGER.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.434.434.2	50.3688	0.365129	1284.8	1284.42	1	224.0	80.0%	1	W.HKDFPIANGER.Q	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.435.435.3	37.513	0.192349	1287.22	1284.42	1	179.0	67.6%	1	W.HKDFPIANGER.Q	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.512.512.2	47.125	0.386054	1005.06	1003.1	1	49.0	100.0%	2	R.QSPVDIDTK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.521.521.1	44.4316	0.297023	874.65	874.967	1	222.0	84.6%	1	Q.SPVDIDTK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.517.517.1	44.316	0.231172	787.66	787.889	1	231.0	90.9%	1	S.PVDIDTK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.961.961.2	65.7762	0.518779	2199.94	2199.56	1	132.0	75.0%	1	K.AVVQDPALKPLALVYGEATSR.R	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.964.964.3	49.3874	0.366065	2201.83	2199.56	1	254.0	65.0%	1	K.AVVQDPALKPLALVYGEATSR.R	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.971.971.2	57.0366	0.468554	2029.46	2029.34	1	134.0	65.6%	1	V.VQDPALKPLALVYGEATSR.R	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.967.967.1	55.3902	0.474719	1276.66	1277.46	1	71.0	94.4%	1	K.PLALVYGEATSR.R	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.600.600.2	51.9421	0.444711	1067.7	1067.19	1	205.0	73.7%	1	L.ALVYGEATSR.R	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.497.497.2	36.2803	0.209204	1223.7	1223.38	1	44.0	57.1%	1	L.ALVYGEATSRR.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.756.756.1	52.7923	0.373058	1581.81	1582.8	1	120.0	93.3%	1	K.YAAELHLVHWNTK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1066.1066.2	70.204	0.535998	2255.12	2254.55	1	157.0	77.1%	1	K.YGDFGTAAQQPDGLAVVGVFLK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.338.338.1	34.3764	0.226842	1012.65	1013.14	1	242.0	80.0%	1	K.VGDANPALQK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.339.339.2	59.8789	0.448976	1014.9	1013.14	1	217.0	88.9%	1	K.VGDANPALQK.V	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.775.775.1	40.5571	0.140629	973.64	974.143	1	172.0	85.7%	1	K.VLDALDSIK.T	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1392.1392.3	38.1471	0.313395	4532.89	4533.29	1	70.0	48.8%	1	L.PNVLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSQQMLK.F	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1390.1390.2	38.5765	0.164986	3381.26	3381.01	1	196.0	44.4%	1	Y.PGSLTTPPLLESVTWIVLKEPISVSSQQMLK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.815.815.2	61.6824	0.49715	1800.62	1801.2	1	163.0	84.0%	1	W.IVLKEPISVSSQQMLK.F	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.820.820.3	62.6515	0.470064	1803.55	1801.2	1	219.0	74.0%	1	W.IVLKEPISVSSQQMLK.F	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.734.734.1	40.768	0.270766	1346.7	1347.58	1	178.0	68.4%	1	K.EPISVSSQQMLK.F	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1064.1064.2	56.881	0.449011	2854.08	2854.3	1	93.0	70.4%	1	R.TLNFNAEGEPELLMLANWRPAQPLK.N	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1065.1065.3	39.0519	0.239538	2855.32	2854.3	1	185.0	45.7%	1	R.TLNFNAEGEPELLMLANWRPAQPLK.N	3

std_gi|1168350|sp|P00330|ADH1_YEAST

60.6%

348

36823

6.7

ALCOHOL DEHYDROGENASE I gi|3339 (V01292) alcohol dehydrogenase [Saccharomyces cerevisiae] gi|171025 (M38456) alcohol dehydrogenase [Saccharomyces cerevisiae] gi|171027 (J01313) alcohol dehydrogenase 1 [Saccharomyces cerevisiae] [MASS=36823]

	Filename	XCorr	DeltCN	ObsM+H+	CalcM+H+	SpR	SpScore	Ion%	#	Sequence
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.619.619.1	40.9672	0.303421	1136.59	1137.28	1	208.0	85.7%	1	K.GVIFYESHGK.L	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.624.624.2	48.1017	0.38313	1137.64	1137.28	1	196.0	100.0%	1	K.GVIFYESHGK.L	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.549.549.1	34.9736	0.183478	893.68	894.102	1	224.0	91.7%	1	K.DIPVPKPK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.761.761.2	55.0284	0.274989	1014.24	1014.21	1	252.0	82.4%	1	K.ANELLINVK.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.762.762.1	38.4118	0.0311701	1016.48	1014.21	1	136.0	92.9%	2	K.ANELLINVK.Y	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.824.824.2	91.5702	0.607869	2021.08	2020.36	1	253.0	82.9%	1	K.LPLVGGHEGAGVVVGMGENVK.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.827.827.3	46.1301	0.282241	2022.67	2020.36	1	109.0	52.9%	1	K.LPLVGGHEGAGVVVGMGENVK.G	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.614.614.2	44.8667	0.276098	838.04	836.964	1	205.0	84.6%	1	K.IGDYAGIK.W	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.616.616.1	34.0679	0.163459	839.46	836.964	1	184.0	84.6%	1	K.IGDYAGIK.W	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.986.986.2	59.9826	0.451343	3013.38	3014.52	1	125.0	67.6%	1	K.ALKSANLMAGHWVAISGAAGGLGSLAVQYAK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1034.1034.2	94.293	0.618193	2701.16	2702.11	1	174.0	85.7%	11	K.SANLMAGHWVAISGAAGGLGSLAVQYAK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.804.804.2	70.2778	0.560662	1619.38	1619.82	1	104.0	77.8%	1	R.VLGIDGGEGKEELFR.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.807.807.3	37.6125	0.056	1622.32	1619.82	1	187.0	44.7%	1	R.VLGIDGGEGKEELFR.S	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.812.812.2	62.7271	0.535635	1407.94	1407.52	1	43.0	85.0%	1	L.GIDGGEGKEELFR.S	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.949.949.1	49.1976	0.397121	1312.64	1313.49	1	216.0	83.3%	2	R.SIGGEVFIDFTK.E	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1059.1059.2	74.4819	0.443323	2366.32	2366.76	1	145.0	86.2%	2	R.SIGGEVFIDFTKEKDIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1072.1072.3	42.2639	0.330724	2369.47	2366.76	1	143.0	54.0%	1	R.SIGGEVFIDFTKEKDIVGAVLK.A	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.1067.1067.2	69.7111	0.429277	2166.16	2166.52	1	58.0	80.0%	1	I.GGEVFIDFTKEKDIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.722.722.2	47.354	0.284476	1073.02	1072.29	1	120.0	83.3%	1	K.EKDIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.784.784.1	35.7955	0.0950958	814.69	815.001	1	210.0	78.6%	1	K.DIVGAVLK.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.786.786.2	39.6792	0.0528564	815.62	815.001	1	204.0	84.6%	1	K.DIVGAVLK.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.846.846.2	92.5054	0.557758	2312.98	2313.49	1	213.0	85.7%	3	K.ATDGGAHGVINVSVSEAAIEASTR.Y	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.839.839.3	38.3988	0.100876	2313.61	2313.49	1	211.0	48.5%	1	K.ATDGGAHGVINVSVSEAAIEASTR.Y	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.739.739.2	50.3211	0.381856	1388.18	1387.64	1	236.0	72.0%	1	R.ANGTTVLVGMPAGAK.C	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.740.740.1	42.2832	0.231905	1389.64	1387.64	1	206.0	72.7%	2	R.ANGTTVLVGMPAGAK.C	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.736.736.1	34.3569	0.269332	1202.68	1202.46	1	228.0	57.9%	1	N.GTTVLVGMPAGAK.C	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.789.789.1	35.2107	0.2999	1251.72	1252.41	1	66.0	72.2%	1	K.SISIVGSYVGNR.A	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.771.771.2	66.7166	0.533642	1252.66	1252.41	1	231.0	95.0%	1	K.SISIVGSYVGNR.A	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.845.845.2	41.4116	0.333578	969.64	969.085	1	156.0	92.3%	1	R.EALDFFAR.G	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.580.580.1	38.0641	0.188579	841.81	842.07	1	235.0	84.6%	1	R.GLVKSPIK.V	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.919.919.2	67.4166	0.488538	2271.2	2271.75	1	248.0	71.9%	1	R.GLVKSPIKVVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.915.915.3	57.4076	0.378692	2272.75	2271.75	1	236.0	62.5%	1	R.GLVKSPIKVVGLSTLPEIYEK.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.904.904.1	53.5894	0.458813	1872.91	1874.23	1	162.0	84.0%	1	K.SPIKVVGLSTLPEIYEK.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.905.905.3	43.7661	0.29027	1874.71	1874.23	1	160.0	56.9%	1	K.SPIKVVGLSTLPEIYEK.M	3
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.901.901.2	95.6016	0.610664	1875.28	1874.23	1	249.0	96.2%	1	K.SPIKVVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.874.874.1	46.2227	0.416138	1447.8	1448.7	1	189.0	73.7%	1	K.VVGLSTLPEIYEK.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.875.875.2	61.3315	0.486929	1448.96	1448.7	1	207.0	90.0%	1	K.VVGLSTLPEIYEK.M	2
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.876.876.1	39.6259	0.389705	1249.64	1250.43	1	186.0	64.7%	1	V.GLSTLPEIYEK.M	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.313.313.1	39.3421	0.201184	811.59	811.91	1	236.0	91.7%	2	R.YVVDTSK.-	1
*	PSM_10ugul_50ulInj_LCMSMS_2nd_120602-anno.295.295.2	44.5286	0.167939	812.68	811.91	1	161.0	100.0%	1	R.YVVDTSK.-	2

	Proteins	Peptide IDs	Copies
Unfiltered	1717	2260	3116
Redundant	7	240	288
Nonredundant	7	240	288

/home/51n/myMS/article/dbdigger/nathanPSM/nonTryptic/simple